BYKdb

Dataset for cluster tadcd of phylum candidate-division-nc10

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2T4TV17      MDPDNALVKVKGGSGGLAKPQLWPVQAFPEQKKDPHLRDYWQVLLKHRWIVLTCFLVTVV
A0A564ZGP5      MESDNALVKAKDGNVDLAKPQLWPVRAFPEDKKEPHLRDYWHVLYKHRWIVLTCFLVTVI
D5MIF0          MDPDNALVKAKDNSESLAKPQLWPVQAFPEQKKDPHLRDYWQVLHKHRWIVLTCFLVTVI
A0A7C3VXX2      -------------------------MRLEKAEKEVHLRDYWRVIRRRQWVVLTAFVLVVA
A0A2U1RKY9      ---MDALVKSEGKPP--TPRELLLQRYYLQQDEETHLRDYWRIILKHRWMVLTFFAIIVT
A0A564ZHL8      ---MDALVKSEGNSP--TPRDLLLQRYYVQQDEETHLRDYWRIILKHRWIVLTVFAMIVT
                                             : .:: ******.:: ...*:*** * : * 

A0A2T4TV17      TVATATFVQRPVYKATATIKIDRAELKILKFDDV-SPSANKETDDYYQTQYKLLTSYSLA
A0A564ZGP5      TVATATFVQQSIYKATATLQIDKAEPNILKFDQV-SPTADKETDDYYQTQYKLLTSYSLA
D5MIF0          TVATATFVQQSVYKATATIQIDKAAPNVLKFEEV-SPAANKETDDYYQTQYKLLMSYSLA
A0A7C3VXX2      TATIYTFIARPIYRATAQLEIGAESLRILSLQEGVSVDTTN--PQYYQTQYELLKSDTLL
A0A2U1RKY9      TATIYTFSLTPTYRATATLKIDYERPQILSFQEIGSPGHQNYGPEFMGTQQKLLQSRSLA
A0A564ZHL8      TATIYTFSLTPTYRATASLKIDYERPQILSFQEIGSPGHQNFGPEFMGTQQKLLQSRSLA
                *.:  **   . *.*** ::*.    .:*.:::  *    :   ::  ** :** * :* 

A0A2T4TV17      ERVVKRFNLDANPEFL-GSGMQGPASPTWTWLTNLVDLI---------RPQPSTQQASGE
A0A564ZGP5      ERIVKLLRLDANPEFS-GKGAAGPASPTWTWLVDLVGSV---------YHQPPAQLSPGE
D5MIF0          ERVVRLLRLDVNPEFT-GTDAPGSASPTWTRFTNLVNLV---------RPRSSMQAASGE
A0A7C3VXX2      RKVIERMRLDRNPEFA--------------------------------PLVQNLQGSDEI
A0A2U1RKY9      KRVIETLTANGHSIAL-DPGPTDSGELAGVWLAWITDMLSGSRTSKSLPTADPVSQPEPP
A0A564ZHL8      KRVIETLKASGQPIALADPASADSAGALNNWPVWITNLF-GSSSSTPKDAIEPALRSESE
                 .::  :  . :.                                           .   

A0A2T4TV17      ASITESPV----VQSFLKKLEIEPVKNTRLVKIAFLSPSPELSAQIANAMAENFIEQSIE
A0A564ZGP5      TSTTESPV----VKSFLKKLEIEPVKNTRLVKISFLSASPELSAQVANAMAEGFIEHSIE
D5MIF0          TSTTESPI----VQSFLKKLEIEPVKNTRLVKIAFLSTSPELSAQVANAMAENFIEQSIE
A0A7C3VXX2      TATRRNQIL---VGAFRSHLTIAPIRNSRLVNIHFDSFSPHLAAQAANAVAQTYIDWDLE
A0A2U1RKY9      VGPTEEQVMVRKIDVLLRMLTIEPVRTTNLVKISFTTPSPALSSLLANAWAKGFIDHSLD
A0A564ZHL8      TGPTEEQVMARKVDALLSTLTVEPVRTTNLVKISFTTPSSGLSSLLANTWTKAFIDHSLE
                ..   . :    :  :   * : *:..:.**:* * : *. *::  **: :: :*:..::

A0A2T4TV17      QRLGAMKYAGDFLAKQIQEVRIKLESSDELLQRFAKQKQ-YLVLDEKQEQTTKQLSLLTD
A0A564ZGP5      QKVGATKYAGDFLAKQIQDVRAKLEGSDELLQKFAKQKQ-YLVLDEKQEQTTKQLSLLTD
D5MIF0          QKVGATKYAGDFLAKQIQDVRIKLESSDELLQKFARQKQ-YLVLDEKQEQTTKQLSLLTD
A0A7C3VXX2      MKVNASQNAVRWLTSQIEEQRKKAEEAQSALQAFKQQKGLVMATEESQNINTQRLSALNA
A0A2U1RKY9      LKYNATAQAGEWLSKQLQDVQDKLEQSEAALHEFVKQKQ-ILTVGEKKDIVTTKLADLSE
A0A564ZHL8      MKYNATSQAGEWLSKQLQDVRDKLEQSEAALHEFVKQKQ-ILTIGEKKDIVTTKLGDLSE
                 . .*   *  :*:.*::: . * * ::  *: * .**   :.  *.::  * .*. *. 

