BYKdb

Dataset for cluster orphancd of phylum candidatus-coatesbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A661UF67 [Bacteria] Bacterial tyrosine kinase [Candidatus Coatesbacteria][Candidatus Coatesbacteria bacterium] (length=335 residues).
MKEDKPQKSYMVCVNEISSDADVQAIIENLSKFCKGARLDEVEHAVQSPPFSFRRMNFDSAQAAKEELEKLGCAVDIREG
TGVSSAEEQLLFAQTSRKHKIRFAKGIDERQLIDSLDVFTSEDPAVEAYRALRTNLLVQMKQDNINSFLVTSPSPKEGKS
TTVANLGIALANAGKKTILVDMDLRHSVLHEFMGIDNSLGVTNIVLDSLDPDLAISHTVFERLHFLPSGPTPPNPAEILS
SSSVRELLAMLSNDFDVVLVDSPPIIGLTDAVVLGTIVGGVFLVIRAGRTSRQQMSLAVQMLQNVGCHILGAVLNEVDIH
KPYYKVYAYSRSSRA
© 1998-2020Legal notice