BYKdb

Dataset for cluster orphancd of phylum metagenomes

[Download (right click)] [Alignment] [Repertoires]

62 sequence(s)

>gnl|bykdb|A0A0F9BMP5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=197 residues).
AGQAIALTSACPREGKTMLTLSLAMALNAMKDQRAVILDCDLRRSRIAELLNLSQGVALDSILLGQTCPLDAVRVDERFG
LHVIPVVYRDAYSPDHLSRSAFAEIIRELKTRYDYVLVDTPPVLAVADTGLLASHCDQTYMVVRWRKTRHAQIRDVFERL
YDLDINVTGTILNFVNPKKEANYRGIPYASYNEYRHV
>gnl|bykdb|A0A0F9C030 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=504 residues).
QQHAFAMVDTIGREVLLRQLGLKTADPYASSRINQQLIDDRGKLQAKLLLYGSAHQEVRTLQQRISLAEHFLQNQRFQDA
EQARQIIQQELGPALFDMARQQCDEAVASERAISAAYEEEKQAAVSLYGTLAELQIIERDLEHLHAFHETLLDRVKDLNL
GQDKGIIRTSILTPPKTPGGPVWPNLSMIAMFSIAIGFGMGLGIVYIQDLLDDHFRSPEELRIQLGLPVLAMVGKLEPQT
NVGVDALHVHVQPNAVESEAFRTLRTALALAEGGSQRLVVSSSEPGDGKTTVISNLAVAYAQSGKRTLLIDADMRRPGLT
PMLDLKGQKGLSTILRAGLPVVQSAEANLCSSLLENLDVIPSGPRPINPTELLVGDRFSELLCWAESRYDQILVDSPPAL
VSDTAIIGRLVDGVLLTVQPHKNRRRTVIRAAESFSNLGINVLGIVINRLATEKSDDYYGYGYGYGYGYGSGYGYGHDDE
PQSDAGLSEGSTDDMPMEIVRRVA
>gnl|bykdb|A0A0F9CMN4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=217 residues).
DIDNPPKSLVITSAVPLEGKSTTALNLAVALAQKESKVLLIDADLRKPIIHKLLHLDNSTGLVDALLNGGHPGASVKQSK
NIDNLWVLTSGSVPSNPSELLGSSGMKALMEQVTKEYDYVVFDTPPLISVSDGAILASQADGILMVVSPGKVKGEIGRHT
KELLERIGTPVLGCVFNGVELSHRNYYYYYNYYRYYAGSAGEKKVGKREKKESNVLD
>gnl|bykdb|A0A0F9G9C6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=515 residues).
NTILDLQAAIGASEKGKDSGIINLSLQSEKPHYAEKVLDKVAGIYVRRNVERNSAEAQKSLEFLEVQLPEIKKQLEFAEQ
RFNDYQIQRQSINITLETQGVLEQVVKLETKLQELELKRLELGRKFKKDHPTYQGIIEQIAAVNEQKKALVGEVGNLPET
QQELLRLRRDVEVSNQIYTLLLSKTQELDIVRAGTVGNVRIIDYAEVNTSKPVKPKKALIVVMTTMLGGMLAVAIVLVQK
AMHKGVEDPNEIEAIGLPVYASVPYSDYQDKLTGFSKALKNKVSKPKSILALDNPADLSIEALRSLRTSLHFAMMEAKNN
LIAISGPSPGVGKSFVSVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGQLNLEQVIKPTAVDGLSVI
TRGQIPPNPSELLMHSNFSKLVAEVSAAYDIVIVDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNG
TDVKGVVFNGVIKKASNAYGYYGYYNYEYKSNEKS
>gnl|bykdb|A0A0F9HWF5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=592 residues).
