BYKdb

Dataset for cluster tadcd of phylum candidatus-aminicenantes

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F5AEV3      ------MATEFPKEPQTGLLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFT
A0A7C6EJS8      --MNNYQMMEPTGEKEVHLLD----YWNVIWRRRWTVATFALIVVLATGLFTFTRRPVYT
A0A524I5M4      ----MKGFASKTDKKEIDVLE----YVRIVLKRKWVLATFAAVLVALAAVLSFTTTPLYR
A0A3E2BQJ8      MSNENYVEPQALDAGEIDLRK----YIDIIFRRRWTVISITLIAAALSLIISFVTRPVYK
A0A523QJ88      -----------------------------------------AVLMLSVGIITFNIVPKYK
A0A523ZV46      -----MEYEPMEKEREIDLLE----YWKTIVKRKWVIVVFAAALMLSVGIITFNIVPKYK
A0A3E2BKD4      -MDRTTPTTAGPRQTQQNLLEQILYYWNAMLRWKWTGLTVAILIVALTLVYVFISPHIYS
A0A2N7QEB5      -MNDNNIEPQADEIGEIDLKK----YLDILLRRRWTIISVTVIAVVISLLISLVTRPMYT
A0A7C5LCJ6      -MNDNYSETQIMDTGEIDLRK----YLDIIIRRRWTVISVTIIAVAITMIISLVMRPVYT
A0A497E0A2      ---------MKKEKKEIDLLE----IWRIALKRKWLIISIIIVFVIGAGIYSLTRTPIYQ
A0A1W9P661      -------MRDNKGKKEIDLFD----IWRVALKRKWIIITIVILFIVGAGIYSFTRTPIYQ
A0A7C0ZJ01      -------MRDNKGKKEIDLFD----IWRVALKRKWIIITIAILFIVGAGIYSFTRTPIYQ
A0A523ZSG1      ------MEQGRYEKDEVDLLE----YWRIIVKRKWVLIAFTGALVLFTGIFSFLATPKYE
A0A7C0ZGV5      -------MRMADEEYEINLLD----YWRVIVKRKWVVISFVGALVFFTGVFSFKATPKYK
                                                                 :  :     : 

A0A1F5AEV3      ASGSVWIEDD-PNILPFEDVQSFG-------AGSNLQSHARLLRSRTLASDTIDKLKLYE
A0A7C6EJS8      AKGTLLVEKE-PTILTFEEIFQIE-----TFRDDYYQTQYKLLQSRGLAERVVDQLKLYE
A0A524I5M4      ATATLLIDEPGASLLNIQDVLNAGAFYRSDYMGTYFNTQLRLLASRSLAERVAKKINLGA
A0A3E2BQJ8      ARGTVMIEKE-PNILSFEDIFQIE-----TFRDDYFQTQYKLLQSRSLAERTIERLKLWE
A0A523QJ88      AMTTLLIKEEGSRMLSIEDEFGYQRRVV-NLR--FYNTQLKLLKSKSLVERVVRKMNLPA
A0A523ZV46      AMTTLLIKEEGSRMLSIEDEFGYQRRVV-NLR--FYNTQLKLLKSKSLVERVVRKMNLPA
A0A3E2BKD4      AKGTIWIDET-QSVLPFEELSRLS-------GGINSQSHALLLKSRSLASDVIEKMKLHE
A0A2N7QEB5      AHGTVMIEKE-PNILSFEDIFQIE-----TFRDDYFQTQYKLLQSRSLAERTIDKLKLWE
A0A7C5LCJ6      ARGTVMIEKE-PNILSFEDIFQIE-----TFRDDYFQTQYKLLQSRTLAERTIDRLKLWE
A0A497E0A2      ASATILIEEPGSSMLNLEEMFNYTPYYRYDFLGVYFNTQLRLLTSRSLAERVARRMNLAD
A0A1W9P661      ATATILIEEPGSSMFNIEEMFNYTPYYRYDFLGVYFNTQLSLLTSRTLAERVARRMNLSE
A0A7C0ZJ01      ATATILIEEPGSSMFNIEEMFNYTPYYRYDFLGVYFNTQLSLLTSRTLAERVARRMNLSE
A0A523ZSG1      STATLLIEGERSRILSIEDEFGYSRSYE-DLR--SFNTSLKLLKSKSLAERVARKMNLLN
A0A7C0ZGV5      AKATLMIEEEASKILSIEDEFGYRQRFA-DLR--FFNTQLKLLQSKSLVERVARKMDLLS
                :  :: :.     :: :::                 ::   ** *. *.. .  .:.*  

