BYKdb

Dataset for cluster tadcd of phylum candidate-division-nc10

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U1RKY9      ---MDALVKSEGKPP--TPRELLLQRYYLQQDEETHLRDYWRIILKHRWMVLTFFAIIVT
A0A564ZHL8      ---MDALVKSEGNSP--TPRDLLLQRYYVQQDEETHLRDYWRIILKHRWIVLTVFAMIVT
A0A2T4TV17      MDPDNALVKVKGGSGGLAKPQLWPVQAFPEQKKDPHLRDYWQVLLKHRWIVLTCFLVTVV
A0A564ZGP5      MESDNALVKAKDGNVDLAKPQLWPVRAFPEDKKEPHLRDYWHVLYKHRWIVLTCFLVTVI
D5MIF0          MDPDNALVKAKDNSESLAKPQLWPVQAFPEQKKDPHLRDYWQVLHKHRWIVLTCFLVTVI
                    :**** :.     :  :*   . : ::.::.******.:: ****:*** * : * 

A0A2U1RKY9      TATIYTFSLTPTYRATATLKIDYERPQILSFQEIGSPGHQNYGPEFMGTQQKLLQSRSLA
A0A564ZHL8      TATIYTFSLTPTYRATASLKIDYERPQILSFQEIGSPGHQNFGPEFMGTQQKLLQSRSLA
A0A2T4TV17      TVATATFVQRPVYKATATIKIDRAELKILKFDDV-SPSANKETDDYYQTQYKLLTSYSLA
A0A564ZGP5      TVATATFVQQSIYKATATLQIDKAEPNILKFDQV-SPTADKETDDYYQTQYKLLTSYSLA
D5MIF0          TVATATFVQQSVYKATATIQIDKAAPNVLKFEEV-SPAANKETDDYYQTQYKLLMSYSLA
                *.:  **   . *.***:::**    ::*.*::: **  ::   ::  ** *** * ***

A0A2U1RKY9      KRVIETLTANGHSIAL-DPGPTDSGELAGVWLAWITDMLSGSRTSKSLPTADPVSQPEPP
A0A564ZHL8      KRVIETLKASGQPIALADPASADSAGALNNWPVWITNLF-GSSSSTPKDAIEPALRSESE
A0A2T4TV17      ERVVKRFNLDANPEFL---GSGMQGPASPTW-TWLTNLV------DLIRPQPSTQQASGE
A0A564ZGP5      ERIVKLLRLDANPEFS---GKGAAGPASPTW-TWLVDLV------GSVYHQPPAQLSPGE
D5MIF0          ERVVRLLRLDVNPEFT---GTDAPGSASPTW-TRFTNLV------NLVRPRSSMQAASGE
                :*::  :  . :.      .    .     * ..:.::.             .   .   

A0A2U1RKY9      VGPTEEQVMVRKIDVLLRMLTIEPVRTTNLVKISFTTPSPALSSLLANAWAKGFIDHSLD
A0A564ZHL8      TGPTEEQVMARKVDALLSTLTVEPVRTTNLVKISFTTPSSGLSSLLANTWTKAFIDHSLE
A0A2T4TV17      ASITESPV----VQSFLKKLEIEPVKNTRLVKIAFLSPSPELSAQIANAMAENFIEQSIE
A0A564ZGP5      TSTTESPV----VKSFLKKLEIEPVKNTRLVKISFLSASPELSAQVANAMAEGFIEHSIE
D5MIF0          TSTTESPI----VQSFLKKLEIEPVKNTRLVKIAFLSTSPELSAQVANAMAENFIEQSIE
                .. **. :    :. :*  * :***..*.****:* :.*. **: :**: :: **::*::

A0A2U1RKY9      LKYNATAQAGEWLSKQLQDVQDKLEQSEAALHEFVKQKQILTVGEKKDIVTTKLADLSEA
A0A564ZHL8      MKYNATSQAGEWLSKQLQDVRDKLEQSEAALHEFVKQKQILTIGEKKDIVTTKLGDLSEA
A0A2T4TV17      QRLGAMKYAGDFLAKQIQEVRIKLESSDELLQRFAKQKQYLVLDEKQEQTTKQLSLLTDA
A0A564ZGP5      QKVGATKYAGDFLAKQIQDVRAKLEGSDELLQKFAKQKQYLVLDEKQEQTTKQLSLLTDA
D5MIF0          QKVGATKYAGDFLAKQIQDVRIKLESSDELLQKFARQKQYLVLDEKQEQTTKQLSLLTDA
                 . .*   **::*:**:*:*. *** *:  *: *..*** *.:.**:: .*.:*. *::*