A0A2T4TV17      ALMKARSERLAKEALHRQTQGQ-----DFQSIPSVLENPLISSLKTEYFRLQAEYRKLSE
A0A564ZGP5      ALMKARSDRLAKEGLYRQTQGQ-----DFQSIPSVLENALIVDLKKEYYRLQAEYRKLSE
D5MIF0          ALMKARSDRLAKEALHRQTQGQ-----DFQSIPSVLENALIVDLKKEYFRLQAEYRKLSE
A0A7C3VXX2      EYLSAQTKRVEAETRFNQVRSLLEDPERLESVSEVTKDPLVQSLRAQEVKLSADLSELAQ
A0A2U1RKY9      ALTKAQGERIAKEALYRQSQKL-----RFDSIPAVLENSMISNLKTEYYKLDSEYRRLGE
A0A564ZHL8      ALTKAQGERISKEALYRQSQKM-----RFDSIPAVLENSMIANLRAEYYKLDSEYRRQSE
                   .*. .*:  *  ..* .        ::*:. * ::.:: .*. :  .*.::    .:

A0A2T4TV17      TFLSDYPRMVALKSNIDEVKIKLDGEVQRVVDGLRSSYEAGLKSEHLLQSAVDKQKTVTL
A0A564ZGP5      KFLPDYPTMIALKSNVEEVKGRLDGEVQRIVDGLRSSYEAAVKTEHLLQVSVDKQKQVAL
D5MIF0          TFLPDYPRMVALKSNIEEVKSRLDGEVQKIIDGLRSSYEAAVKSEHLLQSSVDKQKQVTL
A0A7C3VXX2      KYGPKHPQMVRLKAELDSIREKISQEIKRIVIALKNDYEVARAREATLLQALNRQKAEYM
A0A2U1RKY9      TYKPGYPKMVRLRESMDQIKRQIEVEIARIVDAIKQEYEAAVKKEQLLQAAVNEQKHLAI
A0A564ZHL8      TYKPGYPKMVRLRDGMDQIKRQIEVEIARIVDAINQEYEAALKKEQLLQSAVNAQKHLAI
                .: . :* *: *.  ::.:. .:. *: .:: .:...**..   *  *  ::: **   :

A0A2T4TV17      KTNEDSIQYNILKREVDINRELYSGLLQRMKETAVSAGLDSTNIMITDLAKIPLWPDRPK
A0A564ZGP5      KTNDDSIQYNILKREVDINRELYAGLLQRMKETAVSAGLDSTNIQVTDRAKIPLWPDRPK
D5MIF0          KTNEDSIQYNILKREVDINRELYAGLLQRMKETAVSAGLDSTNIQIADRAKVPLFPDRPK
A0A7C3VXX2      DLAQKSVEYGVLKREADSAQQIYEILLRRLKEASLAENIKESNIRIVNPAPIPLAPYKPK
A0A2U1RKY9      GLNQELIRYDILKRDVDTNRQIYSGILERQKQAGVSQGLAASNVQIVDTAEAPTTPFSPN
A0A564ZHL8      ALNQELIGYDMLKRDVDTNRQIYSGILERQKQAGVSQGLAASNVQIVDTAEVPSVPFSPN
                   :. : *.:***:.*  .::*  :* * *::.:: .:  :*: :.: *  *  *  *:

A0A2T4TV17      KLLNLTLGIVLGLGLGIGLAFFSDYLDNTVNKIEEVESTFALPILGAVPALASVERRRRL
A0A564ZGP5      KLLNLTLGIVLGLSLGIGLAFFADYLDNTVNKIEEVESTFALPILGAVPALASVERRKRL
D5MIF0          KLLNLALGIVLGLSLGIGLAFFADYLDNTVNKIEEVESTFALPILGAVPALASAERRKRL
A0A7C3VXX2      KTQNLLLSLLVGAMVGIGLAFFFEYLDNTLKTPEDVKEHLDLPLLGMIPHLKPAGSARSR
A0A2U1RKY9      KTRNIVLGIVLGLTVAVGMAFFFDYLDNTVKQPDALERTLGIPSLALIPSLASALPKQRR
A0A564ZHL8      KTRNILLGIVLGLTVAVGMAFFFDYLDNTVKHPEALERTLGIPNLALIPSLASALPRQGR
                *  *: *.:::*  :.:*:*** :*****::  : ::  : :* *. :* * ..   .  

