BYKdb

Dataset for cluster orphancd of phylum candidatus-aminicenantes

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
A0A523X2C8      YTSSSRVYVEQSGPKIISKYEGIMTQSSNYLYTQGELIISTPIVVDVVNDSKIKQFRTFA
A0A7C5QCG4      --------INSQSHSMLLKSRSLASEVIDKM-----KLAENPEYVGSLKKDKAEKYKSNP
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
A0A523X2C8      DV-DNLVAYIKNNLNVRIGRKDDIIAVSFDSPYPVEAAEIVNAVVQSYINYHSTRKRSTV
A0A7C5QCG4      VFREKLIDGFIKNLIVTPISGTKLIEVNFEHKNPELASQILNTLFDSYIEMLIKRKYTAS
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
A0A523X2C8      SEVLRIIQKEKVKRDKELSDKFAELLEFARENSEVSLDNQGGNIFLTRLTKLSTAVTDAQ
A0A7C5QCG4      EQATEFLSTQIASLRKDIEEAEKKLAELGTAQGILPLSSAEAPL-ISKITEVNTALTAAT
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
A0A523X2C8      LNTLNAKADYEAIKSMEDEPAKVKQFASASSTAGVRVFVNDTETQLKAELRAVEIELQSA
A0A7C5QCG4      LDKVNKLTTYNQLRALRPE-----ELPESPSNPAI--------ARLREQYALLSREYARR
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
A0A523X2C8      RYHCTEDHPTIQAIHAKIDRIKQELESQAREFADS-YAEVMRLRWTTAMEREDELQASFD
A0A7C5QCG4      LATLKPEYPEMLKLKSEIEATYEALTNEKENLIKTAYAE-----YQGALAKEQNLQKLLD
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------------------------------
A0A523X2C8      AQFQASCDLGIKATEYSVLQSELRRTERLCEILDDRIKELNVT---EDVGALNISILEVA
A0A7C5QCG4      DLKAQAYKANSSAILYNSLKIETENKKTLLEALSKRQSETDLASRLKDLQALNVWIVDRA
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      ------------------------------------DNTVKTSEDVEKYAHLPALGIVPT
A0A523X2C8      RPADSPSKPEKGKCMAMALAFGLTLGGGLAVLRDMFDYRLRSADEVSVVLGIAVLGVIPT
A0A7C5QCG4      SIPVEPAFPNRRKTFLIGLFLAIVGGAGTTLFINYLVATVKSSRDIAQATAWPTLGTIPA
                                                                            

A0A7C2G6U9      ------------------------------------------------------------
A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      FTVDGYRKGYGY------------------------------------------------
A0A523X2C8      MSDRKAVALPGHKVRGLLKRIIAGSHQRTGATTSSGTAKSESVPAQDDGEAIIGSRSIME
A0A7C5QCG4      FEKEYKPRGPRAEFQTL-------------------------------SNLLQGRPGIFS
                                                                            

A0A7C2G6U9      -----------------------------------MATGARGAMTGERVESEEEKKLNQI
A0A3D4NYA6      ------------------------------------------------------MVEPKV
A0A3D4P3H6      ----------------GYGQRGHAKGIILKTTDGIHQTEDKGGAGAEARESGAKNQGTQV
A0A523X2C8      RAQKVRSELEYIRCIHGTSKKTHEAVCTIASPNEAGRKTEDTAVNSPIAGKDKTTTKIIS
A0A7C5QCG4      KKK-------------GKSRVQEPKKFSLQSQPAASPEKNNHQIEL--------------
                                                                            

A0A7C2G6U9      KAIELIPH-----LAPKSSFAESYRTIRTALLLSSPQEKLRSIVVSSPLPAEGKTATVAN
A0A3D4NYA6      KSIELIAH-----LSPKSNLAESYRTIRTSLLLSSADKKPKSIVVTSALPEEGKSATLCN
A0A3D4P3H6      KSIELISH-----RWPKSDYAESYRSIRTSLLLSTADPNLKVIVVTSALASEGKTATVSN
A0A523X2C8      EKPDIVKRGQKAYLEPKSIVAEAYRTIRTAVFFGIPQEEAKTILITSPAPSDGKSTVTSN
A0A7C5QCG4      ----IVQR------EPHCIQSEAFRSIRTTFLLSLEGPAKKALIFSSPLSKDGKSAVISN
                    :: .       *:.  :*::*:***:.::.      . ::.:*. . :**::. .*

A0A7C2G6U9      LAVTLAQANRKVLLIDADLRKPRLHRIFRVKNVNGLTNFLVSDVEYRNLIKTTEVPNLYL
A0A3D4NYA6      LAVTLAQAGKTVLIVDSDFRRPTQHKIFKIRNINGLTNYLTSEMELKALVKETGIPKLYL
A0A3D4P3H6      LAVVLAQAGKHVLILDADLRKPRQHRIFGIRNLNGLTNYLTANLELKALFKQTEIPLLYL
A0A523X2C8      LAITMAQAGQKTLVLDADFRKPIQHNIFQIDSKEGLSNLLAGTINIKEAIQPGPVENLDI
A0A7C5QCG4      LGLALAQAHKKVVIVDSDLRKPKQQEIFSVDYTWGLTHFLSSIVDASEVIRPTSFSNLFL
                *.:.:*** . .:::*:*:*.*  : ** :    **:: * . ::    ..   .  * :

A0A7C2G6U9      INSGPVPPNPAELLGSEKMARLIDFARQYFHHILFDSPPVLVVADAMVLGPIVDGMVLVV
A0A3D4NYA6      INVGPVPPNPAELLGSEKMGNLIESLKQWFDFILFDSPPVLTVSDAMVLGPKIDGIILVV
A0A3D4P3H6      INAGPVPPNPAELLGSDKMAGLIEYLKPHFHYILIDTPPMLAVSDALVLGPKLDGVVLIV
A0A523X2C8      LNCGIEVPNPSEVLNSNSFAKVLKVFSEQYDRVIIDSPPVGPVADSQILAALCDITLLVL
A0A7C5QCG4      VPSGITPTDPLEIMFSDKMRAFINFLKQQFDFILFDSPPILAVSDALVLGKQVDGLIMVV
                :  *   .:* *:: *:.:  .:.     :  :::*:**:  *:*: :*.   *  ::::

A0A7C2G6U9      WGEKTTRDALERAREKLDLMKIKLMGVVINNLDLRRHH------------YYYKHYYYDY
A0A3D4NYA6      WGGKTAKDALKQAKERLDMLKVKCLGVVINNLNIQEHD------------YYHMHHHYHY
A0A3D4P3H6      QGEKTSREAMKRAKEKLDLLKIKSLGVVINNLNLQRHD------------YYYKRYYYHY
A0A523X2C8      RAERSTRRQSQHVRDSLLSVGGHILGAIVNDVPRKHGRYGYYYAGRYGGYGYYSHYGY-Y
A0A7C5QCG4      RAGQTPISALKQARNKIENHKINCLGVIINGVSLIEQD------------GYYARQYY-H
                .. .:.    :...: :     : :*.::*.:                   *: .  * :

A0A7C2G6U9      YYRHYSP----
A0A3D4NYA6      YGEGKGGEKTT
A0A3D4P3H6      YGEE-------
A0A523X2C8      GNKEKKKVLAG
A0A7C5QCG4      YSKPL------
                           

© 1998-2021Legal notice