BYKdb

Dataset for cluster tadcd of phylum candidatus-eisenbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A538SBK7      MAVRAEALPSPPPDLRETWRVLMRRKVLMLVPWSAAVLGGATLAFLLKPIYFSGVTLLLE
A0A1F5RFI7      ---MDAREGATPTDLREIARVLWRRKTLLLVPWVAAVAAGVAAAFMLQPIYFSTTRLILE
A0A538UAA9      ---MAEAPEGTPIDLREIARILWRRRILLIVPWAVAVAGGLAGAFLLPPVFEGSVTLVLE
                         ..* ****  *:* **. *::*** .** .* : **:* *:: . . *:**

A0A538SBK7      RPQALSGALGGMVSAIGPEQQAEVMREQVQSSLFLRSVITASGVKSDPATRAWALRHADK
A0A1F5RFI7      RAQSLPGALGGMVPGDVAAHQADVMREQVQSSLFLRSVITSTGARDDAATRAWALAKART
A0A538UAA9      RPQNLPGNLDDMVRTPAPEAQADLMREQVKSSLFLRSVFTATDLSDDAATKAWAQKSAGR
                *.* *.* *..**    .  **::*****:********:*::.  .*.**.***   *  

A0A538SBK7      VPGLSPDERVEAFLVDYLRDNINVRRGRGNVFQIIVGDYTAERARRLAEAVANEFVIASK
A0A1F5RFI7      IPGMRPDDMVEAFLVDFLRDAITVRRLRGDIFEVTIGDLAPMRAREFARAVADQFVISSK
A0A538UAA9      YPGISGDALTEAVLSDYLKDAIVIRRGKGNVFQVTVSDASPQRAFKLVQAVSDQFVASSK
                 **:  *  .**.* *:*.* * :** .*::*:: :.* :. **  :. **:::** :**

A0A538SBK7      AAQLEAVRATQEFSIEQQQVYKRKLDESEQRLEAFRRETISSSMTGSSVNEGNMARARTL
A0A1F5RFI7      AAQLEAVRATQEFSTEQQQVYKRKLEEVERRLEASRRALLTSTLAGSVVDGSNLARARTL
A0A538UAA9      AAQMEAVRQTQEFSQSQQQIYKDKLEQSEARLEAYRRSILASGLSGASVDATNVARARAL
                ***:**** ***** .***:** **:: * **** **  ::* ::*: *:  *:****:*

A0A538SBK7      LDQTGLDLDEQRQRVAQLHDQFG----GKVRENDPALLTSPQTNELTGQLVGLERQLATA
A0A1F5RFI7      LDQAGLEVQDGRRRAAALRSRIAERARGEGADPDL--LSSPEAANLAAELAALERQLAQA
A0A538UAA9      LEQTQFDADELHQRVSGLRQQLA----GQVSDADLRALATREVSNITGQMAALERQFASS
                *:*: :: :: ..*.: *...:.    *:  : *   *:: :. :::.::..****:* :

A0A538SBK7      MLLADPNSDNGAGARQGIARKVAELERQFTANAAMALPGASSEARDLMVRYRLAQADLQA
A0A1F5RFI7      -LLSATPGEDGSSVRVLLARATSDLEATLAANAARALPGLGPDARDALVRYRLGLADLDA
A0A538UAA9      -SLNDPTGSALGGLRLSIVRKHADLATELGLVAPKA---LAASVRDLLVEVRLAEADLSG
                  *  . ..  .. *  :.*  ::*   :   *. *    ....** :*  **. ***..

A0A538SBK7      KEARRNYLSGQVSAYQSRAVMSPDRDLDLQRLNQEVESNRSFYNSFLEQSSAAQIAEAFE
A0A1F5RFI7      RAARRGYLAAQVAAYERQVVSAPDRELEIQRLSQDAENARSLHNSFLQQSAAAQIAEAFE
A0A538UAA9      VEARRDWIAREVSTYDRRVVMGPEQDIELQRLTQEVESNRAYFNSFLQQSSAAQIAEAFE
                  ***.::: :*::*: ..* .*:.::::***.*:.*. *: .****:**:*********

A0A538SBK7      NAKVSGRFVVLEPANLPRSPGKPNRPMLVLLSLVMGGVIGVGLVLVVEQHDQSVKNADEV
A0A1F5RFI7      NAKISGRFSVLEPANLPLAPGKPNRMMLILLGLIGGAVIGVGAVLVVEQHDQSVRNADEV
A0A538UAA9      NAKLSGRFVVLEPARLPLAPARPNRPLLLLLAILVGGMIGVGTVMVVEHHDESVKNADEV
                ***:**** *****.** :*..*** :*:**.:: *.:**** *:***:**:**.*****

A0A538SBK7      ENLLGLPVLGAVPRVEEL-RRARRSRGAPGGGAGAP-PRDPGMLQRLKVESPLGLEFRRV
A0A1F5RFI7      ESLLGLPVLGAIPRLEELQRSGRRSRSA-GSGVGLPAPREHGLLHRLKVESPLGLEFRRV
A0A538UAA9      ESLLGLPVLGALPRVSELEVRRRRSSAAPGGGAAAADAREPGMLHRLKVESPLGLEFRRI
                *.*********:**:.**    *** .* *.*.. . .*: *:*:**************:

A0A538SBK7      YLKLARTRGRSLPGTLLVTSSTRGEGKTTTSACLGITFARELKGKVLLVDFDLRSPALHR
A0A1F5RFI7      YLKLAKTRGRSMPRTLLVTSATRGEGKTTTAACLAITLARELRERTLLVDFDLRSPALHR
A0A538UAA9      FLKLARTRGRQLPHTLVVTSATRGEGKTTTSACLGITMARELRQKVLLVDFDLRSPSLHR
                :****.****.:* **:***:*********:***.**:****. ..**********:***

A0A538SBK7      SLGLPGSSWGTAHILRQQKFDERLVRATVLPNLDFLGAGKSERPASELIDTEAVEWFIQE
A0A1F5RFI7      ALGLPSSSWGLAHILHQRHFDERYVRSTVLPQLDFLGAGRSEHPASELVDLPAVEWFLAE
A0A538UAA9      ALGLPRSSWGLAQVLAQRHFDERFVRATVLPHLEFLPAGKSDRPAAELIESDVVEWFVKE
                :**** **** *::* *.:**** **:****:*:** **.*:.**:**::  .****: *

A0A538SBK7      ARARYPLVLIDSAPNLAVPDPLILGRAVEGVVYVIKAGTTMRKAAEFGVKVQREARDNIL
A0A1F5RFI7      ASARYPLVVVDAAPNLAVPDPLIIGRAVESVIYVIKAGSTVRKAAEYGVRVQREARENVI
A0A538UAA9      AAARYPMVIIDAAPNLAVPDPLILGRAVEGVLYVVKAGSTIRKAAEHGVRVQREARDNVL
                * ****:*::*:***********:*****.*:**:***:*:*****.**.******:*::

A0A538SBK7      GVLMNDAGEVLPRYYGYHDA-YGDASEAAAGEA
A0A1F5RFI7      GVLINDLGEVLPQYYGYHSA-YGDPAEVAGNDG
A0A538UAA9      GVLINDSGEILPTYYGYREQYYGYADEAAGTDS
                ***:** **:** ****..  ** . *.*. :.

© 1998-2020Legal notice