BYKdb

Dataset for cluster tadcd of phylum candidatus-aminicenantes

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bykdb|A0A1F5AEV3 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium RBG_16_63_14] (length=756 residues).
MATEFPKEPQTGLLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTASGSVWIEDDPNILPFEDVQSFGAGS
NLQSHARLLRSRTLASDTIDKLKLYENSDFAGKPEKGQARPDPADPIYREVLTQIFLSNIGVSTAERSRLVDVRFSNRNP
KLAADILNALFDGYIEMMVRKRYAASEQATAFLNTQIAEIRTDIDKKERELNKYGSEKDILPLTTAEAPTVARIGEVNRA
LTDATLDRVNKFNAYNQLNAAPLGEIPDAPPGSLIQRLREQYINLSLDYRTRLATVRPEFPAMQRLKSELDAATEALQNE
TQNLIRNAYNDYQNALDKEQSYQKLLNDQKNMAYKASSNSVVYNSMRIELENRKALLEALSRRQSETDVSSRLKGLEALN
VWIVDKADYPLRPAFPNKRKNVLMGFLFGLAGGIGLALGLEYLNHTVKTSKDITHSIGVPTLGAIPAFEAEAKPKGPKAE
FARLISMLRGKGERKETKASRRVEDQRVRFLKPNGTDGDSVGGGMRGGKIDLIASREPQSIQAESYRSIRTTLFVSSPPG
KIKTILFTSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGNGPGLSRYLSSHIEPADVGKPTEIP
NLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDFVLFDTPPLLAVSDALAMGPMADAIILVARGGQTPIPALKQAKQK
LDAHKLKCLGVILNGVDLVEQDGYYARQYYHYSKPE
>gnl|bykdb|A0A1W9P661 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium 4484_214] (length=760 residues).
MRDNKGKKEIDLFDIWRVALKRKWIIITIVILFIVGAGIYSFTRTPIYQATATILIEEPGSSMFNIEEMFNYTPYYRYDF
LGVYFNTQLSLLTSRTLAERVARRMNLSERMELNTQSSSSPASFLGQIKSFFSISRWFNRTKEVTQPALQEFVPPADLSA
NYAFVVLSGLKIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQIAQLRNELAAKEKE
LQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRELSSLQIDALSPNIDNPVIQSLKAEYTRLKNEYD
EKIKIFKPEYPDMVRLKARLDSLRTELEKEISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDV
ENKRNLLNSLIAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVAFILEYLDNTIKSP
EDVEQLVDLPSLGLIPLVSASNGVKKASYTHQYSYGQQEGETLEEEVINNIELINYYYPNISIAEDYRTIRTSILFSSLE
DKPMAIGFTSSLPEEGKSTTLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNTNRIGLSNYLAGKSSIDEIIHPTKITK
LDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDFVLVDSPPTLAVVDASVVSTRMDGVVVVIRANKTTKKSLLYAVETL
RKAKAPILGVVLNEVPFSHNGYYSPDYHGYLKGYYSSSKQ
>gnl|bykdb|A0A2N7QEB5 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=734 residues).
MNDNNIEPQADEIGEIDLKKYLDILLRRRWTIISVTVIAVVISLLISLVTRPMYTAHGTVMIEKEPNILSFEDIFQIETF
RDDYFQTQYKLLQSRSLAERTIDKLKLWEKTDFSGNRPLTSEELKDPRIKQKMIDRFLSRLEVKPVRMTRLVEVTFSAHD
PALASECVNTLFDSFVDMNIETKSEATEQATEFLSQQINDLKKEISQKEQELQNYGQEKNIVILSDKETTILDKLNEVNK
ALTEAQIDRVRKEAYYNEIKNASPDFIPEALSNPLIQRLREDYLKLSREYAKMQEQFQPEYPEMQRLKAELDTARDLLKN
ETENLVKAAYSEYQAALKKENSLRDLFERQKEEAFRMNSNAILYNSLKIEIENRKNLLESLLKRQSETGVSARLKGLRTS
NIRVVDRADIPIRPSSPKKFRNLLLALFLGLFGGVGLALGMEYLDNSVKSVEDVERYSGLPTLGVVPAFGDNSGSYGHYY
AYHSSESRSKRNKSEKKDTKQQEEVTNIELTSHFAPESVFAESYRSLRTALLLSAPQGSLKMVMITSPLPGEGKSTTISN
LAISLAQMGKKILLIDADLRRPNQHHNFNIKNNNGLTNYLAMDLEIEKIIKPTMVPSLYLINSGPIPPNPAELLSSDKMS
QLLSKVREQFDFILIDTPPILAVTDAQILGRLVDGLVLVIRAETTPREALQQARELIDLLKLKTFGVVVNYLNLNHRGYY
YRHYYRHYYKEYRR
>gnl|bykdb|A0A3E2BKD4 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Saccharicenans subterraneum] (length=765 residues).