A0A2T4TV17      KGTTNNG-------QDAKSFELVMLQDQ--------------------------------
A0A564ZGP5      KGTT-NG-------QAIESFELVMHHDQ--------------------------------
D5MIF0          KGAT-NG-------QGAKSFELMMHQDQ--------------------------------
A0A7C3VXX2      SSRSRSAASAASARAGSPVPASTSAAPTSAASTATAASTATASSPAAAPALPSDGSSRLL
A0A2U1RKY9      GRLSRNGNNGNH--NGAPAFATVAHSDL--------------------------------
A0A564ZHL8      GRLSRNGSNGHG--NGTPVFALVAHSDL--------------------------------
                   : ..                                                     

A0A2T4TV17      -----SSLVGEAIRNIRTSLLFSLPENPPKLLLVTSAEPGDGKTGVSINLSVALSQLGGD
A0A564ZGP5      -----SSLVSEAIRNIRTSLLFSLPDNPPKLLLVTSAEPGDGKTSVSINLSIALSQLGGD
D5MIF0          -----SSLVSEAIRNIRTSLLFSLPDNPPKLLLVTSAEPGDGKTGVSINLSVALSQLGSD
A0A7C3VXX2      ILHRPKSTGAESYHMLRTNLLLSSPNGPPRVILVTSPGPQEGKTLTSANLAIALAQSGSR
A0A2U1RKY9      -----RSALAEAFRTLRTSLLFSSPGSPPKSILFTSAQPSEGKTGLSINTAITLAQLGGG
A0A564ZHL8      -----RSTLTEAFRTLRTSLLFSSAGSPPKTILFTSAQPSEGKTGLSINTAITLSQLGGS
                      *   *: . :**.**:* . .**. :*.**. * :***  * * :::*:* *. 

A0A2T4TV17      VLLIDADMRYPDCHRILGQDRTPGLSNFLVGDAELSAVIKPTATSNLSLLPAGQSPLNPA
A0A564ZGP5      VLLIDADMRYPDCHRLLEQDRAPGLSNFLVGDAELSAAIKPTTIPNLYLLPAGQSPLNPA
D5MIF0          ILLIDADMRYPDCHRLLEQDRTPGLSNFLVGDAELSAAIKPTTIPNLYLLPAGQSPLNPA
A0A7C3VXX2      TLLVDGDFRRPGVHTLFGIEENVGLVDYLAQGKPLDGLLLDTPLPNLKMITSGPNPPNPA
A0A2U1RKY9      VLLIDGDMRRPSCHSHLEIPLKAGLSDYLTGNADLVSVIKRTTVSNLYCIPAGTIPVNPA
A0A564ZHL8      VLLIDADMRRPSCHAQLELPLKAGLSDYLTGNADLVSAIKGTAVPNLYCIPAGTIPVNPA
                 **:*.*:* *. *  :      ** ::*. .  * . :  *. .**  :.:*  * ***

A0A2T4TV17      ELLGSERMRDALELLCQQFKYVIIDAPPVLGFTDSVLLSTFAEGTVFVIRAGKTVRDAAQ
A0A564ZGP5      ELLGSERMKAAVDLLCQQFKHVIIDSPPVLGFTDSVLLSTFADGTLLVIRAGKTVRDAAQ
D5MIF0          ELLGSERMRDALELLCRQFKHVIIDSPPILGFTDSVLLSTFADGTLLVIRAGKTVRDAAL
A0A7C3VXX2      ELLSSPRVGEALQVLRQQFDAIVLDSPPLAAVTDPVLLSQVADGTILVVKAAHTVREAAQ
A0A2U1RKY9      ELLASPRMRETIDLLSQRFDYIVVDSPPIFSVADALILSTVVKGVILVVHGGRTPRDMIQ
A0A564ZHL8      ELLASARMKDTIDLLSQRFDYIVVDSPPIFGVADALILSTVVKGVILVVHGGRTPREMVQ
                ***.* *:  ::::* ..*. :::*:**: ..:*.::** ...*.::*:....* *:   

A0A2T4TV17      RAVRTLNAVNAKILGVVLNNIDLHSHGYSYYQDYHDYYHRKSERHGIVARGHHDRSNTPG
A0A564ZGP5      RAVRTLDAVNAKILGVVLNNLEIHGNGYSYYRDYHDYYHRKSERRDSVMSHRDS------
D5MIF0          RAVRTLNAVNAKLLGVVLNSLELHGNGYSYYQDYHDYYHRKSERRDSVMSHRDSH-----
A0A7C3VXX2      MAKEQLLSVNATILGVVLNDIEVDREGYPYH--YYHYYGRYYRHYYRTEEEEQGEEGKEG
A0A2U1RKY9      RSFKNLIELNAPVLGAVLNNIDIRGNGYPYY--YRYHYSHYYQYAAPDTVPDPA------
A0A564ZHL8      RAFKNLIELNAPVLGAVLNNVDIRGNGYPHY--YHYYYNH-YQQASSGAAPEPA------
                 :   *  :** :**.***.:::   **.::  *  :* .                    

A0A2T4TV17      APHAHEHESPDSPADIPSPLAGEG----
A0A564ZGP5      ----------------------------
D5MIF0          ----------------------------
A0A7C3VXX2      RERRRSSRKEKAATTATATGGTKEEGKR
A0A2U1RKY9      -----STVQAHAPVESQPTNAGNGDRPV
A0A564ZHL8      -----HNETQASNLEP------------
                                            

© 1998-2021Legal notice