BYKdb

Dataset for cluster tadcd of phylum candidatus-coatesbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F5FG50      MEQTTNPGRGRGAPKVSEYLLVLRKRKWIIIFAVLFSLTVAAYQSYTTSPTYVATASLVL
A0A7C1HG95      MEQSQTDSPGRAVPKIGEFVAVLRKRKWIIIFAVLFSVTVAAYQSYTTPPTFMATASLVL
                ***: . . **..**:.*:: ****************:**********.**::*******

A0A1F5FG50      ETSGQSTDLLQGFYTSFQPYRLETELQIISSRTICLGVVERLDLAFHPQVQLPDGVFFQD
A0A7C1HG95      ESSAQDTSLIPGFYTAFQPYRLETELQIIQSRSICLGVVERLNLAFHPKGRLAEGAYFEN
                *:*.*.*.*: ****:*************.**:*********:*****: .*.:*.:*::

A0A1F5FG50      PFVKVGFPAGRYRVIEGESGFSVMDDAHNVIGECLYEQPFVSNDGLFGFTLHDPEPHPKR
A0A7C1HG95      PKVELGFPVGAYRLVEGERGFVVIDSSRQPLGEGVYGKPFASKDGLLHFVFFDPNPQPKR
                * *::***.* **::*** ** *:*.:.: :** :* :**.*:***: *.:.**:*:***

A0A1F5FG50      IISFRVTNPIQEAESIRQATTVQQSSDSNAFTVSVSHTDPKMVARLANTIAEVYVDENLR
A0A7C1HG95      ILSFTVTDPISEAEAIRQATTVRQAKDSNAFTISVSHTDPNMAAALANAVAEVYVEENLR
                *:** **:**.***:*******.*:.******:*******:*.* ***::*****:****

A0A1F5FG50      WKQERARKAREFIGQQIEVAEVKLRLTEDLLREYKEELGIVSFTDEARELIHRLSVVEEN
A0A7C1HG95      WKRERARKAREFIGQQIEVAEVKLRLTEDLLREYKEELGIVSFSDEARMLVMQLSGNQDS
                **.****************************************:**** *: .**  ::.

A0A1F5FG50      RNSLEQELAELEEQQGTVENYLNRGEIDLDTLTAMSSWPAFQTDQMLKEFVRTAGELTLE
A0A7C1HG95      RANLEMELAELEEQKRTIENYLAAGELDLGLLTAISSWPAFQTDQLLRQLTAKASELEVE
                * .** ********: *:****  **:**. ***:**********:*.::. .*.** :*

A0A1F5FG50      KQQLRQTSGLLNPRLAEIDGELDAVEGGIERRLTYIATSGALGISIEGAKSKLDETSNSI
A0A7C1HG95      KRRLKET-GPLNPRLAEIDRELESLKCAIREQLFYISGYGSLAVSLEGLRGKIAEKGRFI
                *..*.:* * ********* **:::: .*  .* **:  *:*.:*:** ..*: *... *

A0A1F5FG50      SELTAELSTMPREEMELSIRERKSDVASKIHSLLLERYEEARINESMETGDVRIIDRAIR
A0A7C1HG95      SRTLVEMETMPGQEMELALRERKSQVASKIHGLLLERYEEARINESMETGDVRIIDLAIR
                *   .*:.*** :****::*****:******.************************ ***

A0A1F5FG50      PTAPVSPNHASDLLLGLAVGLVIGIGLAMIVEMNDTTVKSADEVTGLTGLSPIGTIPKAT
A0A7C1HG95      PRAPTSPNHTSDVLLGFAIGLVIGIALAMLVEAQDTTVKSAEEVGKLTGLSSLGQVPKTG
                * **.****:**:***:*:******.***:** :*******:**  *****.:* :**: 

A0A1F5FG50      EEFEELGEGRLIVLENPRSPIAETYRIIRTNIQYFGIDKQIRVLSITSPSKGEGKTTTTA
A0A7C1HG95      ---EGVGDERLVVLAEPLSAIAEAYRIIRTNIAYFAVEKELCLLCLTSPGKGEGKTTTTA
                   * :*: **:** :* *.***:******** **.::*:: :*.:***.**********

A0A1F5FG50      NLGVSIAQQGHKTLLVDTDLRKAKMHRFFNIPNTPGFTELILGDRTDEEVIRPTQVENLF
A0A7C1HG95      NLGVCFAQQGLTTLIIDTDLRKAKMNRLFRVPQTPGFTELILGDASIDDVIRPTGVENLS
                ****.:**** .**::*********:*:*.:*:*********** : ::***** **** 

A0A1F5FG50      VLPSGHPPPNPSELLSSRRTQDILERFRQEYDKVILDTSPVLAVTDPAVLGSLVDGTILV
A0A7C1HG95      VLPSGHSPPNPSELLSSKRTLDLLGHFKSSYAKVLLDTSPVLAVTDPAILSRSSDGTILV
                ******.**********.** *:* .*...* **:*************:*.   ******

A0A1F5FG50      IEAEVSEAEAVKEAVNLLKNARAQILGFVLNKVDLTRTYKSNRYYHYYYYHHDDEAERSK
A0A7C1HG95      VEAESSEAEAVKEAAQLLRNARANLFGFVLNKVDPSRTYKSHFYYHYY---HSDDDGPTK
                :*** *********.:**.****:::******** :*****: *****   *.*:   :*

A0A1F5FG50      GSIWKRFRGKK
A0A7C1HG95      GSIWKRFRGKK
                ***********

© 1998-2021Legal notice