BYKdb

Dataset for cluster tadcd of phylum candidatus-hydrothermae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A496U6A5      -----MEEELKFEDIINVLRSRKKIIIMSIIFVTLLSIIYSFLKSPVYEAKARVRLPGSS
A0A660ZFU7      MNSEEKGREVSLYDYINLIYRHRVLIIVVFVITTLGAWIFSLLSPPVYKASSVVKLALKE
A0A660ZJ93      MADPTREEEISLMDIMGVLFRYRYVIIGLTIGIAALAWLYSALTRPVYEAKSLVRLSISA
                        *:.: * :.::   . :**   :  :  : ::* *. ***:*.: *.*. . 

A0A496U6A5      QVTEFF--LAGMTNPWNDVPTQLEIIKSINVAKRVINKLGLRFRVLDKKMPPGLTIDSVY
A0A660ZFU7      TRLNVIPEISPALRTVDPVQSQIEIIKSRALLENLVMKHGLNISFLTP--VDAFEFDTLW
A0A660ZJ93      PPITTLGPEMGYGTTIDPVQSQIEIIKSRTLAERVVKRMGLNIVF-----PKGIIVDTAW
                     :        . : * :*:*****  : :.:: . **.: .       .: .*: :

A0A496U6A5      VKEDMPSGDFILEVYRNYYLVKNLPEGKIYIKGPIKTYHEEKGLGLKVLLDKKQKIT---
A0A660ZFU7      TTRKAKEGIYTVKFKGE-YFQVFAPDGSVIGNGRLGEPFNGGVLGFLIRAKRKD------
A0A660ZJ93      STDLVKTGIYYLKLKQDSSFEVFDKDDNYLGPGKLGKIFRSQRAGFGFSVRCKDGECEKF
                 .     * : ::.  :  :     :..    * :   .     *: .    *:      

A0A496U6A5      ----FPLKVRFEILDYHTLIKSLSSRMKVSQEARSFIAVIRTRARSPELAKKLADTYANA
A0A660ZFU7      ----YPLVIKFIVTAPDRVALSLKGIFKVTQKGQTDLAVISAQGSSPDFVKKMADALADE
A0A660ZJ93      IGRRIPFRVKSIISTAE----GFRGKIKASQKGQTDLAVIKVRAYSPQKAAQLANAVAEE
                     *: :.  :        .: . :*.:*:..: :*** ... **: . ::*:: *: 

A0A496U6A5      YVEYTLDDVRYSARVLREFLQQQVNKIETQLKIQEDSLKLVKEKFGVFAALALENSQEST
A0A660ZFU7      YVAFTLYGMQEEAKALRSFLEEQLNKVEKELKLAEDSLRAFKEKAGIFLL------DESA
A0A660ZJ93      YVNFVIYDLQQEARSVRNFIESQLEKVERRLREAEDSLKAFKEKTGIFIL------DESA
                ** :.: .:. .*. :*.*::.*::*:*  *.  ****. .*** *:*        :**:

A0A496U6A5      KELLRTLTTLEMEKSQSIAEREEAKKKIEILKNQIEGKGF-LAKYRELAELPGLSNNPQV
A0A660ZFU7      RTLIERLSALQSELAKAETEKQEAEHKLASLRAQLGEKTATFEKYKQTASSPEVSSNPLV
A0A660ZJ93      KSLISRLSELQAELTKAQTDRVGAFERLKKLRQQLKQRGE--EQYQALASTPEISGNPIV
                . *:  *: *: * ::: ::.  *  .:  *. *:  .     :*.  *. * :*.** *

A0A496U6A5      QELQNKIITLEIKKAELMEKYTEKHPEIQAIENQIEATRKNLQSILKSLAFSGPSAGDPL
A0A660ZFU7      RSLKEKLTSLEIQKAMLLEKYTELHPEVVAVNREIAKTKEELNRAVANALKSGPSAGDPI
A0A660ZJ93      QSLRDKLTQLEIRKAKLLEEYTEAHPDVQALEREIQKTREELNKAIENMLKSGLPTGDPI
                ..*.:*:  ***.** *:*:*** **:: *::.:*  *.::*:  : .   ** .:***:

