BYKdb

Dataset for cluster orphancd of phylum chrysiogenetes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A524JK64 [Bacteria] Bacterial tyrosine kinase [Chrysiogenetes][Chrysiogenales bacterium] (length=332 residues).
MGNVLRALKKSAQQQNVQEQSAVHVVSMAVAEAEQATADILDGETVTVVEATPAPAPKAAHTAVAEAIRQATRITTPAGQ
STPPRQAIAGHRDTAGAEPRVAPMRRSSCFSPLILTHHRPRCQVSEQIRQIRTALIRLAHSGPVRCMITSSQPREGKTVT
AVNLAYTFSEVAEKKTLLIDADLRRGSVAPLLGMTRRNGLADLLAGACTPEEAIWSAGRSNFHVLTAGTVKLDQIGELLS
GAKADRVMTDLHSRYDFVVIDSPPVISVADAGILGRWADMAVLAVRIHRTHRDQVEQATQILEGVGVPVAGLIALDEKAT
GRKYYRYAGYTY
© 1998-2020Legal notice