BYKdb

Dataset for cluster tadcd of phylum candidatus-aminicenantes

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F5AEV3      -----MATEFPKEPQTGLLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTA
A0A524I5M4      -------MKGFASKTDKKEIDVLEYVRIVLKRKWVLATFAAVLVALAAVLSFTTTPLYRA
A0A2N7QEB5      ----MNDNNIEPQADEIGEIDLKKYLDILLRRRWTIISVTVIAVVISLLISLVTRPMYTA
A0A3E2BQJ8      ---MSNENYVEPQALDAGEIDLRKYIDIIFRRRWTVISITLIAAALSLIISFVTRPVYKA
A0A523QJ88      ----------------------------------------AVLMLSVGIITFNIVPKYKA
A0A523ZV46      --------MEYEPMEKEREIDLLEYWKTIVKRKWVIVVFAAALMLSVGIITFNIVPKYKA
A0A3E2BKD4      MDRTTPTTAGPRQTQQNLLEQILYYWNAMLRWKWTGLTVAILIVALTLVYVFISPHIYSA
A0A523ZSG1      ---------MEQGRYEKDEVDLLEYWRIIVKRKWVLIAFTGALVLFTGIFSFLATPKYES
A0A1W9P661      ----------MRDNKGKKEIDLFDIWRVALKRKWIIITIVILFIVGAGIYSFTRTPIYQA
A0A497E0A2      ------------MKKEKKEIDLLEIWRIALKRKWLIISIIIVFVIGAGIYSLTRTPIYQA
                                                                :  :     : :

A0A1F5AEV3      SGSVWIEDDPN-ILPFEDVQSFGA-------GSNLQSHARLLRSRTLASDTIDKLKLYEN
A0A524I5M4      TATLLIDEPGASLLNIQDVLNAGAFYRSDYMGTYFNTQLRLLASRSLAERVAKKINLGAR
A0A2N7QEB5      HGTVMIEKEPN-ILSFEDIFQIE-----TFRDDYFQTQYKLLQSRSLAERTIDKLKLWEK
A0A3E2BQJ8      RGTVMIEKEPN-ILSFEDIFQIE-----TFRDDYFQTQYKLLQSRSLAERTIERLKLWEK
A0A523QJ88      MTTLLIKEEGSRMLSIEDEFGYQRR---VVNLRFYNTQLKLLKSKSLVERVVRKMNLPAR
A0A523ZV46      MTTLLIKEEGSRMLSIEDEFGYQRR---VVNLRFYNTQLKLLKSKSLVERVVRKMNLPAR
A0A3E2BKD4      KGTIWIDETQS-VLPFEELSRLSG-------GINSQSHALLLKSRSLASDVIEKMKLHEH
A0A523ZSG1      TATLLIEGERSRILSIEDEFGYSRSYE-DLRS--FNTSLKLLKSKSLAERVARKMNLLNR
A0A1W9P661      TATILIEEPGSSMFNIEEMFNYTPYYRYDFLGVYFNTQLSLLTSRTLAERVARRMNLSER
A0A497E0A2      SATILIEEPGSSMLNLEEMFNYTPYYRYDFLGVYFNTQLRLLTSRSLAERVARRMNLADR
                  :: *.     :: :::                 ::   ** *.:*.. .  .::*  .

A0A1F5AEV3      SDFAGKPEKGQ---------------------ARPDPADPIY------REVLTQIFLSNI
A0A524I5M4      PEFRGARAEE----------------------------------PTPASSSYAFSILGGL
A0A2N7QEB5      TDFSGNRPLTSEELKDPR-----------------------------IKQKMIDRFLSRL
A0A3E2BQJ8      KEFSGSKSPTADDLKNPV-----------------------------FRQKMVDKFLGRL
A0A523QJ88      PEFSA-DQKPKKSLTTTVKNLISLRWIVPA--KKAEVGDSMYSIPSSPYAEIANVLQDGI
A0A523ZV46      PEFSA-DQKPKKSLTTTVKNLISLRWIVPE--KKPEIGDSMYSIPSSPYAEIANVLQDGI
A0A3E2BKD4      PEF------------------MGPKLPVRLAKERIQPDNPVF------KEKLIDEFIASL
A0A523ZSG1      PEFGW-GQTQKKGLLTTAKEAISLKWIFPR--KGAKTGESEPMIRSDPYSEIADTVRDAI
A0A1W9P661      MELNTQSSSSPASFLGQIKSFFSISRWFNRTKEVTQPALQEFVPPADLSANYAFVVLSGL
A0A497E0A2      LELQAQPNSTRGGFLSRLRSVFSLSYWVSKGKRNTQSDSTEFIPPTDINTNYAYVVLSGL
                 ::                                                    .   :