MDRTTPTTAGPRQTQQNLLEQILYYWNAMLRWKWTGLTVAILIVALTLVYVFISPHIYSAKGTIWIDETQSVLPFEELSR
LSGGINSQSHALLLKSRSLASDVIEKMKLHEHPEFMGPKLPVRLAKERIQPDNPVFKEKLIDEFIASLNVSPISGTKLIE
VSFDHKNPRLAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQITALRKDIEEAEKKLAELGTAQGILPLSSAEAPLIS
KITEVNTALTAATLDRVNKYTTYNQLKALRPEELPESPANPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEIEA
TYESLANEKENLIKTAYADYQGALAKEQNLQRLLDDLKAQAYKANSTAILYNSLKIETDNKKALLEALSKRQSETDLASR
LKDLQALNVWIVDKASVPVNPSFPNRRKTFLIGVLLALIGGAGTSLFINYLVATVKSSRDISQATGWATIGTIPAFEKEY
KPKGPRAEFRTLSSLLKGKPGILDKKKKKKHSQPKPKSVSLKADQASQAPAETPDRNNHQIELIIQREPRCIQSEAFRSI
RTSLLLSFDSPARKALIFSSPLSKDGKSSVISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVDYTWGLTHFLSAIVDAS
EIIRPTAYTNLFVVPSGVTPSDPLEIMFSEKMKAFINFLKQQFDFVLFDSPPILAVSDALVLGKQVDGLILVVRAGQTPL
NALKQARNKVEDHKINCLGVIINGVSLLEQEGYYARQYYHYSKPL
>gnl|bykdb|A0A3E2BQJ8 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Saccharicenans subterraneum] (length=737 residues).
MSNENYVEPQALDAGEIDLRKYIDIIFRRRWTVISITLIAAALSLIISFVTRPVYKARGTVMIEKEPNILSFEDIFQIET
FRDDYFQTQYKLLQSRSLAERTIERLKLWEKKEFSGSKSPTADDLKNPVFRQKMVDKFLGRLEVKPIRMTRLVEVAFKAH
DPTLASDCVNALFDSFVDMNIEAKYETTEQATEFLSEQIEELKKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELN
KALTEAQIDRVRKESYYNGIKNASPDFIPEAMNNPLIQRLREDYLKLSREYAKMQEKFQPEYPEMQRLKAELDSARELLK
NETQRLIKAAYADYQAALKKEVSLKELFEQQKEEAFRLNSSAILYNSLKIELENKKNLLESLLKRQSETGVSARLKGLRT
SNIRIVDRADLPLRPDSPRKFRNLLLALFLGLFGGLGLALVMEYLDNTVKSAEDVERYSGLPTLGVVPVFDEDATLNGHY
YAYRSGEEEEAGGKKKKKEQDKAEGENGSEPRSIELISHFAPDSTFAESYRSLRTALLLSGPLASLKSLIITSPLPNEGK
SVTISNLAVSLAQMEKKVLLMDADLRRPKQHRIFNLKNHDGLSNYLTMGLELNKLIKTTLVPSLYFINSGPVPPNPAELL
GSDRMKALLDRLKAAFDFILIDTPPILSVTDAQVLGKMVDGLVLVVQADRTPREALKQTREVIDLLQLKTYGVVINALNL
DNRGYYRRQYYRHYYQK
>gnl|bykdb|A0A497E0A2 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=758 residues).