IVITSFLKRFDVKPVRNTQIAVVSFNSKSPEMAARVANAAVQAYVDYTLTTKIKANVGASGVLRKNIQEQRKKIEESEKL
LFEYKEKFKIISLEEEKNITIQKLAAHSKNLVSAENVRIEAQSKYQVAVGMLVDGDLAGSIPEVMSNGFITKLKTDEAVL
REQLSEISRKYGSKHPKVIALNDKISTVRGMIDDEIFRVVDSMKSQYDVALRNELALKGELVRLKEESQSLGKHAVAYSV
LARDVYTNKEMYEVLLKRLKETSITGGMQTTNVRVLDEAIPPTIPFRPRRMLNILLAIVLGLFMGPVVAISFEYMDSSVK
TPEDIERYLRVPYLGPLPDFHGQESERAGGRSTMLVTSLDPKSVPAEAYRSIRTSIIFSSPDDKRTLLVTSSNPTEGKSV
TSSNLAVIMAQNGARTLLLDMDFRRPVLHKIFNVPQEKGFSNMLVGDAGVDDVITHTNVPNLDVIPSGHIPPNPAELLSS
DGIASFMDIFKSRYDRIVIDSPPILSATDPVIISTFVDEVLMVIKMGETSRELVQTAIGKLHHVKANLIGTVLNGVDTGQ
GNYYQYQYYGDRQPETEQGVFGRLRKPFLMRK
>gnl|bykdb|A0A0W8FVN7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrocarbon metagenome] (length=414 residues).
MNEQILVYKAGIFASNPAQIQQLTAKVLEEEVRYQSLLSSHKELDELVQRYEVRFNEMPKRTLDLARLQRIKEANEKLYL
LVEEKYQEAQINEQSTPGNVLIIDAARQPENPSKPNRILIIAVGLVLGLGFGFGFAFVRNYFDNTVKTPEELQQKNISLL
AWIPEMFVADKNRAPGSEFIVNKKSDSTASEAYRALRTRIRYSGVEGTIPKKLLVTSSSAGEGKTTTAVNLAGSFAQANQ
KVLLLDCDLRKPRVHKIFNDERYPGFIDYFFGQATFDELIRKTEQANLFYITGGTIPPNPAEILGSHKMEEFLAKLETHF
DLIVIDSPPIIAVTDSEILSQIVDGVMLVISAGVTEYDILYKSLDVLKMAKSQFLGAVLNKFAYRPGYGSYYKYYYYYYN
TGNGKEDKKKLLKV
>gnl|bykdb|A0A1J5SIM8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=279 residues).
MERIKQAILRAKNHQSSEANLAQLRPDGQGKSFKSNISKSQDELVDFRYENTRVVKLEKEHLEKNRIVAFDKSNPMSMNF
DLLRTHVLQKMEENGWRTLAITSPTPEAGKTVIAINLAMSIAQQTNRTAMLVDFDLRRPKVGAYLGMHMEKSLNDVLNGT
DQLPDVLVNPDVPRLVVLPTRNAVKNSSEILSSKKIGDLITDLRERYKSRIVIFDLPPLLVTDDAIALLPKIDCVLLVVA
NGMSTKREIEDSLRLLPAENLIGTILNKADVEPKAYYYD
>gnl|bykdb|A0A2H9T3X6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][invertebrate metagenome] (length=616 residues).
MIGRAVARRFSPDAEAGELINTPWLWFSGYGWGGEALKIERFEMHSSLLDQPYTLVAGENGHYQLWLDDRMILTGKVGEA
AQSKDQQLRLFVSLLQARPGTRFNVTDQLLVSTVNQLSQRLSVSEKGKKTGVLSLSLTGPSRPENSRLLEAIIQRYVRQN
IERVSAEAQNSLKFLERQLPEMKKDVELAESKLHRFQQENQTVDLTMETQAVLDQAVTIDTQLAKLDMQIEQMSQRYTAN
HPVMEELQLQRQLIVDRQDKFSDQARGLPKTQQEVMRLARDVQVSTEVYTELLNKAQELKIVKASAVGNVRILDHALSGI
TPVKPKKPLIFVLAVLLGGMCGTGFVFLRDMLRQGVKTPEEIEAKTGLSVFATIPQSEQNLLLERNARKQGGGFMLAQSA
PDDLAVESLRSLRTNLSFTMMEGKDNRVMITGPSPGIGKSFVSANLALLLAESGEKVLLIDGDMRKGRLNHYFGVKRGDG
LSNILAGTAGYDAVREINKKCYLMTTGLLPPNPSELLMSHGFTELLENVSPLYDIVLVDTPPILAVTDAAIIGRKCGRTF
MVTRAEKNTASEISYAAKRLQQAKVNVKGCILNGMVYTSSCYGQYGYYHYKYGSES
>gnl|bykdb|A0A2P2C6F5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=485 residues).
MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVLYSATSSGLVVVGNATTAGEEQGNAALAEEKAGLYAFLVSSMP
VAEKVVDDLDLDVPPSEIAGRFSATVNADVNALTITAIGSTPEQARDLANGVVDAVVEYAQEVDTGESNPKRDPLTRVVP
VQPAQLPGAPFTPDYVKAAMKGAAGGLALAYAFLIARRLIDRRIRSVKHVEDATGAAVLGIIPKEDALGRTHRGVRGDLG
RAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQ
ALAGDVDVRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYSGYGGYGGYRAEEATREAYSTAGKGRRRKLVKS
SSDKD
>gnl|bykdb|A0A380TAR7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=631 residues).
MAERDEFTSSRSRSLLEIASRAAALGGKDETNPGSADRQALAAQAARAASLDEVVDEFLKHLDVRPTKASRVISVRFQSR
DAQLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVARSEKAVEAFRTQSGLLRGSQVTLISEEISEINR
RLAAASADRAQATATLNEVQALQKASNIEAAQAIMESPVVQQLRIQEAAVLRELAELSIELGERHPRVINKKSELEKFRA
KIEAEMERVLKGYATAVSVATAREDSLERELNKLKSKQALANSREIELRELEREAEANRKLLETFLTRLKETTPQLDTEM
QVPGATVLSPAAVPLRSLPDKRIVLAVATIIALLLGLGLALMAERLDYGFRHAEQVSEATGLPVIAHLPVARSGRDGPEA
AMLDSQPSLFLEGIRSTYIQLALRSKRPAIRSLLVTSSMPKEGKTTLAIGLTRARAIAGHRALLIDADLRRPSVHVRLKL
AREPGLVDLLVGDASLEQVLQRDEPTGAFVIASGSAARDPSDLLGSKAVKAFLDQACESFDLVVLDSSPLMSVSDACNLA
PLAEETVFVIQWGKTGREVVKLALEKLTETQGVPRGIVLSRVDTAKIRLYGYGDAAYYDRTVREYYTRGSA
>gnl|bykdb|A0A382GX28 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=252 residues).
SPHAEAYRVLRTNILFAGRKDESQTTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILIVDSDLRRPSMHRYMNVSNNIGL
TNYLLGQVTIDEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVTEMKSRYDYVFLDAPPIMGVSDASVLASMVDMC
VLVVQYRKYPQMMTQRAKEMVTKVGGELVGVVLNNINISQDSYYYYYSGYYYDNYYKSREKEGSAEDDTKSRKKTKLLAS
AKTGEEDEKPKY
>gnl|bykdb|A0A382PKY1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=269 residues).
NLSVLGIIPSIGNPDKKRRRWLMAKNRSTSNTRGLRRRLITKEDPKSPVSEAYRSLRTSMLYSTSAKELKSILVSSAGPG
EGKTTTVANLAITYANLGRKTLLVDTDLRRPVVHKVFDLDREPGVTTYLSSATDDYASLIQTCEISNLSIITAGIIPPNP
SELLGSKRMTELVKQLENDWDMVLFDSPPMIAVTDATMISKEIDQVVLIVKVGQTDKKAFHHTINNLRNINAPLGGIIMN
AVTSKSSYGSYYYYYYQYYHYYGSEKESD
>gnl|bykdb|A0A3B0VF49 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=214 residues).
MDLVTITDPRSPRSEAYRTLRTNLSFYSLDTPLQTLVVTSPVMGEGKSSTVANLAVTMAQSGRKIVLVDCDLRRPSLHTL
FNLKAEPGFTDAILENGEPALQETAVENLWLLTAGTKPPNPADILGTPQVDQLIATLQEKADIILFDAPPVNVVTDAAVL
GAKVDGVLLVLSAGKTRREHAERAKEILKKARVNIIGATLTNAPTDSSMEAYYG
>gnl|bykdb|A0A3B0VG16 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=290 residues).