A0A2U1RKY9      LTKAQGERIAKEALYRQSQKLRFDSIPAVLENSMISNLKTEYYKLDSEYRRLGETYKPGY
A0A564ZHL8      LTKAQGERISKEALYRQSQKMRFDSIPAVLENSMIANLRAEYYKLDSEYRRQSETYKPGY
A0A2T4TV17      LMKARSERLAKEALHRQTQGQDFQSIPSVLENPLISSLKTEYFRLQAEYRKLSETFLSDY
A0A564ZGP5      LMKARSDRLAKEGLYRQTQGQDFQSIPSVLENALIVDLKKEYYRLQAEYRKLSEKFLPDY
D5MIF0          LMKARSDRLAKEALHRQTQGQDFQSIPSVLENALIVDLKKEYFRLQAEYRKLSETFLPDY
                * **..:*::**.*:**:*   *:***:****.:* .*. **:.*::***. .*.: ..*

A0A2U1RKY9      PKMVRLRESMDQIKRQIEVEIARIVDAIKQEYEAAVKKEQLLQAAVNEQKHLAIGLNQEL
A0A564ZHL8      PKMVRLRDGMDQIKRQIEVEIARIVDAINQEYEAALKKEQLLQSAVNAQKHLAIALNQEL
A0A2T4TV17      PRMVALKSNIDEVKIKLDGEVQRVVDGLRSSYEAGLKSEHLLQSAVDKQKTVTLKTNEDS
A0A564ZGP5      PTMIALKSNVEEVKGRLDGEVQRIVDGLRSSYEAAVKTEHLLQVSVDKQKQVALKTNDDS
D5MIF0          PRMVALKSNIEEVKSRLDGEVQKIIDGLRSSYEAAVKSEHLLQSSVDKQKQVTLKTNEDS
                * *: *...::::* .:: *: .::*.:...***.:*.*:*** :*: ** :::  *:: 

A0A2U1RKY9      IRYDILKRDVDTNRQIYSGILERQKQAGVSQGLAASNVQIVDTAEAPTTPFSPNKTRNIV
A0A564ZHL8      IGYDMLKRDVDTNRQIYSGILERQKQAGVSQGLAASNVQIVDTAEVPSVPFSPNKTRNIL
A0A2T4TV17      IQYNILKREVDINRELYSGLLQRMKETAVSAGLDSTNIMITDLAKIPLWPDRPKKLLNLT
A0A564ZGP5      IQYNILKREVDINRELYAGLLQRMKETAVSAGLDSTNIQVTDRAKIPLWPDRPKKLLNLT
D5MIF0          IQYNILKREVDINRELYAGLLQRMKETAVSAGLDSTNIQIADRAKVPLFPDRPKKLLNLA
                * *::***:** **::*:*:*:* *::.** ** ::*: :.* *: *  *  *:*  *: 

A0A2U1RKY9      LGIVLGLTVAVGMAFFFDYLDNTVKQPDALERTLGIPSLALIPSLASALPKQRRGRLSRN
A0A564ZHL8      LGIVLGLTVAVGMAFFFDYLDNTVKHPEALERTLGIPNLALIPSLASALPRQGRGRLSRN
A0A2T4TV17      LGIVLGLGLGIGLAFFSDYLDNTVNKIEEVESTFALPILGAVPALASV---ERRRRL--K
A0A564ZGP5      LGIVLGLSLGIGLAFFADYLDNTVNKIEEVESTFALPILGAVPALASV---ERRKRL--K
D5MIF0          LGIVLGLSLGIGLAFFADYLDNTVNKIEEVESTFALPILGAVPALASA---ERRKRL--K
                ******* :.:*:*** *******:: : :* *:.:* *. :*:***.   : * **  :