MKKEKKEIDLLEIWRIALKRKWLIISIIIVFVIGAGIYSLTRTPIYQASATILIEEPGSSMLNLEEMFNYTPYYRYDFLG
VYFNTQLRLLTSRSLAERVARRMNLADRLELQAQPNSTRGGFLSRLRSVFSLSYWVSKGKRNTQSDSTEFIPPTDINTNY
AYVVLSGLRIQPVEETRLVEVSYRSPFPVLAADIVNNLIEEFINYSVEMRYEATRQASEFLNKQIAQLRDELAAKEKELQ
KYGEEKKLLFLNEKESSVVSKFAELNSAFTEAQIERIKKEAAYRELASLKVDALPPYISNPVIQNLKAEYTRLKNEYDEK
IKIFKPEYPDMVRLKARLDSVRQELEREISQAVDAARSEYRAALARENSLKKLLEKQREDVVKMNNNAILYNSLKIEVEN
KRNLLNSLIAKQNEALVSARLKGLRTSNIKIVDRALVPQSPIYPTPVRNVMLAFLLSLFVGVGLAFFLEFLDNTIKSPED
VEHLVDLPSLGLIPLISATNGAKKNYYTHQYSYGEREGEELEEDALIKNIELINYYYPNIAVAEDYRTIRTSILFSSLEE
TSQAIAFTSAFPQEGKSTTAVNTAVAFAQMDRRIVLLDADLRKPRLHKIFENSNRLGLSSYLAGKAPLESIIQSTKVSGM
DLIPCGLHPPNPAELLESRRFQQLIRLLKEEYDFVFVDSPPVLAVVDASVVSARVDGVVIVIKANKTTKKALYQSVETLR
KAKAHILGVVFNEVRISRDGYYSPDYHGYLKGYYSSTK
>gnl|bykdb|A0A523QJ88 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=716 residues).
AVLMLSVGIITFNIVPKYKAMTTLLIKEEGSRMLSIEDEFGYQRRVVNLRFYNTQLKLLKSKSLVERVVRKMNLPARPEF
SADQKPKKSLTTTVKNLISLRWIVPAKKAEVGDSMYSIPSSPYAEIANVLQDGIEVSSIRNTNLVEVSYKSPYPVLCSDI
VNTLAEEFISFSVEKRYETTQQASDFLSEQIANLRGDLAAKEKELQRYGKRKKLFFLSDTESATMSKFADLTEAYTQSQI
ERIKAEASYRELKELEVDSLPQFVSNMMIQNLKTEYTRMRNEYKEKGEIYKSDYPVMVTLRAKLDSMRNELENEIAKAVD
EAERTYSSSLKEETSLKNLLEAHKADVIRMNSNAIFYNSLKIEVDNKRRLLNSLVERQNETLVSARLGGLKTSNTSIIDK
AEVPKSPVSPNKKLNLILALFVGIFGGVGLCFFLEFLDNTVKGPEEVERLTGLPSLGVIPYLSPDGMKKKNRYSYYSKYK
YSYSEKKENSRREEALPDIKEIELVNHLHPKFFISEDYRTVRTSILLSHAESPPKTIAFSSALPQEGKTVTAINTAVAFS
QLKEKVLLVDSDLRKPRLHRIFKVKNAGGLSGYLTGKVSIEDAIQKTNVKNVWLIPSGPIPPNPAELVNSGKMKELMEEA
KKKFDIVLFDTPPVLAVVDAVIVSSFTDSTVFIIHAGKTEQKPFLQAVEEMKKAKAKIIGVLFNEVKIKRDGYYSP
>gnl|bykdb|A0A523ZSG1 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=761 residues).
