BYKdb

Dataset for cluster tadcd of phylum candidatus-kryptonia

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A0N7MUP1 [Bacteria] Bacterial tyrosine kinase [Candidatus Kryptonia][Candidatus Kryptonium thompsoni] (length=777 residues).
MEKINTNGQTFFQTEEETINLYEVIQVLYRGKWLIILVFILVVLATATFTFMQDPIYESTAVVLIEKGKKGVGLTEAFDI
TGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVDPENKKDTILVILPSKKELKEGIKPFAKIETILERFKEDVKIESP
RDADIIKITVRSKNPKEAALIANTFADSYYESNLMMSRNESRSVRMFLEEQLAEKRKLLRQAEAQLENYMKQAGVVALDE
ESKELIKQLSDLESKRGETIVDISSAKRKLDSYLEQIKQIEPEFVKVATEALDPYIKYLQEEIAKLEVTRDQIIAQNPKV
GSKEVLNKSLREIDEQLASLRKKLQDKISEFLKIGFASSGSPGTQSYDPTGFVKELKQKILLTEIELSAYEARKKELDRL
IEQLNKKFETIPSKLIDYARLERTRLSNEKLYLLIEEKYQEAMIAERSQFGYVQIIDYATPGIKPVSPKVHLNLIIGIVL
GLGLGVTIVFVREFFDRTVRSPEQLEKRGFTVLSAIPVIEVEVKLDGKQLKKDEGRNIAAHLITHLNPKSPVAEAYRVLR
TGIQFAKLDRKIKSIVVASSAPKEGKSTTSSNLAITMAKANLKTVLVDADLRRPVLHRVFGVKREPGLTDYLFERAELDE
IFRKTDIENLYLIPCGVVPPNPSELLGSEKMKKFVEYLKSNYDLVVFDTPPLVAVADALILANQVDGVLLVASAGKTEID
VLDKAREMIQRVEGNVIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADREKGEGNA
>gnl|bykdb|A0A0P1MWA2 [Bacteria] Bacterial tyrosine kinase [Candidatus Kryptonia][Candidatus Chrysopegis kryptomonas] (length=777 residues).
MEKTNVNGQPFFQTEEETINLYEVIQVLYRGKWLVILIFILVVLATAIFTFMQDPIYESTAVVLIERGKKGLGLTEAFDI
TGLSEQRNIKNEIEILKSRSLAEAVAKKLIDRVYVDLNDKKDTILIIKPSRKELKEGIKPFAKIETIIERFEKDVKIESP
RDADIIKITVRSKNPKEAALIANTFADAYYERNLMMSRNESRSVRKFLEEQLADKKKLLDQAENQLESYMKSAGVVALDE
ESKKLIEQLANLESKRGEAIVEISSAEKKLNAYLEQIKQIEPEFVKVATEALDPYIKYLQEEIAKLEVTRDQIIAQNPKV
GSQEVLNKSLREIDEQLASLRKKLQEKIAEFLKTGFASSGSPGTQTYDPTGFVKELKQKILLTEIELTAYEAKKRELERL
IEQLNRKFETIPAKLIDYARLERARMSSEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGLKPVSPKIHLNLILSIIV
GLGLGVGIVFVKEYFDRTIKTPEQIEKRGFTVLSAIPIIEVETKLDGKQLKKDEGRNIAAHLITHLSPKSHIAEAYRVLR
TGIQFAKLDKKIKSIVVASSAPKEGKSTTASNLAITMASAGLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAEIEE
IFKQTEVENLYLVPCGVVPPNPAELLGSEKMKEFIEYLKLNYEMVIFDTPPLVAVTDALIIASQVDGVLLVASAGKTEID
VLDKAREMIQRVGGTVIGVLLNNFDASSTYGTYYRYYRYYRYYDYYGADRDKGEGKK
>gnl|bykdb|A0A0S4MUQ7 [Bacteria] Bacterial tyrosine kinase [Candidatus Kryptonia][Candidatus Thermokryptus mobilis] (length=774 residues).
MEKIGTNGQTFFQEEETINLYEVIQVLYRGKWLIILIFILVVLATAIFTFMQDPIYESTAVILIEKGKKGLGLAQAFDIT
GFSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVEPEKKSDTILVILPSRKELKEGIKPFAKIETIIERFEKNVKIESPR
DADIIKITARSKNPKEAALIANTFADAYYERNLMMSRNESRSVRKFLEEQLADKRKQLDQAENQLESYMKSAGVVALDEE
SKKLIEQLSNLESARGEAIVDISAAKKKLDSYLEQIKQIEPEFVKVATEALDPYIKYLQEEIAKLEVTRDQIIAQNPKVG
SQEVLNKSLREIDEQLASLRKKLQEKIAEFLKTGFASSGSPGTQTYDPTGFVKELKQKILLTEIELSAYEARKKEIEKLI
EQLNRKFETIPAKLIDYARLERARMSAEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGVRPVSPKVHLNLILSIIIG
LGLGVGIVFVKEYFDRSVKTPEQLEKRGFTVLSAIPVIEIEAKLDGKQLRKDEGRNIAAHLITHLSPKSPVAEAYRVMRT
GIQFAKLDKKIKSIVVASSAPKEGKSTTASNLAITMATAGLKTVLVDTDLRRPVLHRVFNVPREPGLTDYLFDRADVQEI
FKQTEVENLYLVPCGVVPPNPAELLGSEKMKEFVEYLKLNYDFVVFDTPPLVAVTDALILASQVDSVLLVASAGKTEIDV
LEKAREMVQRVGGNVIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADRDKSRG
© 1998-2020Legal notice