A0A1F5AEV3      NSDF-----------------------------AGKPEKGQARPDPADPIYREVLTQIFL
A0A7C6EJS8      HPEF-----------------------------VGDPAKRKKPIDKNDLRLRKSLVDSFL
A0A524I5M4      RPEFRGARAEEPTP------------------------------------ASSSYAFSIL
A0A3E2BQJ8      KKEF-----------------------------SGSKSPTADDLKNPV--FRQKMVDKFL
A0A523QJ88      RPEFSADQKPKKSLTTTVKN---LISLRWIVPAKKAEVGDSMYSIPSS--PYAEIANVLQ
A0A523ZV46      RPEFSADQKPKKSLTTTVKN---LISLRWIVPEKKPEIGDSMYSIPSS--PYAEIANVLQ
A0A3E2BKD4      HPEF--------------------------MGPKLPVRLAKERIQPDNPVFKEKLIDEFI
A0A2N7QEB5      KTDF-----------------------------SGNRPLTSEELKDPR--IKQKMIDRFL
A0A7C5LCJ6      KEEF-----------------------------ASRKSLTSDELKNPV--FRRKLVDRFL
A0A497E0A2      RLELQAQPNSTRGGFLSRLRSVFSLSYWVSKGKRNTQSDSTEFIPPTD--INTNYAYVVL
A0A1W9P661      RMELNTQSSSSPASFLGQIKSFFSISRWFNRTKEVTQPALQEFVPPAD--LSANYAFVVL
A0A7C0ZJ01      RMELNTQSSSSPASFLGQIKSFFSISRWFNRTKEVTQPALQEFVPPAD--LSANYAFVVL
A0A523ZSG1      RPEFGWGQTQKKGLLTTAKE---AISLKWIFPRKGAKTGESEPMIRSD--PYSEIADTVR
A0A7C0ZGV5      HPLF------------------------IKAAGNNNNDQDEKKKIPHN--PYSKVSQALL
                .  :                                                      . 

A0A1F5AEV3      SNIGVSTAERSRLVDVRFSNRNPKLAADILNALFDGYIEMMVRKRYAASEQATAFLNTQI
A0A7C6EJS8      GRLKVNPVRMTRLVEVNFRANDPKLAAAAVNELFDSFIDMNVESRFEATEQATQFLTEQI
A0A524I5M4      GGLSIAPIEETRLVYVSYVSPHAALAADVVNALVEEFVSFSVETRYEATKQTSEFLSEQV
A0A3E2BQJ8      GRLEVKPIRMTRLVEVAFKAHDPTLASDCVNALFDSFVDMNIEAKYETTEQATEFLSEQI
A0A523QJ88      DGIEVSSIRNTNLVEVSYKSPYPVLCSDIVNTLAEEFISFSVEKRYETTQQASDFLSEQI
A0A523ZV46      DGIEVSSIRNTNLVEVSYKSPYPVLCSDIVNTLAEEFISFSVEKRYETTQQASDFLSEQI
A0A3E2BKD4      ASLNVSPISGTKLIEVSFDHKNPRLAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQI
A0A2N7QEB5      SRLEVKPVRMTRLVEVTFSAHDPALASECVNTLFDSFVDMNIETKSEATEQATEFLSQQI
A0A7C5LCJ6      DRLEVKPIRMTRLVEVTFKAHDPVLAGDCVNALFDSFVDMNVEAKYEATEQATEFLSQQI
A0A497E0A2      SGLRIQPVEETRLVEVSYRSPFPVLAADIVNNLIEEFINYSVEMRYEATRQASEFLNKQI
A0A1W9P661      SGLKIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQI
A0A7C0ZJ01      SGLKIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQI
A0A523ZSG1      DAIDVSAVRTTKLVEISYTSSSPVLAANIVNTLAEEFIDFSIGKRYETTQQASDFLSEQI
A0A7C0ZGV5      DSLEVSPVRETKLVEVSFTSPDPVFAADLVNTLTEEFVDFYIEKRYQTTRQASEFLARQI
                  : : .   :.*: : :    . :..  :* * : ::.  :  .  :: *:: **  *:

