BYKdb

Dataset for cluster tadcd of phylum candidatus-saccharibacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A563BE10 [Bacteria] Bacterial tyrosine kinase [Candidatus Saccharibacteria][TM7 phylum sp. oral taxon 351] (length=486 residues).
MDEINLGEMFAYFKAKLHILLIIFALIFGLGSFYVFFMQKPKYEATATVIVSSDKSNANLPGEVATNKNLIDTYTQVVKS
HRVLDKVKNDINIEKSYDEMLKMIEVSAIKGTEIINITTTDRDAEFATKMTNKIADHFVKEIAKIYNDRNINVLDSAVTP
TEPANIKVVRQEIIAFAAGLIVSVSILFLVFYFDRSVKTSEQVESQLHLPVIGKIHMIDAEKERLKRRQRALALKAKKEA
KDDGSTENAENGEEASEEISEEDLSSELILKNNPKSIISEDFRTVRTSLDFSLVGKNNNSLVLTSTAPNEGKSFVSANLA
IAFANTGKKVLLVDADMRLGRQHEIFELSNQAGLSNLLVETAGDRLRKYVQKTDIENLSVVTRGVTPPNPAELIDSKQME
KFIATVKSKYDYVIIDSAPVYNLADSLIISKKADRTMIVCRVNKTNIDHVKDGLKSLQAIDANVAGVILNQIPLEKRTGY
YNQYYL
>gnl|bykdb|A0A563C7E0 [Bacteria] Bacterial tyrosine kinase [Candidatus Saccharibacteria][TM7 phylum sp. oral taxon 351] (length=566 residues).
MEEINLRDLLSYFKKHLILFIVVVLFVVSAGTIYSVFILKPEYKSQATVILSSDKSKNTVQSEINANKNLIDTYTEVVKS
HRVLDRVKSEMQIEDTYEQLVKKVTVASLKDTEIISISVVDLNKNHSYSLANKIADTFTDEIGQIYNDKSVNVLDRAVEP
QKPYNVDIVKQEAIYAAAGIVLATAVIFLMFYFDRTIKTTEQIEQLFKLPIYGKVRKLETEKQKQQRKKRAEKAAKLEAK
QAAKLEKEQQKEAKKAEKLAAKLEKQEKTSNEELGVDYQDGEEAGAEETQSAQKSEAEVKPVVEIKAVGRKIIAEEKALQ
EKLAAEVDEDEAEVEEFNEEMLDEDSELVLRDNPKSKVSEDFRTIRTSLYFSLNKKGSNAVLISSSTPNEGKSFIASNLA
VAFAKTKKKVLLIDCDMRLGRQHEIFGLSNKEGLSNLLAESKSGEYRKYLQKTTVKNLSIITRGVVPPNPSELLDSSIME
ELLEKVKQKFDYVILDGTPIDGLSDSLILAKKTDRLVLVSAANMTTIEDLQNSKKALESIEVKISGVVLNRTIDERRGDK
YNKYYN
© 1998-2020Legal notice