MEQGRYEKDEVDLLEYWRIIVKRKWVLIAFTGALVLFTGIFSFLATPKYESTATLLIEGERSRILSIEDEFGYSRSYEDL
RSFNTSLKLLKSKSLAERVARKMNLLNRPEFGWGQTQKKGLLTTAKEAISLKWIFPRKGAKTGESEPMIRSDPYSEIADT
VRDAIDVSAVRTTKLVEISYTSSSPVLAANIVNTLAEEFIDFSIGKRYETTQQASDFLSEQIANLREDLSLKEKELQRYG
QEKEIFFLTETESTVVNKFADLNGAHTQAQIGRIRREAEYRELKSLDVGSLPQFVNNPLIQTLKTEYTRMKNEYEEKSEI
FKSGYPEMMKLKAKLDSMRVELKSEIEKAVDHAESEYRSSLKEESSLKVLLEEQRADVVRMNSNAILYNSLKIEVENKRK
LLNSLVERQNETLVSARLGGLRMSNISIIDRGDIPKSPVSPKKKRNLILAFLIGILGGGGLCFLLEYLDNTVKGPEEVER
LTGLPSLGVIPHLSPERIRKKKRYGLYSKYMYSDGKKNPDDGNNLSDIKEIEFVNESHPKLSVSEDYRTVRTSILLSQAG
TPPKTIVFSSSVPQEGKTATVTNMAISFSQLDKKVLIIDADMRKPRLHRLFKIKNVGGLSGYLTGRVSIKNALKKTSHKN
IWIITSGPIPPNPAELLNSERMEELLKDAKEKYDVVLLDTPPILAVVDALIVSSLSESMVFIIRAGKTARVPFLRAVEEL
KQAKTKIVGVVFNEVKIKEREYYSPYQHYYRQSYYGEEDEH
>gnl|bykdb|A0A523ZV46 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=762 residues).
MEYEPMEKEREIDLLEYWKTIVKRKWVIVVFAAALMLSVGIITFNIVPKYKAMTTLLIKEEGSRMLSIEDEFGYQRRVVN
LRFYNTQLKLLKSKSLVERVVRKMNLPARPEFSADQKPKKSLTTTVKNLISLRWIVPEKKPEIGDSMYSIPSSPYAEIAN
VLQDGIEVSSIRNTNLVEVSYKSPYPVLCSDIVNTLAEEFISFSVEKRYETTQQASDFLSEQIANLRGDLAAKEKELQRY
GKRKKLFFLSDTESATMSKFADLTEAYTQSQIERIKAEASYRELKELEVDSLPQFVSNMMIQNLKTEYTRMRNEYKEKGE
IYKSDYPVMVTLRAKLDSMRNELENEIAKAVDEAERTYSSSLKEEISLKNLLEAHKADVIRMNSNAIFYNSLKIEVDNKR
RLLNSLVERQNETLVSARLGGLKTSNTSIIDKAEVPKFPVSPNKKLNLILALFVGIFGGVGLCFVLEYLDNSVKGPEEVE
RLTGLPSLGVIPYLSPDGMKKKNRYSYYSKYKYSYSEKKENSRREEALPDIKEIELVNHLHPKFFISEDYRTVRTSILLS
HAESPPKTIAFSSALPQEGKTVTAINTAVAFSQLKEKVLLVDSDLRKPRLHRIFKVKNAGGLSGYLTGKVSIEDAIQKTN
VKNVWLIPSGPIPPNPAELVNSGKMKELMEEAKKKFDVVLFDTPPILAVVDAVIVSSFTDSTVFIIHAGKTEQKPFLQAV
EEMKKAKAKIIGVLFNEVKIKRDGYYSSYYRYHYYGEEERTE
>gnl|bykdb|A0A524I5M4 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=753 residues).
