BYKdb

Dataset for cluster orphancd of phylum candidatus-aminicenantes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A523X2C8      YTSSSRVYVEQSGPKIISKYEGIMTQSSNYLYTQGELIISTPIVVDVVNDSKIKQFRTFA
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
                                                                            

A0A523X2C8      DVDNLVAYIKNNLNVRIGRKDDIIAVSFDSPYPVEAAEIVNAVVQSYINYHSTRKRSTVS
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
                                                                            

A0A523X2C8      EVLRIIQKEKVKRDKELSDKFAELLEFARENSEVSLDNQGGNIFLTRLTKLSTAVTDAQL
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
                                                                            

A0A523X2C8      NTLNAKADYEAIKSMEDEPAKVKQFASASSTAGVRVFVNDTETQLKAELRAVEIELQSAR
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
                                                                            

A0A523X2C8      YHCTEDHPTIQAIHAKIDRIKQELESQAREFADSYAEVMRLRWTTAMEREDELQASFDAQ
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
                                                                            

A0A523X2C8      FQASCDLGIKATEYSVLQSELRRTERLCEILDDRIKELNVTEDVGALNISILEVARPADS
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
                                                                            

A0A523X2C8      PSKPEKGKCMAMALAFGLTLGGGLAVLRDMFDYRLRSADEVSVVLGIAVLGVIPTMS--D
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      -------------------------------DNTVKTSEDVEKYAHLPALGIVPTFTVDG
                                                                            

A0A523X2C8      RKAVALPGHKVRGLLKRIIAGSHQRTGATTSSGTAKSESVPAQDDGEAIIGSRSIMERAQ
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      YRKGYGYGYGQRGHAKGIILKTTDGIHQTEDKGG--------------------------
                                                                            

A0A523X2C8      KVRSELEYIRCIHGTSKKTHEAVCTIASPNEAGRKTEDTAVNSPIAGKDKTTTKIISEKP
A0A3D4NYA6      --------------------------------------------------------MVEP
A0A3D4P3H6      ---------------------------------------------AGAEARESGAKNQGT
                                                                           .

A0A523X2C8      DIVKRGQKAYLEPKSIVAEAYRTIRTAVFFGIPQEEAKTILITSPAPSDGKSTVTSNLAI
A0A3D4NYA6      KVKSIELIAHLSPKSNLAESYRTIRTSLLLSSADKKPKSIVVTSALPEEGKSATLCNLAV
A0A3D4P3H6      QVKSIELISHRWPKSDYAESYRSIRTSLLLSTADPNLKVIVVTSALASEGKTATVSNLAV
                .: .    ::  ***  **:**:***::::. .: : * *::**. ..:**::. .***:

A0A523X2C8      TMAQAGQKTLVLDADFRKPIQHNIFQIDSKEGLSNLLAGTINIKEAIQPGPVENLDILNC
A0A3D4NYA6      TLAQAGKTVLIVDSDFRRPTQHKIFKIRNINGLTNYLTSEMELKALVKETGIPKLYLINV
A0A3D4P3H6      VLAQAGKHVLILDADLRKPRQHRIFGIRNLNGLTNYLTANLELKALFKQTEIPLLYLINA
                .:****: .*::*:*:*.* **.** * . :**:* *:. :::*  .:   :  * ::* 

A0A523X2C8      GIEVPNPSEVLNSNSFAKVLKVFSEQYDRVIIDSPPVGPVADSQILAALCDITLLVLRAE
A0A3D4NYA6      GPVPPNPAELLGSEKMGNLIESLKQWFDFILFDSPPVLTVSDAMVLGPKIDGIILVVWGG
A0A3D4P3H6      GPVPPNPAELLGSDKMAGLIEYLKPHFHYILIDTPPMLAVSDALVLGPKLDGVVLIVQGE
                *   ***:*:*.*:.:. ::: :. .:  :::*:**: .*:*: :*..  *  :*::.. 

A0A523X2C8      RSTRRQSQHVRDSLLSVGGHILGAIVNDVPRKHGRYGYYYAGRYGGYGYYSHYGYYGNKE
A0A3D4NYA6      KTAKDALKQAKERLDMLKVKCLGVVINNLNIQ--EHDYYHM--------HHHYHYYGEGK
A0A3D4P3H6      KTSREAMKRAKEKLDLLKIKSLGVVINNLNLQ--RHDYYYK--------RYYYHYYGEE-
                .::.   :...: *  :  : **.::*::  :   :.**:           :* ***:  

A0A523X2C8      KKKVLAG
A0A3D4NYA6      GGEKTT-
A0A3D4P3H6      -------
                       

© 1998-2020Legal notice