BYKdb

Dataset for cluster orphancd of phylum candidatus-fermentibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A163UNQ6      ------------------------------------------------------------
A0A496UDX9      MVEGCCRLQLQASRYGECDSVNEQNMSAVHPDTYPGTPDHSEEESLDLNFYLWMFLRGKW
A0A496UIN1      --------------------MNDGNF-------------QEERESINISEYLWLLYHNKW
                                                                            

A0A163UNQ6      ------------------------------------------------------------
A0A496UDX9      VILAFVLAGLLVAGYVNKTTTPVYRSSSTFMYTTDNSMSRTLDMPGTFWFQMDALRNDQI
A0A496UIN1      IVLGFLIISITASIWMTSRIRPLFRSSATFIFDVSSNMTQTLNMSNVFWFEMDPMRNNQI
                                                                            

A0A163UNQ6      ------------------------------------------------------------
A0A496UDX9      HLINSRIMAELVADSILHSSDSDSIISVLFLGDIPERPYIRNALVSLAQSTVSVSWIKDT
A0A496UIN1      QIIRSRSMAESVADSILRSPNSDSLLTILFCDLTVPQNNLRGSLIGMVRGSISVSIMKDT
                                                                            

A0A163UNQ6      ------------------------------------------------------------
A0A496UDX9      NFFVLSGSGYSPEASAVITNLFLFVYDKWNKQQARGENTEVRLFLEEQLQHTSQQLDLSE
A0A496UIN1      DFFVLSAIGYSPVAAATMANLMVGTYFRRNLTDARGENTLVKEFLSEQLDIMEIELAESE
                                                                            

A0A163UNQ6      ------------------------------------------------------------
A0A496UDX9      SALLQFKEEHGITDIDTETRDLITTLSSFETQARTAATNAAAARVRRDYLNGLLGEQRET
A0A496UIN1      DSLTLFKEEYGILSLSTETAQIVRNLSIFETAAATSRTEQGALQAQKTYYSDQLEVGRIN
                                                                            

A0A163UNQ6      MAGEIASINDSYIDTLQEELALLEASRATLLARGAQPDDPALTELEEEISIRTEALSSSL
A0A496UDX9      VTGDIVSSNSEYIDQIQSDLARYESARAALLADGAGNESEPVRAMEQRIDTRTQELAEAL
A0A496UIN1      LPEDIANLNTAFIAQLENDIATLESSRASLMSRGGTEDDNVIMDLDTQISVRREALTRAL
                :. :*.. *  :*  ::.::*  *::**:*:: *.  :.  :  ::  *. * : *: :*

A0A163UNQ6      EGLVRARYPENPSAAVQSLVGEIIRVEADLRAETTRESVLRAQASSLESDLSRLPAAEMN
A0A496UDX9      QDVAGMNYPANPQRGIEGLVSSIAEAESEYRSSTAREQALRAVVNDLSAGMTELPEFQYE
A0A496UIN1      EEAAYSRYPNDPAQSLQGIVSQLVTVESQLRAERIRESVLRSIVLDLEDSISVLPELELR
                :  .  .** :*  .::.:*..:  .*:: *:.  **..**: . .*. .:: **  :  

A0A163UNQ6      LARLQRNRLVSENVYLLLRNKYEEIRIAEAGQIGNVTIIDTALPGNMIRPSRRKNLMMGL
A0A496UDX9      LVSLERNRRVNENIYILLRTRYEEVKIAEIGQMGNVTIVDSALPGGMIKPTTRRNLIMGI
A0A496UIN1      LTRLERNWRVSENIYLMLRTKYEEVRIAEAGQIGNVTIVDTALPGGMIKPNKKRNLILGI
                *. *:**. *.**:*::**..***:.*** **:*****:*:****.**.*. ..**::*:

A0A163UNQ6      LVGLALGLGTVFLKQQLDTSISSPEQVEALGVSILGVIPHLPKSALASRASRTVPSSTLV
A0A496UDX9      MVGLAAGIGIVFLFHQMDTSLRNPEQLERLDIPLVGVIPE---SSQKTGGDRI----PLM
A0A496UIN1      FAGLAAGIGFIFLKEQLDTSVKNPEDIENLGIPVIGVVPKVPRSDVTIPGGKQ----GLI
                :.*** *:* :**  *:***: .**::* *.:.::**:*    *     ...      *:

A0A163UNQ6      THFAPRDPISEAYRDLRTSLKFARADQPLESILITSAGPREGKSTTSANLAVAFAQSGRR
A0A496UDX9      LLERSKSPNAEAIRDLRTSLSFSRPEQGIKSLLVTSSGPREGKSSVSANLAVAEAEAGKK
A0A496UIN1      MITAPRQAASEAYRDLRTSLRFSAIEEGIHSILVTSAGPGEGKSTTAGNLAVAIAQAGSR
                    .... :** ******* *:  :: : *:*:**:** ****:.:.***** *::* .

A0A163UNQ6      CILVDADLRRPVIHNIFGLDREPGLSEAAAGVTPLAECVRKTSIDNLSILPSGFIPHNPS
A0A496UDX9      VILVDCDLRRPTVNKTFGFKRKPGFTELISGKATIDEVVKKTEVEGLFVICSGHIPHNPA
A0A496UIN1      VLIVDTDLRRPILHKVFGLKQEPGFTETITGMKTLEEAVNSTSIENLSILTSGHIPHNPS
                 ::** ***** ::: **:..:**::*  :*  .: * *..*.::.* :: **.*****:

A0A163UNQ6      ELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTDALLLSPEVDGTLLVVGAKLGNRRVLQ
A0A496UDX9      EMVETAVKKGVFSQIAEACDMLIIDTPPAAVVTDAVVIAPAVDSVILVVRSGKIQKKVVQ
A0A496UIN1      ELLGSRKFKRLHALLKESYDMVIFDSPPIAVVTDPVVMSPEVDATLMVVGVKKIDRRVLK
                *:: :   * : : :    **:*:*:** *****.::::* **..::**     :..*::

A0A163UNQ6      TSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYTYRYYYPYYNPEGQGRGKGRRTR
A0A496UDX9      GVWQKLLRSGGHLSGAVINGFDPIRTYTSYTYYTYKYQYYYEEQSE----------
A0A496UIN1      SAWEKLRRGSGHCVGAVLNGFDPLNTYTSYNYYTYKYHYYYHDKKK----------
                   ..* * ...  ***:*****:. **** ****.* * * : .           

© 1998-2020Legal notice