A0A1F5AEV3      AEIRTDIDKKERELNKYGSEKDILPLTTAEAPTVARIGEVNRALTDATLDRVNKFNAYNQ
A0A7C6EJS8      ASLQTEIAEKERQLQAYGQEKNIVALSDTETTIIDKLGEINKALTAAQIDRVQKEAYYNE
A0A524I5M4      ALLREDLKRKEEDLQKYGQEKNLLYLSGDESSIVNKFSEVNTALTTAQIERYAKESVYRE
A0A3E2BQJ8      EELKKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELNKALTEAQIDRVRKESYYNG
A0A523QJ88      ANLRGDLAAKEKELQRYGKRKKLFFLSDTESATMSKFADLTEAYTQSQIERIKAEASYRE
A0A523ZV46      ANLRGDLAAKEKELQRYGKRKKLFFLSDTESATMSKFADLTEAYTQSQIERIKAEASYRE
A0A3E2BKD4      TALRKDIEEAEKKLAELGTAQGILPLSSAEAPLISKITEVNTALTAATLDRVNKYTTYNQ
A0A2N7QEB5      NDLKKEISQKEQELQNYGQEKNIVILSDKETTILDKLNEVNKALTEAQIDRVRKEAYYNE
A0A7C5LCJ6      TELRKEISQKEQELQNYGQEKDIVILSDKETTILDKLSELNKALTEAQIDRVRKESYYNG
A0A497E0A2      AQLRDELAAKEKELQKYGEEKKLLFLNEKESSVVSKFAELNSAFTEAQIERIKKEAAYRE
A0A1W9P661      AQLRNELAAKEKELQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRE
A0A7C0ZJ01      AQLRNELAAKEKELQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRE
A0A523ZSG1      ANLREDLSLKEKELQRYGQEKEIFFLTETESTVVNKFADLNGAHTQAQIGRIRREAEYRE
A0A7C0ZGV5      EDLKNRLATKEQELQKYSQEKDLFFLNEQESTALSQFSDLNNAFTQAQIERVRAEANYRE
                  :.  :   * .*   .  : :. *.  *:. : .  ::. * * : : *      :. 