MKGFASKTDKKEIDVLEYVRIVLKRKWVLATFAAVLVALAAVLSFTTTPLYRATATLLIDEPGASLLNIQDVLNAGAFYR
SDYMGTYFNTQLRLLASRSLAERVAKKINLGARPEFRGARAEEPTPASSSYAFSILGGLSIAPIEETRLVYVSYVSPHAA
LAADVVNALVEEFVSFSVETRYEATKQTSEFLSEQVALLREDLKRKEEDLQKYGQEKNLLYLSGDESSIVNKFSEVNTAL
TTAQIERYAKESVYRELKNISVDALPESVSNPTIQALKTTYSQVKSDYEEKGQIYRPDYPEMVQLKARLDATKNTLQGEI
RKAVDSAEAEYRAALKKETSLQGLLDEQRGDVTRMNKNAIFYHTLRTEVENMRTLLSTLVAKQNEIQVSSQLGGLRTSNI
KVVDRALVPGGPFSPNVRRNLLTALLLGLFGGLGLIFVVEYLDNTVKGPEDVEKLVGLPSLGIIPFLTADGQKKRSDPYG
SYRSYGAESDKPGEKIPEVREIELINHLYPKFSISEDYRTVRTSILFSHADSAPKTISFTSTLPQEGKTATISNLAVSFA
QLEGKVLLIDADLRKPRLHKVFNLRNINGLSSYLAGKNSFEEVVQMTSIDNVWTIPSGPHPPNPAELLNSKRMKELLAMA
KDRFNIVLLDTPPVLAVIDPVIISSLVDSTVFVVRAGKTTRRPLVRAIEEIRKSKADIIGVVFNEVKIGHQGIGTPFYHY
YQYEYEATEGAGPAEKKRGPAGEAEKARAGTKT
>gnl|bykdb|A0A7C0ZGV5 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=748 residues).
MRMADEEYEINLLDYWRVIVKRKWVVISFVGALVFFTGVFSFKATPKYKAKATLMIEEEASKILSIEDEFGYRQRFADLR
FFNTQLKLLQSKSLVERVARKMDLLSHPLFIKAAGNNNNDQDEKKKIPHNPYSKVSQALLDSLEVSPVRETKLVEVSFTS
PDPVFAADLVNTLTEEFVDFYIEKRYQTTRQASEFLARQIEDLKNRLATKEQELQKYSQEKDLFFLNEQESTALSQFSDL
NNAFTQAQIERVRAEANYRELSNLKVDTLPQFLNNKVLEDLRTEYIRLKNEYDEKSKVFKPEYPDMLKLKAKMESMRIQL
EEEIGKAVKAAELEYRAALKKEESLKELLDQQKNAVAQMNSNAIIYNSLKIEVENMRKLLNSLEERQKETLVSTRLGELK
TSNISIIDRAEPPTSPVSPKKKLNLLLALIIGLFGGVGLCFVLEYLDNTVKGPDDAEKLTGIASLGIVPFLPPGGLRKLS
RKGYYYRYHYQSGEGEKGQKKPGEEASEVPDVNEIELINFKYSNVPISEDYRTIRTSILLSSAGGPPRSILVTSSVPQEG
KTATVVNLAIAFAQLGQKILVVDADMRKPRLHRIFKLGSSVGLSSCLTGKAKIEECILKTDIDGLSVLPCGPVPPNPTEL
IDSDKMKELVEKLTASYDLVLFDSPPVLAVVDPVILANLVEATILVVLSGKTTDKALVGATEELKKARAKLIGAVFNGVK
MDKQGYYYYSRSYRPYYHSGSEGKEERE
>gnl|bykdb|A0A7C0ZJ01 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=760 residues).
MRDNKGKKEIDLFDIWRVALKRKWIIITIAILFIVGAGIYSFTRTPIYQATATILIEEPGSSMFNIEEMFNYTPYYRYDF
LGVYFNTQLSLLTSRTLAERVARRMNLSERMELNTQSSSSPASFLGQIKSFFSISRWFNRTKEVTQPALQEFVPPADLSA
NYAFVVLSGLKIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQIAQLRNELAAKEKE
LQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRELSSLQIEALSPNIDNPVIQSLKAEYTRLKNEYD
EKIKIFKPEYPDMVRLKARLDSLRTELEKEISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDV
ENKRNLLNSLIAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVAFILEYLDNTIKSP
EDVEQLVDLPSLGLIPLVSASNGVKKASYTHQYSYGQQEGETLEEEVINNIELINYYYPNISIAEDYRTIRTSILFSSLE
DKPMAIGFTSSLPEEGKSTTLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNTNRIGLSNYLAGKSSIDEIIHPTKITK
LDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDFVLVDSPPTLAVVDASVVSTRMDGVVVVIRANKTTKKSLLYAVETL
RKAKAPILGVVLNEVPFSHNGYYSPDYHGYLKGYYSSSKH
>gnl|bykdb|A0A7C5LCJ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=735 residues).
