BYKdb

Dataset for cluster tadcd of phylum candidatus-bathyarchaeota

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A537HEJ2 [Archaea] Bacterial tyrosine kinase [Candidatus Bathyarchaeota][Candidatus Bathyarchaeota archaeon] (length=806 residues).
MKTYLPNNNAQRPALPDSSEAEYVYYGPEQYGPEVEETKILDYWKILVRRRRLLIQIFVISLLLGAYFNFTATTVYKATA
MLKIEPLTPTVTGVGQIGTSSIPEGGGPYDYYQTQYKLLESRDLAARVIADLQLDKNKAFTTASVTSASAIPRVRSWILG
TLNSIISPVAGFFRARQDSWDGDTLADSKNHNAPSNRQQSNTNKPAVNPGWVGRYMSFLRLNPIKSTRLVEIAFVTPNPT
LSQMLADAHARGFIRMNLESRFQLTKEARDFLDGKNAELKQNLERSEGALNRFRQTHGVVSMEKGENIVVDRLVDFNRQL
TAARAQRIEAESLYKVVENKSTQSLSQVMTQGMVPVLRSNLLALEAEKVKLASIFKPDHPRMIELNQQISEMTRSVNTEI
KNVVRGIQESFFAARSKEEALQAEAQKQQQTALNLKEVGVQYAVLEEEVKVNRALYESVLKRLSETNVSNDIAVSNMQIM
QSAERPRFPDAPNIPINLTIYAALGLFLGVGMAFALEYIDSHLNTPEHVWRAVDLNTLGVVPDLDSLEHRPLISYAPASR
AKLLPTRMGQPQLEESGNRGKDLIVAHHPLSIYSEAYRTIRTALLLSQPGGNRKVILLTSPSPSEGKTATTLNLGIALAQ
DGYKILIIDADLRRGSCHSRVGLRNHRGLSNVLGGEMPIEQLIQPTSIAGLSLVTRGVCPPNPSELLGTRKMKELLTSLR
ESHDFILIDTPPAIAVSDAAILSSVADGIILVFHARKTTVHSARQVKERFDAVRGPILGVILNGINVEDPDYAYYRHYYG
SDYGTV
© 1998-2020Legal notice