A0A1F5AEV3      GVSTAERSRLVDVRFSNRNPKLAADILNALFDGYIEMMVRKRYAASEQATAFLNTQIAEI
A0A524I5M4      SIAPIEETRLVYVSYVSPHAALAADVVNALVEEFVSFSVETRYEATKQTSEFLSEQVALL
A0A2N7QEB5      EVKPVRMTRLVEVTFSAHDPALASECVNTLFDSFVDMNIETKSEATEQATEFLSQQINDL
A0A3E2BQJ8      EVKPIRMTRLVEVAFKAHDPTLASDCVNALFDSFVDMNIEAKYETTEQATEFLSEQIEEL
A0A523QJ88      EVSSIRNTNLVEVSYKSPYPVLCSDIVNTLAEEFISFSVEKRYETTQQASDFLSEQIANL
A0A523ZV46      EVSSIRNTNLVEVSYKSPYPVLCSDIVNTLAEEFISFSVEKRYETTQQASDFLSEQIANL
A0A3E2BKD4      NVSPISGTKLIEVSFDHKNPRLAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQITAL
A0A523ZSG1      DVSAVRTTKLVEISYTSSSPVLAANIVNTLAEEFIDFSIGKRYETTQQASDFLSEQIANL
A0A1W9P661      KIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQIAQL
A0A497E0A2      RIQPVEETRLVEVSYRSPFPVLAADIVNNLIEEFINYSVEMRYEATRQASEFLNKQIAQL
                 : .   :.*: : :    . *.:: :* * : ::.  :  .  :: *:: **. *:  :

A0A1F5AEV3      RTDIDKKERELNKYGSEKDILPLTTAEAPTVARIGEVNRALTDATLDRVNKFNAYNQLNA
A0A524I5M4      REDLKRKEEDLQKYGQEKNLLYLSGDESSIVNKFSEVNTALTTAQIERYAKESVYRELKN
A0A2N7QEB5      KKEISQKEQELQNYGQEKNIVILSDKETTILDKLNEVNKALTEAQIDRVRKEAYYNEIKN
A0A3E2BQJ8      KKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELNKALTEAQIDRVRKESYYNGIKN
A0A523QJ88      RGDLAAKEKELQRYGKRKKLFFLSDTESATMSKFADLTEAYTQSQIERIKAEASYRELKE
A0A523ZV46      RGDLAAKEKELQRYGKRKKLFFLSDTESATMSKFADLTEAYTQSQIERIKAEASYRELKE
A0A3E2BKD4      RKDIEEAEKKLAELGTAQGILPLSSAEAPLISKITEVNTALTAATLDRVNKYTTYNQLKA
A0A523ZSG1      REDLSLKEKELQRYGQEKEIFFLTETESTVVNKFADLNGAHTQAQIGRIRREAEYRELKS
A0A1W9P661      RNELAAKEKELQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRELSS
A0A497E0A2      RDELAAKEKELQKYGEEKKLLFLNEKESSVVSKFAELNSAFTEAQIERIKKEAAYRELAS
                . ::   * .*   *  : :. *.  *:. : .  ::. * * : : *      :. :  

A0A1F5AEV3      APLGEIPDAPPGSLIQRLREQYINLSLDYRTRLATVRPEFPAMQRLKSELDAATEALQNE
A0A524I5M4      ISVDALPESVSNPTIQALKTTYSQVKSDYEEKGQIYRPDYPEMVQLKARLDATKNTLQGE
A0A2N7QEB5      ASPDFIPEALSNPLIQRLREDYLKLSREYAKMQEQFQPEYPEMQRLKAELDTARDLLKNE
A0A3E2BQJ8      ASPDFIPEAMNNPLIQRLREDYLKLSREYAKMQEKFQPEYPEMQRLKAELDSARELLKNE
A0A523QJ88      LEVDSLPQFVSNMMIQNLKTEYTRMRNEYKEKGEIYKSDYPVMVTLRAKLDSMRNELENE
A0A523ZV46      LEVDSLPQFVSNMMIQNLKTEYTRMRNEYKEKGEIYKSDYPVMVTLRAKLDSMRNELENE
A0A3E2BKD4      LRPEELPESPANPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEIEATYESLANE
A0A523ZSG1      LDVGSLPQFVNNPLIQTLKTEYTRMKNEYEEKSEIFKSGYPEMMKLKAKLDSMRVELKSE
A0A1W9P661      LQIDALSPNIDNPVIQSLKAEYTRLKNEYDEKIKIFKPEYPDMVRLKARLDSLRTELEKE
A0A497E0A2      LKVDALPPYISNPVIQNLKAEYTRLKNEYDEKIKIFKPEYPDMVRLKARLDSVRQELERE
                     :.    .  *  *.  *  :  :*       .. :* *  *.: :::    *  *