MGKVSRALDKAGAPIKPDENSFIPADVTPGSRDAVVERKKVPGGTKTSPSPAPTVNTFEGWDERLVAASRNFSGVVESFR
KLRTRILYPVEGDVPRSILIISADAQEGKSFICANLGLSLAHSVAQHALMIDCDLRRPSLAGIFGLDNSRGLVDYLRGEE
DFARLVYETGLPDLSIMPAGLPPDNPAELIGSERMAGLLNEAVNGYVDGFVLLDCPPFQAVSESAVLAQLVDKVVLVVRW
GRAGRENVKKLVEQIGRDKIIGIVFNSFEMNILDRKMQDVGYHNYYSERY
>gnl|bykdb|A0A3B0VRL8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=282 residues).
MGKVFKALNKAMSNPDDSASPPASTPEPSIKTERQPTPAKRETPTVSVTGSMDNTSGVNNWDEKLVAFSAPSSIITENIR
HLRNRILHPPSGGPALRRVMTTSALPGEGKSMLCSNLAISMAQGLEQHALLVDCDLRRSSLAQMLAVNNSQGLSNYLQHD
RELGEVIRQTGLPKLSLLPSGPRPMNPAELLDSKRVGEMFDELSNRYDDRFIIIDTPPLPMAAETTVLAEQVDGIIIVVR
WGRAAREQVKQMTENLNKDKIIGVLYNAFEKYILRAKLTCYE
>gnl|bykdb|A0A3B0Z1H7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=257 residues).
MSDQKVDVIPARRMPEDDLSGVRYKQTKPIKISKSQLKENRIISGMDLGVEMDAYRKLRTRVLKKMKKNNWNVLAVTSPA
PGAGKTLTAINLAISIAMEVDKTVLLIDADLRQSRVNKYFGLPETMLGLSDYLTSDISLERLLINPGIGRLIILPGGKLM
HHSSEILSSPKMKRLVEEVKSRYESRYVIFDLPPMLASDDAMGFAPLVDATLLVVEDGVANIDELKSSIELLEDANLIGT
VLNKSREPVKDYYYGKY
>gnl|bykdb|A0A3B1CXE3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=280 residues).
MSRIERAMEKAAKIRISAERSPSVDKPPAIHRDQPCLEGIETVIDKAMTDKCIVTLAEPQSPAAEQYRKLRARILKAIAT
KDDSGNTIMITSSDKREGKTITAINLAVAMANVIDYPVVLVDADLRNPFVHRYLGIEPEYGLSDYLTGKVILSDILLRTG
IGELIILPGGLPPENPAELLSSERMKTLVNELKIRHGGGYVIFDSSPVLLTSDPLSLGSLMDGVIFIIHAALTSEKSAAQ
AISLIKGCNILGIVFNDVQNYPAKDPYPYYSADEAQSGQG
>gnl|bykdb|A0A3B1CYP8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=293 residues).
MSRIERAMEKAARIRGSAERSPAVDSPAAPVIHRDQPCFECECIEAVIDRALADKHIVTLTEPQSPAAEQYRKLRARILK
AAETKDDSINTIMITSSDKKEGKTITAINLAVAMAKVINYPVVLVDADLRNPFVHKYLGIEPEYGLSDYLTGRASLSDIL
LRTGIGELMLLPGGFPPENPAELLSSERMKNLVNELKIRHRGGYVIFDSSPVLLTSDPLSLGSLMDGVLFIIHAALTSEK
SASQAISLIKGCNILGIVFNEVQNYPAKDPYPYNFPEDKDAGRIAGKTKTQGA
>gnl|bykdb|A0A3B1D1Y9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=270 residues).
MSRIEEILEKAARMREGEKNGEKSRKISPPGSKVPGVVRQARIENPNLVTIVDPDSPTAEEYRKLKSMVVKLTEMDDFRN
MLMVTSAIGGEGKSVTSLNLAITLAQEYDHTVLLVDADLRQPSLNDYLGIHSEIGLTDCLVDGVGIGSALIKTGIGGLVF
LPSGRKVSNPGELLSSNRMKEIVKELKHRYPDRYVIFDAPPVLPFAEVLSVGALLDGIIFVVREGVTPEDNMKDAVTMLK
DNNILGVVYNAAETVPLSDYYNYSHYYQNR
>gnl|bykdb|A0A3B1DET2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=261 residues).