A0A1F5AEV3      LNAAPLGEIPDAPPGSLIQRLREQYINLSLDYRTRLATVRPEFPAMQRLKSELDAATEAL
A0A7C6EJS8      VKNLSPDFIPEAFTNPLIQKLREDYVRLSREYQKKMETFRPEYPEMQRLKAELESARKLL
A0A524I5M4      LKNISVDALPESVSNPTIQALKTTYSQVKSDYEEKGQIYRPDYPEMVQLKARLDATKNTL
A0A3E2BQJ8      IKNASPDFIPEAMNNPLIQRLREDYLKLSREYAKMQEKFQPEYPEMQRLKAELDSARELL
A0A523QJ88      LKELEVDSLPQFVSNMMIQNLKTEYTRMRNEYKEKGEIYKSDYPVMVTLRAKLDSMRNEL
A0A523ZV46      LKELEVDSLPQFVSNMMIQNLKTEYTRMRNEYKEKGEIYKSDYPVMVTLRAKLDSMRNEL
A0A3E2BKD4      LKALRPEELPESPANPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEIEATYESL
A0A2N7QEB5      IKNASPDFIPEALSNPLIQRLREDYLKLSREYAKMQEQFQPEYPEMQRLKAELDTARDLL
A0A7C5LCJ6      IKDASPDFIPEALNNPLIQRLREDYLKLSREYVKMQEKFQPEYPEMQRLKAELDSARELL
A0A497E0A2      LASLKVDALPPYISNPVIQNLKAEYTRLKNEYDEKIKIFKPEYPDMVRLKARLDSVRQEL
A0A1W9P661      LSSLQIDALSPNIDNPVIQSLKAEYTRLKNEYDEKIKIFKPEYPDMVRLKARLDSLRTEL
A0A7C0ZJ01      LSSLQIEALSPNIDNPVIQSLKAEYTRLKNEYDEKIKIFKPEYPDMVRLKARLDSLRTEL
A0A523ZSG1      LKSLDVGSLPQFVNNPLIQTLKTEYTRMKNEYEEKSEIFKSGYPEMMKLKAKLDSMRVEL
A0A7C0ZGV5      LSNLKVDTLPQFLNNKVLEDLRTEYIRLKNEYDEKSKVFKPEYPDMLKLKAKMESMRIQL
                :       :.    .  :  *.  *  :  :*       .. :* *  *.: :::    *

A0A1F5AEV3      QNETQNLIRNAYNDYQNALDKEQSYQKLLNDQKNMAYKASSNSVVYNSMRIELENRKALL
A0A7C6EJS8      ENETQNMIKAAYSEYQAALKKEKSLEAVFNKQKEEAFNLNSNAIIYNALKTEIENKKNLL
A0A524I5M4      QGEIRKAVDSAEAEYRAALKKETSLQGLLDEQRGDVTRMNKNAIFYHTLRTEVENMRTLL
A0A3E2BQJ8      KNETQRLIKAAYADYQAALKKEVSLKELFEQQKEEAFRLNSSAILYNSLKIELENKKNLL
A0A523QJ88      ENEIAKAVDEAERTYSSSLKEETSLKNLLEAHKADVIRMNSNAIFYNSLKIEVDNKRRLL
A0A523ZV46      ENEIAKAVDEAERTYSSSLKEEISLKNLLEAHKADVIRMNSNAIFYNSLKIEVDNKRRLL
A0A3E2BKD4      ANEKENLIKTAYADYQGALAKEQNLQRLLDDLKAQAYKANSTAILYNSLKIETDNKKALL
A0A2N7QEB5      KNETENLVKAAYSEYQAALKKENSLRDLFERQKEEAFRMNSNAILYNSLKIEIENRKNLL
A0A7C5LCJ6      KNETQRLVMAAYSEYQSALNKEKSLQAMFEKQKEEAFRLNSNAILYNSLKIEIENKKNLL
A0A497E0A2      EREISQAVDAARSEYRAALARENSLKKLLEKQREDVVKMNNNAILYNSLKIEVENKRNLL
A0A1W9P661      EKEISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDVENKRNLL
A0A7C0ZJ01      EKEISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDVENKRNLL
A0A523ZSG1      KSEIEKAVDHAESEYRSSLKEESSLKVLLEEQRADVVRMNSNAILYNSLKIEVENKRKLL
A0A7C0ZGV5      EEEIGKAVKAAELEYRAALKKEESLKELLDQQKNAVAQMNSNAIIYNSLKIEVENMRKLL
                  *  . :  *   *  :*  * .   :::  .  . . ...::.*:::. : :* . **