A0A1F5AEV3      TQNLIRNAYNDYQNALDKEQSYQKLLNDQKNMAYKASSNSVVYNSMRIELENRKALLEAL
A0A524I5M4      IRKAVDSAEAEYRAALKKETSLQGLLDEQRGDVTRMNKNAIFYHTLRTEVENMRTLLSTL
A0A2N7QEB5      TENLVKAAYSEYQAALKKENSLRDLFERQKEEAFRMNSNAILYNSLKIEIENRKNLLESL
A0A3E2BQJ8      TQRLIKAAYADYQAALKKEVSLKELFEQQKEEAFRLNSSAILYNSLKIELENKKNLLESL
A0A523QJ88      IAKAVDEAERTYSSSLKEETSLKNLLEAHKADVIRMNSNAIFYNSLKIEVDNKRRLLNSL
A0A523ZV46      IAKAVDEAERTYSSSLKEEISLKNLLEAHKADVIRMNSNAIFYNSLKIEVDNKRRLLNSL
A0A3E2BKD4      KENLIKTAYADYQGALAKEQNLQRLLDDLKAQAYKANSTAILYNSLKIETDNKKALLEAL
A0A523ZSG1      IEKAVDHAESEYRSSLKEESSLKVLLEEQRADVVRMNSNAILYNSLKIEVENKRKLLNSL
A0A1W9P661      ISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDVENKRNLLNSL
A0A497E0A2      ISQAVDAARSEYRAALARENSLKKLLEKQREDVVKMNNNAILYNSLKIEVENKRNLLNSL
                  . :  *   *  :*  * . . *::  .  . . ...::.*:::. : :* . **.:*

A0A1F5AEV3      SRRQSETDVSSRLKGLEALNVWIVDKADYPLRPAFPNKRKNVLMGFLFGLAGGIGLALGL
A0A524I5M4      VAKQNEIQVSSQLGGLRTSNIKVVDRALVPGGPFSPNVRRNLLTALLLGLFGGLGLIFVV
A0A2N7QEB5      LKRQSETGVSARLKGLRTSNIRVVDRADIPIRPSSPKKFRNLLLALFLGLFGGVGLALGM
A0A3E2BQJ8      LKRQSETGVSARLKGLRTSNIRIVDRADLPLRPDSPRKFRNLLLALFLGLFGGLGLALVM
A0A523QJ88      VERQNETLVSARLGGLKTSNTSIIDKAEVPKSPVSPNKKLNLILALFVGIFGGVGLCFFL
A0A523ZV46      VERQNETLVSARLGGLKTSNTSIIDKAEVPKFPVSPNKKLNLILALFVGIFGGVGLCFVL
A0A3E2BKD4      SKRQSETDLASRLKDLQALNVWIVDKASVPVNPSFPNRRKTFLIGVLLALIGGAGTSLFI
A0A523ZSG1      VERQNETLVSARLGGLRMSNISIIDRGDIPKSPVSPKKKRNLILAFLIGILGGGGLCFLL
A0A1W9P661      IAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVAFIL
A0A497E0A2      IAKQNEALVSARLKGLRTSNIKIVDRALVPQSPIYPTPVRNVMLAFLLSLFVGVGLAFFL
                  .*.*  :::.* .*   *  ::*..  *  *  *    ..: ..:..:  * *  : :