MNDNYSETQIMDTGEIDLRKYLDIIIRRRWTVISVTIIAVAITMIISLVMRPVYTARGTVMIEKEPNILSFEDIFQIETF
RDDYFQTQYKLLQSRTLAERTIDRLKLWEKEEFASRKSLTSDELKNPVFRRKLVDRFLDRLEVKPIRMTRLVEVTFKAHD
PVLAGDCVNALFDSFVDMNVEAKYEATEQATEFLSQQITELRKEISQKEQELQNYGQEKDIVILSDKETTILDKLSELNK
ALTEAQIDRVRKESYYNGIKDASPDFIPEALNNPLIQRLREDYLKLSREYVKMQEKFQPEYPEMQRLKAELDSARELLKN
ETQRLVMAAYSEYQSALNKEKSLQAMFEKQKEEAFRLNSNAILYNSLKIEIENKKNLLESLLKRQSETGVSARLRGLRTS
NIRIVDRADIPIRPSSPRKFRNFLLALFLGLLGGVGLALVVEYLDNSVKSVEDVERYSGLPTLGVVPAFSEDSVLSGYYY
AYRSGDEEGKKKKSEKKMEARAGHEPRSIELIAHFAPESAFAESYRSLRTALLLSGPQERLRVLMVTSPLPDEGKSATIS
NLAVSLAQMEKRVVLIDADLRKPKQHKIFNQKNHDGLTNYLAMGLEPERLIKTTLVPSLYFINSGPIPPNPAELLSSEKM
KALLEKLKGQFDFILVDTPPILSVTDAQIVGRMVDGLVLVVQAEKTPREALRQARDTIDLLKLKTFGVVVNSLNLDSRGY
YYRHYYRHYQKEYRG
>gnl|bykdb|A0A7C6EJS8 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=857 residues).
MNNYQMMEPTGEKEVHLLDYWNVIWRRRWTVATFALIVVLATGLFTFTRRPVYTAKGTLLVEKEPTILTFEEIFQIETFR
DDYYQTQYKLLQSRGLAERVVDQLKLYEHPEFVGDPAKRKKPIDKNDLRLRKSLVDSFLGRLKVNPVRMTRLVEVNFRAN
DPKLAAAAVNELFDSFIDMNVESRFEATEQATQFLTEQIASLQTEIAEKERQLQAYGQEKNIVALSDTETTIIDKLGEIN
KALTAAQIDRVQKEAYYNEVKNLSPDFIPEAFTNPLIQKLREDYVRLSREYQKKMETFRPEYPEMQRLKAELESARKLLE
NETQNMIKAAYSEYQAALKKEKSLEAVFNKQKEEAFNLNSNAIIYNALKTEIENKKNLLDSLIKRQSEMGVAARQRGLRT
ANVRVVDKADVPLRPSSPKKRQNLILALIIGLMGGVGLAFLYEYLDNTVKTAEDVERYGKAPALGIVPTFSVDGFRRGYG
YGYYSYAYGYGQKRRKRKEEKEREKEGAKESEKEREREKQKEKEKERGGVTLAEKTEGEEGEGVGGLTEKASLGGDKKII
YKPGEGLITVSSRPSEPRGREEAQRKMAEGKKAAVSTGEGAGEEAAGAERAEPGEVISEEEKKLKEVKAIELIPHFAPKS
SFAESYRTIRTALLLSSPQEKLRSIVISSPLPAEGKTATVANLAVTLAQANRRVLLVDADLRKPRLHRIFRVKNVNGLTN
FLVSDVEYRDLIKATDIPNLYVINAGPVPPNPAELLGSEKMSRLVDFAKQYFHHLLFDSPPVLVVADAMVLGPLVDGMVL
VVWGEKTTREALQRAREKLDLMKIKLMGVIINNLDIRRHHYYYKHYYYDYYYRRYSP
© 1998-2021Legal notice