A0A1F5AEV3      EALSRRQSETDVSSRLKGLEALNVWIVDKADYPLRPAFPNKRKNVLMGFLFGLAGGIGLA
A0A7C6EJS8      DSLIKRQSEMGVAARQRGLRTANVRVVDKADVPLRPSSPKKRQNLILALIIGLMGGVGLA
A0A524I5M4      STLVAKQNEIQVSSQLGGLRTSNIKVVDRALVPGGPFSPNVRRNLLTALLLGLFGGLGLI
A0A3E2BQJ8      ESLLKRQSETGVSARLKGLRTSNIRIVDRADLPLRPDSPRKFRNLLLALFLGLFGGLGLA
A0A523QJ88      NSLVERQNETLVSARLGGLKTSNTSIIDKAEVPKSPVSPNKKLNLILALFVGIFGGVGLC
A0A523ZV46      NSLVERQNETLVSARLGGLKTSNTSIIDKAEVPKFPVSPNKKLNLILALFVGIFGGVGLC
A0A3E2BKD4      EALSKRQSETDLASRLKDLQALNVWIVDKASVPVNPSFPNRRKTFLIGVLLALIGGAGTS
A0A2N7QEB5      ESLLKRQSETGVSARLKGLRTSNIRVVDRADIPIRPSSPKKFRNLLLALFLGLFGGVGLA
A0A7C5LCJ6      ESLLKRQSETGVSARLRGLRTSNIRIVDRADIPIRPSSPRKFRNFLLALFLGLLGGVGLA
A0A497E0A2      NSLIAKQNEALVSARLKGLRTSNIKIVDRALVPQSPIYPTPVRNVMLAFLLSLFVGVGLA
A0A1W9P661      NSLIAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVA
A0A7C0ZJ01      NSLIAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVA
A0A523ZSG1      NSLVERQNETLVSARLGGLRMSNISIIDRGDIPKSPVSPKKKRNLILAFLIGILGGGGLC
A0A7C0ZGV5      NSLEERQKETLVSTRLGELKTSNISIIDRAEPPTSPVSPKKKLNLLLALIIGLFGGVGLC
                .:*  .*.*  :::.   *   *  ::*..  *  *  *    ..: ..:..:  * *  

A0A1F5AEV3      LGLEYLNHTVKTSKDITHSIGVPTLGAIPAFEAEAKPKGPKAEFARLISMLRGKGERKET
A0A7C6EJS8      FLYEYLDNTVKTAEDVERYGKAPALGIVPTFSVDGFRRGYGYG-YYSYAYGYGQKRRKRK
A0A524I5M4      FVVEYLDNTVKGPEDVEKLVGLPSLGIIPFLTADGQKKRS---------DPYGSYRSYGA
A0A3E2BQJ8      LVMEYLDNTVKSAEDVERYSGLPTLGVVPVFDEDATLNGHYYAYRSGEEEEAGGKKKKKE
A0A523QJ88      FFLEFLDNTVKGPEEVERLTGLPSLGVIPYLSPDGMKKKNRYSYYSKYKYSYSEKKENSR
A0A523ZV46      FVLEYLDNSVKGPEEVERLTGLPSLGVIPYLSPDGMKKKNRYSYYSKYKYSYSEKKENSR
A0A3E2BKD4      LFINYLVATVKSSRDISQATGWATIGTIPAFEKEYKPKGPRAEFRTLSSLLKGKPGILDK
A0A2N7QEB5      LGMEYLDNSVKSVEDVERYSGLPTLGVVPAFGDNSGSYGH----YYAYHSSESRSKRNKS
A0A7C5LCJ6      LVVEYLDNSVKSVEDVERYSGLPTLGVVPAFSEDSVLSGY----YYAYRSGDEEGKKKKS
A0A497E0A2      FFLEFLDNTIKSPEDVEHLVDLPSLGLIPLISATNGAKKN----YYTHQYSYG------E
A0A1W9P661      FILEYLDNTIKSPEDVEQLVDLPSLGLIPLVSASNGVKKA----SYTHQYSYG------Q
A0A7C0ZJ01      FILEYLDNTIKSPEDVEQLVDLPSLGLIPLVSASNGVKKA----SYTHQYSYG------Q
A0A523ZSG1      FLLEYLDNTVKGPEEVERLTGLPSLGVIPHLSPERIRKKKRYGLYSKYMYSDG------K
A0A7C0ZGV5      FVLEYLDNTVKGPDDAEKLTGIASLGIVPFLPPGGLRKLSRKGYYYRYHYQSGEGEKGQK
                :  ::*  ::*   :  .    .::* :* .                             