A0A496U6A5      FQKLATDFITNEALALALEAKVSALDKVIRAYEKKISFLPTQELTYARLKRKIEATKTVY
A0A660ZFU7      FQNLIAGIIESETKIQSTEGRINALKQLIKKYEAQMKLLPQKEVQLAELTRNVEANRAVY
A0A660ZJ93      IRRIMQDIVENEATINALDGKIQALQTVINIYEGKLQSLPEAEVKLAELTREVEANRATY
                :..:  .:: .*:   : :..:.**. :*. ** ::. **  *:  * *.*::**..:.*

A0A496U6A5      NMLLQKLEETRIQEASQISDARVLDYALLPKSPISPKKKLNIVLGLILGTMLGIFGAFIA
A0A660ZFU7      SMLINKLEETKIAEAQKSTDAKVIEYATRPIAPIKPRKKMNVLLGAILGLVLGVGGAFVL
A0A660ZJ93      EMLISKLQDVKITEARTVSDAKVIDPAVLPKKPIKPKTKLNIILGFILGLMLGVGGAFVL
                .**:.**::..* **   :**.*:: *  *  **.*..*:*::** *** :**: ***: 

A0A496U6A5      EYLDNTVKSAKEVEEITFKPVLSIIPLIQLE--NDNNSTSRIEKTFITHFDPLNPISEAF
A0A660ZFU7      EYVDVNVKTPEEVEELLGVQVLGNIPYI-----KSAEDAEP-RVRLITNLDPKSVTVEAY
A0A660ZJ93      EYLDTSVKVPEEVETALNIPVLGTIPMVMRGKPKSKDEAQLIKERLITHFHPSHPVSEAF
                **:* .** .:***      **. ** :     :. :.:.     :**:: *     **:

A0A496U6A5      KKLQINIRFLDPERKLRIFSITSSIKGEGKSTVACNIAIAFANAGEKVLLIDGDIRRATL
A0A660ZFU7      RSLKVNLKFASTGEPIRTFMVSSAKAEEGKTLTAVNLAITSVQAGERVILVDADMRNPSV
A0A660ZJ93      KTLRTNLRFSSISNPANSIVITSAVAREGKSTVTANLGITLAQLGHKTLLVDADLRKPIL
                ..*. *:.* .     . : ::*:   ***: .: *:.*: .: * ..:*:*.*:*.. :

A0A496U6A5      HDIFNVPREPGFSDLLVGHQA-----KAFETQIKNLYLLPAGTRILPSLDLFNPVNVDKL
A0A660ZFU7      HRFLEMTKSPGFTDVLKGEETLDDAIKH-PEFLRDLAVLTCGSDVVNTLEVINSESFGRL
A0A660ZJ93      HRLFGFNRIPGLTDVLIGNTQLESVIKDLHRVIPNLALITCGQIPPNPSELLGSPQMEEF
                * :: . . **::*:* *        *     : :* ::..*     . :::.. ..  :

A0A496U6A5      KERINHHYNVVIVDTPPILPVAEALSISSLSDATILVVRSEYTDKNILQDVAQQLKRSNV
A0A660ZFU7      LNELVNRYDTVIFDSAPILLVSDTLAMADRVKNLLLVVRAGYTERPALVAALRALKRANV
A0A660ZJ93      IKYVKTQFDYVLFDTPPIMPATDATELGARVDGIILVVRAGNTERAILEHAKKLLERANV
                 : :  .:: *:.*:.**: .:::  :.   .  :****:  *:.  *  . . *:*:**

A0A496U6A5      NFLGTVLNAFNFE-NYGYYARRYYYEYYGRSGVAKRTIFNKIINQIKK---------LKK
A0A660ZFU7      NLVGAVVNAIHLQKHYGYYYPYK------YYGYEER-------EKRKGKKSRSWWRYFTK
A0A660ZJ93      NIIGAVLNAVDIERQF-YYYKYRYKHYYYYYSYTHKDKFKEFEERRKSKLSRFFGRIFRR
                *::*:*:**. :: :: **            .   .       :. *          : .

A0A496U6A5      NGA
A0A660ZFU7      RG-
A0A660ZJ93      RAA
                .. 

© 1998-2020Legal notice