A0A1F5AEV3      EYLNHTVKTSKDITHSIGVPTLGAIPAFEAEAKPKG-PKAEFARLISMLRGK---GERKE
A0A524I5M4      EYLDNTVKGPEDVEKLVGLPSLGIIPFLTADGQKKRSDPYGSYRSYGAESDK--------
A0A2N7QEB5      EYLDNSVKSVEDVERYSGLPTLGVVPAFGDNSGSYG-HYYAYHSSESRSKRN--------
A0A3E2BQJ8      EYLDNTVKSAEDVERYSGLPTLGVVPVFDEDATLNG-HYYAYRSGEEEEAGG--------
A0A523QJ88      EFLDNTVKGPEEVERLTGLPSLGVIPYLSPDGMKKK-NRYSYYSKYKYSYSE--------
A0A523ZV46      EYLDNSVKGPEEVERLTGLPSLGVIPYLSPDGMKKK-NRYSYYSKYKYSYSE--------
A0A3E2BKD4      NYLVATVKSSRDISQATGWATIGTIPAFEKEYKPKG-PRAEFRTLSSLLKGKPGILDKKK
A0A523ZSG1      EYLDNTVKGPEEVERLTGLPSLGVIPHLSPERIRKK-KRYGLYSKYMYSDGK--------
A0A1W9P661      EYLDNTIKSPEDVEQLVDLPSLGLIPLVSASNGVKK-ASY----THQYSYGQ--------
A0A497E0A2      EFLDNTIKSPEDVEHLVDLPSLGLIPLISATNGAKK-NYY----THQYSYGE--------
                ::*  ::*   :: .  . .::* :* .                                

A0A1F5AEV3      TKASRRVEDQRVRFLKPNGTDGDSVGGGMRGGKIDLIASREPQSIQAESYRSIRTTLFVS
A0A524I5M4      -----------------------PGEKIPEVREIELINHLYPKFSISEDYRTVRTSILFS
A0A2N7QEB5      ------------------KSEKKDTKQQEEVTNIELTSHFAPESVFAESYRSLRTALLLS
A0A3E2BQJ8      -------------KKKKKEQDKAEGENGSEPRSIELISHFAPDSTFAESYRSLRTALLLS
A0A523QJ88      -----------------KKENSRREEALPDIKEIELVNHLHPKFFISEDYRTVRTSILLS
A0A523ZV46      -----------------KKENSRREEALPDIKEIELVNHLHPKFFISEDYRTVRTSILLS
A0A3E2BKD4      KKKHSQPKPKSVSLKADQASQAPAETPDRNNHQIELIIQREPRCIQSEAFRSIRTSLLLS
A0A523ZSG1      -------------------KNPDDGNNLSDIKEIEFVNESHPKLSVSEDYRTVRTSILLS
A0A1W9P661      -------------------QEGETLEEE-VINNIELINYYYPNISIAEDYRTIRTSILFS
A0A497E0A2      -------------------REGEELEEDALIKNIELINYYYPNIAVAEDYRTIRTSILFS
                                                .*::     *    :* :*::**:::.*

A0A1F5AEV3      SPPGKIKTILFTSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGN
A0A524I5M4      HADSAPKTISFTSTLPQEGKTATISNLAVSFAQLEGKVLLIDADLRKPRLHKVFNLR--N
A0A2N7QEB5      APQGSLKMVMITSPLPGEGKSTTISNLAISLAQMGKKILLIDADLRRPNQHHNFNIK--N
A0A3E2BQJ8      GPLASLKSLIITSPLPNEGKSVTISNLAVSLAQMEKKVLLMDADLRRPKQHRIFNLK--N
A0A523QJ88      HAESPPKTIAFSSALPQEGKTVTAINTAVAFSQLKEKVLLVDSDLRKPRLHRIFKVK--N
A0A523ZV46      HAESPPKTIAFSSALPQEGKTVTAINTAVAFSQLKEKVLLVDSDLRKPRLHRIFKVK--N
A0A3E2BKD4      FDSPARKALIFSSPLSKDGKSSVISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVD--Y
A0A523ZSG1      QAGTPPKTIVFSSSVPQEGKTATVTNMAISFSQLDKKVLIIDADMRKPRLHRLFKIK--N
A0A1W9P661      SLEDKPMAIGFTSSLPEEGKSTTLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNT--N
A0A497E0A2      SLEETSQAIAFTSAFPQEGKSTTAVNTAVAFAQMDRRIVLLDADLRKPRLHKIFENS--N
                        : ::*... :**: .  * .:::::   .::::*.*:*.*.    *      