A0A1F5AEV3      KASRRVEDQRVRFLKPNGTDGDSVGG----------------------------------
A0A7C6EJS8      EEKEREKEGAKESEKEREREKQKEKEKERGGVTLAEKTEGEEGEGVGGLTEKASLGGDKK
A0A524I5M4      ESDKPGEK----------------------------------------------------
A0A3E2BQJ8      QDKAEGEN----------------------------------------------------
A0A523QJ88      REEA--------------------------------------------------------
A0A523ZV46      REEA--------------------------------------------------------
A0A3E2BKD4      KKKKKHSQPKPKSVSLKADQASQ-------------------------------------
A0A2N7QEB5      EKK-DTKQ----------------------------------------------------
A0A7C5LCJ6      EKKMEARA----------------------------------------------------
A0A497E0A2      REGEELEE----------------------------------------------------
A0A1W9P661      QEGETLEE----------------------------------------------------
A0A7C0ZJ01      QEGETLEE----------------------------------------------------
A0A523ZSG1      KNPDDGNN----------------------------------------------------
A0A7C0ZGV5      KPGEEASE----------------------------------------------------
                                                                            

A0A1F5AEV3      ------------------------------------------------------------
A0A7C6EJS8      IIYKPGEGLITVSSRPSEPRGREEAQRKMAEGKKAAVSTGEGAGEEAAGAERAEPGEVIS
A0A524I5M4      ------------------------------------------------------------
A0A3E2BQJ8      ------------------------------------------------------------
A0A523QJ88      ------------------------------------------------------------
A0A523ZV46      ------------------------------------------------------------
A0A3E2BKD4      -----------------------------------------------------------A
A0A2N7QEB5      ------------------------------------------------------------
A0A7C5LCJ6      ------------------------------------------------------------
A0A497E0A2      ------------------------------------------------------------
A0A1W9P661      ------------------------------------------------------------
A0A7C0ZJ01      ------------------------------------------------------------
A0A523ZSG1      ------------------------------------------------------------
A0A7C0ZGV5      ------------------------------------------------------------
                                                                            

A0A1F5AEV3      -----GMRGGKIDLIASREPQSIQAESYRSIRTTLFVSSPPGKIKTILFTSPLAREGKSS
A0A7C6EJS8      EEEKKLKEVKAIELIPHFAPKSSFAESYRTIRTALLLSSPQEKLRSIVISSPLPAEGKTA
A0A524I5M4      -----IPEVREIELINHLYPKFSISEDYRTVRTSILFSHADSAPKTISFTSTLPQEGKTA
A0A3E2BQJ8      -----GSEPRSIELISHFAPDSTFAESYRSLRTALLLSGPLASLKSLIITSPLPNEGKSV
A0A523QJ88      -----LPDIKEIELVNHLHPKFFISEDYRTVRTSILLSHAESPPKTIAFSSALPQEGKTV
A0A523ZV46      -----LPDIKEIELVNHLHPKFFISEDYRTVRTSILLSHAESPPKTIAFSSALPQEGKTV
A0A3E2BKD4      PAETPDRNNHQIELIIQREPRCIQSEAFRSIRTSLLLSFDSPARKALIFSSPLSKDGKSS
A0A2N7QEB5      -----QEEVTNIELTSHFAPESVFAESYRSLRTALLLSAPQGSLKMVMITSPLPGEGKST
A0A7C5LCJ6      -----GHEPRSIELIAHFAPESAFAESYRSLRTALLLSGPQERLRVLMVTSPLPDEGKSA
A0A497E0A2      -----DALIKNIELINYYYPNIAVAEDYRTIRTSILFSSLEETSQAIAFTSAFPQEGKST
A0A1W9P661      -----E-VINNIELINYYYPNISIAEDYRTIRTSILFSSLEDKPMAIGFTSSLPEEGKST
A0A7C0ZJ01      -----E-VINNIELINYYYPNISIAEDYRTIRTSILFSSLEDKPMAIGFTSSLPEEGKST
A0A523ZSG1      -----LSDIKEIEFVNESHPKLSVSEDYRTVRTSILLSQAGTPPKTIVFSSSVPQEGKTA
A0A7C0ZGV5      -----VPDVNEIELINFKYSNVPISEDYRTIRTSILLSSAGGPPRSILVTSSVPQEGKTA
                           *::     .    :* :*::**:::.*        : .:*... :**: 

