BYKdb

Dataset for cluster tadcd of phylum candidatus-aerophobetes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A532VCB9 [Bacteria] Bacterial tyrosine kinase [Candidatus Aerophobetes][Candidatus Aerophobetes bacterium Ae_b3b] (length=545 residues).
MYREEESVELRQYWEVLWRHKWIVLLAVVVVFVGTMIFTYRQAPVYRASSKILINPPPSLYPYTAPGQILTSQGLPYSRD
LPYYINYLENYRVWLTSETMMDKIIERVKSLYPESEEIPFSMGASVIRDTSIFAIGIESGDPELCKVAANATAQVLVEEN
QRMFAAGLKTASEMMKKQIQTPLEELSKLLPGSELPGKGVGTTKGEKPESQLWQAAQLNNVRIMDYAKTPRSPIKPRKKL
NAMLGLLVGFMLGGGLAFLLTYLDTSVRTIEDVEKYFSWPVLGIIPRFDRTNDEPSGKTSPSEIEPVVSKYPKSVSAEAY
RTLRTNIQLSNLDHPPRFLVITSAGPLEGKSTTALNLALALAQRESKVLLVDGDLRKSTIHKALHLDNSTGLADSILNHG
SLEAAIKRLDSVANLSVLTSGSAPSNPSELLGSSGMRSLVEQVKKEYDYVVFDTPPLMSVSDGAVLASQADGILIVISPG
KLRREIARHTKELLDRIGTPVLGCVLNGVEPSHSNYYYYYHYYHSYADSEGKETIRERKKKKKNL
© 1998-2020Legal notice