A0A2U1RKY9      GNNGNHNGAPAFATVAHSDLRSALAEAFRTLRTSLLFSSPGSPPKSILFTSAQPSEGKTG
A0A564ZHL8      GSNGHGNGTPVFALVAHSDLRSTLTEAFRTLRTSLLFSSAGSPPKTILFTSAQPSEGKTG
A0A2T4TV17      GTTNNGQDAKSFELVMLQDQSSLVGEAIRNIRTSLLFSLPENPPKLLLVTSAEPGDGKTG
A0A564ZGP5      GTT-NGQAIESFELVMHHDQSSLVSEAIRNIRTSLLFSLPDNPPKLLLVTSAEPGDGKTS
D5MIF0          GAT-NGQGAKSFELMMHQDQSSLVSEAIRNIRTSLLFSLPDNPPKLLLVTSAEPGDGKTG
                * . : :    *  :   *  * : **:*.:******* . .*** :*.***:*.:***.

A0A2U1RKY9      LSINTAITLAQLGGGVLLIDGDMRRPSCHSHLEIPLKAGLSDYLTGNADLVSVIKRTTVS
A0A564ZHL8      LSINTAITLSQLGGSVLLIDADMRRPSCHAQLELPLKAGLSDYLTGNADLVSAIKGTAVP
A0A2T4TV17      VSINLSVALSQLGGDVLLIDADMRYPDCHRILGQDRTPGLSNFLVGDAELSAVIKPTATS
A0A564ZGP5      VSINLSIALSQLGGDVLLIDADMRYPDCHRLLEQDRAPGLSNFLVGDAELSAAIKPTTIP
D5MIF0          VSINLSVALSQLGSDILLIDADMRYPDCHRLLEQDRTPGLSNFLVGDAELSAAIKPTTIP
                :*** :::*:***..:****.*** *.**  *     .***::*.*:*:* :.** *: .

A0A2U1RKY9      NLYCIPAGTIPVNPAELLASPRMRETIDLLSQRFDYIVVDSPPIFSVADALILSTVVKGV
A0A564ZHL8      NLYCIPAGTIPVNPAELLASARMKDTIDLLSQRFDYIVVDSPPIFGVADALILSTVVKGV
A0A2T4TV17      NLSLLPAGQSPLNPAELLGSERMRDALELLCQQFKYVIIDAPPVLGFTDSVLLSTFAEGT
A0A564ZGP5      NLYLLPAGQSPLNPAELLGSERMKAAVDLLCQQFKHVIIDSPPVLGFTDSVLLSTFADGT
D5MIF0          NLYLLPAGQSPLNPAELLGSERMRDALELLCRQFKHVIIDSPPILGFTDSVLLSTFADGT
                **  :***  *:******.* **. :::**...*.::::*:**::..:*:::***...*.

A0A2U1RKY9      ILVVHGGRTPRDMIQRSFKNLIELNAPVLGAVLNNIDIRGNGYPYYYRYHYSHYYQYAAP
A0A564ZHL8      ILVVHGGRTPREMVQRAFKNLIELNAPVLGAVLNNVDIRGNGYPHYYHYYYNH-YQQASS
A0A2T4TV17      VFVIRAGKTVRDAAQRAVRTLNAVNAKILGVVLNNIDLHSHGYSYYQDYHDYYHRKSERH
A0A564ZGP5      LLVIRAGKTVRDAAQRAVRTLDAVNAKILGVVLNNLEIHGNGYSYYRDYHDYYHRKSERR
D5MIF0          LLVIRAGKTVRDAALRAVRTLNAVNAKLLGVVLNSLELHGNGYSYYQDYHDYYHRKSERR
                ::*:..*.* *:   *:...*  :** :**.***.:::..:**.:*  *:  :  :    

A0A2U1RKY9      DTVPDPASTVQAHAPVESQPTNAGNGDRPV---------
A0A564ZHL8      GAAPEPAHNETQASNLEP---------------------
A0A2T4TV17      GIVARGHHDRSNTPGAPHAHEHESPDSPADIPSPLAGEG
A0A564ZGP5      DSVMSHRDS------------------------------
D5MIF0          DSVMSHRDSH-----------------------------
                . .                                    

© 1998-2020Legal notice