A0A1F5AEV3      TVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGNGPGLSRYLSSHIEPADVGKPTE
A0A7C6EJS8      TVANLAVTLAQANRRVLLVDADLRKPRLHRIFRVK--NVNGLTNFLVSDVEYRDLIKATD
A0A524I5M4      TISNLAVSFAQLEGKVLLIDADLRKPRLHKVFNLR--NINGLSSYLAGKNSFEEVVQMTS
A0A3E2BQJ8      TISNLAVSLAQMEKKVLLMDADLRRPKQHRIFNLK--NHDGLSNYLTMGLELNKLIKTTL
A0A523QJ88      TAINTAVAFSQLKEKVLLVDSDLRKPRLHRIFKVK--NAGGLSGYLTGKVSIEDAIQKTN
A0A523ZV46      TAINTAVAFSQLKEKVLLVDSDLRKPRLHRIFKVK--NAGGLSGYLTGKVSIEDAIQKTN
A0A3E2BKD4      VISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVD--YTWGLTHFLSAIVDASEIIRPTA
A0A2N7QEB5      TISNLAISLAQMGKKILLIDADLRRPNQHHNFNIK--NNNGLTNYLAMDLEIEKIIKPTM
A0A7C5LCJ6      TISNLAVSLAQMEKRVVLIDADLRKPKQHKIFNQK--NHDGLTNYLAMGLEPERLIKTTL
A0A497E0A2      TAVNTAVAFAQMDRRIVLLDADLRKPRLHKIFENS--NRLGLSSYLAGKAPLESIIQSTK
A0A1W9P661      TLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNT--NRIGLSNYLAGKSSIDEIIHPTK
A0A7C0ZJ01      TLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNT--NRIGLSNYLAGKSSIDEIIHPTK
A0A523ZSG1      TVTNMAISFSQLDKKVLIIDADMRKPRLHRLFKIK--NVGGLSGYLTGRVSIKNALKKTS
A0A7C0ZGV5      TVVNLAIAFAQLGQKILVVDADMRKPRLHRIFKLG--SSVGLSSCLTGKAKIEECILKTD
                .  * .:::::   .::::*.*:*.*.    *        **:  *            * 

A0A1F5AEV3      IPNLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDFVLFDTPPLLAVSDALAMGPMAD
A0A7C6EJS8      IPNLYVINAGPVPPNPAELLGSEKMSRLVDFAKQYFHHLLFDSPPVLVVADAMVLGPLVD
A0A524I5M4      IDNVWTIPSGPHPPNPAELLNSKRMKELLAMAKDRFNIVLLDTPPVLAVIDPVIISSLVD
A0A3E2BQJ8      VPSLYFINSGPVPPNPAELLGSDRMKALLDRLKAAFDFILIDTPPILSVTDAQVLGKMVD
A0A523QJ88      VKNVWLIPSGPIPPNPAELVNSGKMKELMEEAKKKFDIVLFDTPPVLAVVDAVIVSSFTD
A0A523ZV46      VKNVWLIPSGPIPPNPAELVNSGKMKELMEEAKKKFDVVLFDTPPILAVVDAVIVSSFTD
A0A3E2BKD4      YTNLFVVPSGVTPSDPLEIMFSEKMKAFINFLKQQFDFVLFDSPPILAVSDALVLGKQVD
A0A2N7QEB5      VPSLYLINSGPIPPNPAELLSSDKMSQLLSKVREQFDFILIDTPPILAVTDAQILGRLVD
A0A7C5LCJ6      VPSLYFINSGPIPPNPAELLSSEKMKALLEKLKGQFDFILVDTPPILSVTDAQIVGRMVD
A0A497E0A2      VSGMDLIPCGLHPPNPAELLESRRFQQLIRLLKEEYDFVFVDSPPVLAVVDASVVSARVD
A0A1W9P661      ITKLDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDFVLVDSPPTLAVVDASVVSTRMD
A0A7C0ZJ01      ITKLDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDFVLVDSPPTLAVVDASVVSTRMD
A0A523ZSG1      HKNIWIITSGPIPPNPAELLNSERMEELLKDAKEKYDVVLLDTPPILAVVDALIVSSLSE
A0A7C0ZGV5      IDGLSVLPCGPVPPNPTELIDSDKMKELVEKLTASYDLVLFDSPPVLAVVDPVILANLVE
                   :  : .*  *.:* *:: * .:  ::      :  ::.*:** * * *.  :.   :