A0A1F5AEV3      GPGLSRYLSSHIEPADVGKPTEIPNLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDF
A0A524I5M4      INGLSSYLAGKNSFEEVVQMTSIDNVWTIPSGPHPPNPAELLNSKRMKELLAMAKDRFNI
A0A2N7QEB5      NNGLTNYLAMDLEIEKIIKPTMVPSLYLINSGPIPPNPAELLSSDKMSQLLSKVREQFDF
A0A3E2BQJ8      HDGLSNYLTMGLELNKLIKTTLVPSLYFINSGPVPPNPAELLGSDRMKALLDRLKAAFDF
A0A523QJ88      AGGLSGYLTGKVSIEDAIQKTNVKNVWLIPSGPIPPNPAELVNSGKMKELMEEAKKKFDI
A0A523ZV46      AGGLSGYLTGKVSIEDAIQKTNVKNVWLIPSGPIPPNPAELVNSGKMKELMEEAKKKFDV
A0A3E2BKD4      TWGLTHFLSAIVDASEIIRPTAYTNLFVVPSGVTPSDPLEIMFSEKMKAFINFLKQQFDF
A0A523ZSG1      VGGLSGYLTGRVSIKNALKKTSHKNIWIITSGPIPPNPAELLNSERMEELLKDAKEKYDV
A0A1W9P661      RIGLSNYLAGKSSIDEIIHPTKITKLDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDF
A0A497E0A2      RLGLSSYLAGKAPLESIIQSTKVSGMDLIPCGLHPPNPAELLESRRFQQLIRLLKEEYDF
                  **: :*:      .  . *    :  : .*  *.:* *:: * .:  ::   .  ::.

A0A1F5AEV3      VLFDTPPLLAVSDALAMGPMADAIILVARGGQTPIPALKQAKQKLDAHKLKCLGVILNGV
A0A524I5M4      VLLDTPPVLAVIDPVIISSLVDSTVFVVRAGKTTRRPLVRAIEEIRKSKADIIGVVFNEV
A0A2N7QEB5      ILIDTPPILAVTDAQILGRLVDGLVLVIRAETTPREALQQARELIDLLKLKTFGVVVNYL
A0A3E2BQJ8      ILIDTPPILSVTDAQVLGKMVDGLVLVVQADRTPREALKQTREVIDLLQLKTYGVVINAL
A0A523QJ88      VLFDTPPVLAVVDAVIVSSFTDSTVFIIHAGKTEQKPFLQAVEEMKKAKAKIIGVLFNEV
A0A523ZV46      VLFDTPPILAVVDAVIVSSFTDSTVFIIHAGKTEQKPFLQAVEEMKKAKAKIIGVLFNEV
A0A3E2BKD4      VLFDSPPILAVSDALVLGKQVDGLILVVRAGQTPLNALKQARNKVEDHKINCLGVIINGV
A0A523ZSG1      VLLDTPPILAVVDALIVSSLSESMVFIIRAGKTARVPFLRAVEELKQAKTKIVGVVFNEV
A0A1W9P661      VLVDSPPTLAVVDASVVSTRMDGVVVVIRANKTTKKSLLYAVETLRKAKAPILGVVLNEV
A0A497E0A2      VFVDSPPVLAVVDASVVSARVDGVVIVIKANKTTKKALYQSVETLRKAKAHILGVVFNEV
                ::.*:** *:* *.  :.   :. :.: ..  *   .:  : : :   :    **:.* :

A0A1F5AEV3      DLVEQDGYYARQYYHYSKPE----------------------------
A0A524I5M4      K-IGHQGIGTPFYHYYQYEYEATEGAGPAEKKRGPAGEAEKARAGTKT
A0A2N7QEB5      N-LNHRGYYYRHYYRHYYKEYRR-------------------------
A0A3E2BQJ8      N-LDNRGYYRRQYYRHYYQK----------------------------
A0A523QJ88      K-IKRDGYYSP-------------------------------------
A0A523ZV46      K-IKRDGYYSSYYRYHYYGEEERTE-----------------------
A0A3E2BKD4      SLLEQEGYYARQYYHYSKPL----------------------------
A0A523ZSG1      K-IKEREYYSPYQHYYRQSYYGEEDEH---------------------
A0A1W9P661      P-FSHNGYYSPDYHGYLKGYYSSSKQ----------------------
A0A497E0A2      R-ISRDGYYSPDYHGYLKGYYSSTK-----------------------
                  .                                             

© 1998-2020Legal notice