BYKdb

Dataset for cluster tadcd of phylum candidatus-saccharibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A563BE10      MDEINLGEMFAYFKAKLHILLIIFALIFGLGSFYVFFMQKPKYEATATVIVSSDKSNANL
A0A563C7E0      MEEINLRDLLSYFKKHLILFIVVVLFVVSAGTIYSVFILKPEYKSQATVILSSDKSKNTV
                *:**** ::::*** :* :::::. ::.. *::* .*: **:*:: ****:*****: .:

A0A563BE10      PGEVATNKNLIDTYTQVVKSHRVLDKVKNDINIEKSYDEMLKMIEVSAIKGTEIINITTT
A0A563C7E0      QSEINANKNLIDTYTEVVKSHRVLDRVKSEMQIEDTYEQLVKKVTVASLKDTEIISISVV
                 .*: :*********:*********.**.:::**.:*::::* : *:::*.****.*:..

A0A563BE10      DRDAEFATKMTNKIADHFVKEIAKIYNDRNINVLDSAVTPTEPANIKVVRQEIIAFAAGL
A0A563C7E0      DLNKNHSYSLANKIADTFTDEIGQIYNDKSVNVLDRAVEPQKPYNVDIVKQEAIYAAAGI
                * : :.: .::***** *..**.:****..:**** ** * :* *:.:*.** *  ***:

A0A563BE10      IVSVSILFLVFYFDRSVKTSEQVESQLHLPVIGKIHMIDAEKERLKRRQR----------
A0A563C7E0      VLATAVIFLMFYFDRTIKTTEQIEQLFKLPIYGKVRKLETEKQKQQRKKRAEKAAKLEAK
                :::.:::**:*****::**:**:*. ::**: **:. :::**:. :*.:*          

A0A563BE10      -------------------ALALKAKKEAKDDGSTENAENGEEASEEISEE---------
A0A563C7E0      QAAKLEKEQQKEAKKAEKLAAKLEKQEKTSNEELGVDYQDGEEAGAEETQSAQKSEAEVK
                                   *  *: ::::.::    : ::****. * ::.         

A0A563BE10      ------------------------------------------DLSSELILKNNPKSIISE
A0A563C7E0      PVVEIKAVGRKIIAEEKALQEKLAAEVDEDEAEVEEFNEEMLDEDSELVLRDNPKSKVSE
                                                          * .***:*.:**** :**

A0A563BE10      DFRTVRTSLDFSLVGKNNNSLVLTSTAPNEGKSFVSANLAIAFANTGKKVLLVDADMRLG
A0A563C7E0      DFRTIRTSLYFSLNKKGSNAVLISSSTPNEGKSFIASNLAVAFAKTKKKVLLIDCDMRLG
                ****:**** ***  *..*:::::*::*******:::***:***:* *****:*.*****

A0A563BE10      RQHEIFELSNQAGLSNLLVETAGDRLRKYVQKTDIENLSVVTRGVTPPNPAELIDSKQME
A0A563C7E0      RQHEIFGLSNKEGLSNLLAESKSGEYRKYLQKTTVKNLSIITRGVVPPNPSELLDSSIME
                ****** ***: ******.*: ..  ***:*** ::***::****.****:**:**. **

A0A563BE10      KFIATVKSKYDYVIIDSAPVYNLADSLIISKKADRTMIVCRVNKTNIDHVKDGLKSLQAI
A0A563C7E0      ELLEKVKQKFDYVILDGTPIDGLSDSLILAKKTDRLVLVSAANMTTIEDLQNSKKALESI
                ::: .**.*:****:*.:*: .*:****::**:** ::*. .* *.*: :::. *:*::*

A0A563BE10      DANVAGVILNQIPLEKRTGYYNQYYL
A0A563C7E0      EVKISGVVLNRTIDERRGDKYNKYYN
                :.:::**:**.   *.* . **:** 

© 1998-2020Legal notice