A0A1F5AEV3      AIILVARGGQTPIPALKQAKQKLDAHKLKCLGVILNGVDLVEQDGY---------YARQY
A0A7C6EJS8      GMVLVVWGEKTTREALQRAREKLDLMKIKLMGVIINNLDIRRHHYY-----YKHYYYDYY
A0A524I5M4      STVFVVRAGKTTRRPLVRAIEEIRKSKADIIGVVFNEVKIGHQGIG---TPFYHYYQYEY
A0A3E2BQJ8      GLVLVVQADRTPREALKQTREVIDLLQLKTYGVVINALNLDNRGYY------RRQYYRHY
A0A523QJ88      STVFIIHAGKTEQKPFLQAVEEMKKAKAKIIGVLFNEVKIKRDGYY------SP------
A0A523ZV46      STVFIIHAGKTEQKPFLQAVEEMKKAKAKIIGVLFNEVKIKRDGYY------SSYYRYHY
A0A3E2BKD4      GLILVVRAGQTPLNALKQARNKVEDHKINCLGVIINGVSLLEQEGY---------YARQY
A0A2N7QEB5      GLVLVIRAETTPREALQQARELIDLLKLKTFGVVVNYLNLNHRGYY------YRHYYRHY
A0A7C5LCJ6      GLVLVVQAEKTPREALRQARDTIDLLKLKTFGVVVNSLNLDSRGYY------YRHYYRHY
A0A497E0A2      GVVIVIKANKTTKKALYQSVETLRKAKAHILGVVFNEVRISRDGYY---SPDYHGYLKGY
A0A1W9P661      GVVVVIRANKTTKKSLLYAVETLRKAKAPILGVVLNEVPFSHNGYY---SPDYHGYLKGY
A0A7C0ZJ01      GVVVVIRANKTTKKSLLYAVETLRKAKAPILGVVLNEVPFSHNGYY---SPDYHGYLKGY
A0A523ZSG1      SMVFIIRAGKTARVPFLRAVEELKQAKTKIVGVVFNEVKIKEREYY---SPYQHYYRQSY
A0A7C0ZGV5      ATILVVLSGKTTDKALVGATEELKKARAKLIGAVFNGVKMDKQGYYYYSRSYRPYYHSGS
                . :.:  .  *   .:  : : :   .    *.:.* : :                    

A0A1F5AEV3      YHYSKPE---------------------
A0A7C6EJS8      YRRYSP----------------------
A0A524I5M4      EATEGAGPAEKKRGPAGEAEKARAGTKT
A0A3E2BQJ8      YQK-------------------------
A0A523QJ88      ----------------------------
A0A523ZV46      YGEEERTE--------------------
A0A3E2BKD4      YHYSKPL---------------------
A0A2N7QEB5      YKEYRR----------------------
A0A7C5LCJ6      QKEYRG----------------------
A0A497E0A2      YSSTK-----------------------
A0A1W9P661      YSSSKQ----------------------
A0A7C0ZJ01      YSSSKH----------------------
A0A523ZSG1      YGEEDEH---------------------
A0A7C0ZGV5      EGKEERE---------------------
                                            

© 1998-2021Legal notice