BYKdb

Dataset for cluster orphancd of phylum candidatus-aminicenantes

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A3D4NYA6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=240 residues).
MVEPKVKSIELIAHLSPKSNLAESYRTIRTSLLLSSADKKPKSIVVTSALPEEGKSATLCNLAVTLAQAGKTVLIVDSDF
RRPTQHKIFKIRNINGLTNYLTSEMELKALVKETGIPKLYLINVGPVPPNPAELLGSEKMGNLIESLKQWFDFILFDSPP
VLTVSDAMVLGPKIDGIILVVWGGKTAKDALKQAKERLDMLKVKCLGVVINNLNIQEHDYYHMHHHYHYYGEGKGGEKTT
>gnl|bykdb|A0A3D4P3H6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=307 residues).
DNTVKTSEDVEKYAHLPALGIVPTFTVDGYRKGYGYGYGQRGHAKGIILKTTDGIHQTEDKGGAGAEARESGAKNQGTQV
KSIELISHRWPKSDYAESYRSIRTSLLLSTADPNLKVIVVTSALASEGKTATVSNLAVVLAQAGKHVLILDADLRKPRQH
RIFGIRNLNGLTNYLTANLELKALFKQTEIPLLYLINAGPVPPNPAELLGSDKMAGLIEYLKPHFHYILIDTPPMLAVSD
ALVLGPKLDGVVLIVQGEKTSREAMKRAKEKLDLLKIKSLGVVINNLNLQRHDYYYKRYYYHYYGEE
>gnl|bykdb|A0A523X2C8 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=785 residues).
YTSSSRVYVEQSGPKIISKYEGIMTQSSNYLYTQGELIISTPIVVDVVNDSKIKQFRTFADVDNLVAYIKNNLNVRIGRK
DDIIAVSFDSPYPVEAAEIVNAVVQSYINYHSTRKRSTVSEVLRIIQKEKVKRDKELSDKFAELLEFARENSEVSLDNQG
GNIFLTRLTKLSTAVTDAQLNTLNAKADYEAIKSMEDEPAKVKQFASASSTAGVRVFVNDTETQLKAELRAVEIELQSAR
YHCTEDHPTIQAIHAKIDRIKQELESQAREFADSYAEVMRLRWTTAMEREDELQASFDAQFQASCDLGIKATEYSVLQSE
LRRTERLCEILDDRIKELNVTEDVGALNISILEVARPADSPSKPEKGKCMAMALAFGLTLGGGLAVLRDMFDYRLRSADE
VSVVLGIAVLGVIPTMSDRKAVALPGHKVRGLLKRIIAGSHQRTGATTSSGTAKSESVPAQDDGEAIIGSRSIMERAQKV
RSELEYIRCIHGTSKKTHEAVCTIASPNEAGRKTEDTAVNSPIAGKDKTTTKIISEKPDIVKRGQKAYLEPKSIVAEAYR
TIRTAVFFGIPQEEAKTILITSPAPSDGKSTVTSNLAITMAQAGQKTLVLDADFRKPIQHNIFQIDSKEGLSNLLAGTIN
IKEAIQPGPVENLDILNCGIEVPNPSEVLNSNSFAKVLKVFSEQYDRVIIDSPPVGPVADSQILAALCDITLLVLRAERS
TRRQSQHVRDSLLSVGGHILGAIVNDVPRKHGRYGYYYAGRYGGYGYYSHYGYYGNKEKKKVLAG
>gnl|bykdb|A0A7C2G6U9 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=255 residues).
MATGARGAMTGERVESEEEKKLNQIKAIELIPHLAPKSSFAESYRTIRTALLLSSPQEKLRSIVVSSPLPAEGKTATVAN
LAVTLAQANRKVLLIDADLRKPRLHRIFRVKNVNGLTNFLVSDVEYRNLIKTTEVPNLYLINSGPVPPNPAELLGSEKMA
RLIDFARQYFHHILFDSPPVLVVADAMVLGPIVDGMVLVVWGEKTTRDALERAREKLDLMKIKLMGVVINNLDLRRHHYY
YKHYYYDYYYRHYSP
>gnl|bykdb|A0A7C5QCG4 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=672 residues).
INSQSHSMLLKSRSLASEVIDKMKLAENPEYVGSLKKDKAEKYKSNPVFREKLIDGFIKNLIVTPISGTKLIEVNFEHKN
PELASQILNTLFDSYIEMLIKRKYTASEQATEFLSTQIASLRKDIEEAEKKLAELGTAQGILPLSSAEAPLISKITEVNT
ALTAATLDKVNKLTTYNQLRALRPEELPESPSNPAIARLREQYALLSREYARRLATLKPEYPEMLKLKSEIEATYEALTN
EKENLIKTAYAEYQGALAKEQNLQKLLDDLKAQAYKANSSAILYNSLKIETENKKTLLEALSKRQSETDLASRLKDLQAL
NVWIVDRASIPVEPAFPNRRKTFLIGLFLAIVGGAGTTLFINYLVATVKSSRDIAQATAWPTLGTIPAFEKEYKPRGPRA
EFQTLSNLLQGRPGIFSKKKGKSRVQEPKKFSLQSQPAASPEKNNHQIELIVQREPHCIQSEAFRSIRTTFLLSLEGPAK
KALIFSSPLSKDGKSAVISNLGLALAQAHKKVVIVDSDLRKPKQQEIFSVDYTWGLTHFLSSIVDASEVIRPTSFSNLFL
VPSGITPTDPLEIMFSDKMRAFINFLKQQFDFILFDSPPILAVSDALVLGKQVDGLIMVVRAGQTPISALKQARNKIENH
KINCLGVIINGVSLIEQDGYYARQYYHYSKPL
© 1998-2021Legal notice