MGKITSALKKAAEERINRIDKITKIQERDQMVIKKIGESNVDPRIVTYFDPKALITEQYKILRTNILSLNKSKPPKTIVI
TSSLHSEGKTITSLNLAVALSQAIHKPKVLLVDADMRKGRIERYLGVDQKEGLSDILSGQKNIEDVVFHLDTENLTFISS
GEVPENPAELLSSNKMKQFLSQTRAQFDFVIIDTPPIIAVTDSGIIGAQADGIIMVVQAGRTQRGIVRRAQELLYQSHSK
VLGQVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A3B1DSI5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=343 residues).
QVSPNFTRMMTIGGLLGFLVGAGFAFLRETFDKRFSAPEDIQQQLGVPVIGHVPNISIKRRKKNALSQLDPSVCTFHLPK
SKASEAFRAVRTSLYFSTHNANHQVLQVTSPNPGDGKSTLASNLAVSIACSGKQVLILDCDFRKPRIHEIFGLPNDVGLA
TTITEGIDGEPLAYVQNTEIPNLWCMTCGKLPPNPSELLSSSIFEQFLEVAREKYDYVIVDTPPLLAVTDPSTVAARVDA
VLITLKLKKNSRTMATRAREMLTAVNANLIGIVVNGAGHLEHYSYGYTGYGSSSYEQGYYGYDYAYSVKNDHNTTQPLPV
MYDSQKKGHLQEALYQNENNDDV
>gnl|bykdb|A0A644TLG5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=245 residues).
MTELITKKHSKSPVSEAYRTIRTNVQFSAVNKDLKTIVITSATANEGKSTTISNLGVVMAQAGQKVVIMDCDFRNPTQHK
IFQLPNKGLSNCIAMHKSVMEIIQHTDVEGLDVLTSGPVAPNPSEILSSKRMDEVLEVLGREYDYVLIDTPPILPVTDAA
VMAAKVDGVIMLTAWGNINPEVARDAKARLVQAGANIIGVILNKVEVNTPGNSYGYGYGYGYYYYYGSGEGKEDGEKKHR
HSKEK
>gnl|bykdb|A0A644USI7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=816 residues).
MEETKKNIDKQVFQEEESSFDIMEWVMHFVSHWYLFLVGLAVTMSLAYMQNRKWLPEFKSGGTVIIDESRSMMNSAQVLM
QGFGIQESYRNVNNQVIMIGSYDLMGRVVDSLPHFQTEYISKGRFRTRNLYDWSPILIEPDYIAPEAYGMLFKINIHIDG
TFTITSEDERLSKSFSINGRLGQLTQHQLMFITVNDVNGDITEEELYFRFRTKVSLIDEFSSRLRLNFVNEGSSVLEISL
VSQTPQRDVDFINKLCEIYLISNLERKNDAATKTINFIDEQLENVSKSLAISEDDLTSFRKRNQIIDVGSLSGELLTKAT
AYDNELNQIRLKETYLSYLDKYIRTNLSEGTIVAPTSLGLNEPMLMSLVQQINDLIIKRSELSEKNMFYAKYTRDIENVK
VAINEVVRNMQTSNDLQKQDLNRRLADVQRQIQNLPEKELEMIGIERNYRMNDSYYTMFLQKRAEAQILKASNTPDNNIL
DRARTTSVTNQGAKSKTTMILLLLGVLLPAGYVVLKELMNNAVRTTKDVDRYCVFPLIGLVRHTNSQSPYIVSDYPRSSF
TEMFRIIRTRVEFLAKRKSDITIMITSSESGDGKTYFCINMACIYAMASPKTLLVDMDIRKPSVYKRLGCENNMGVSNYL
ANQCTLDEIIVRPPGAEFDFITAGTVPPNAGELIRSDNLVEMFDELRKRYEFIIVDTSPIGVVADAYSFASMSDINLFVI
RSNKTNKLFLRNLSNQLKADDVTNFYSVLNDVEVDSGSYSQYYSRKYAYGRNKSYGVGAYGYGYGYGYGYTSGSGKNKGK
SSDSYYQYYQDDAKDI
>gnl|bykdb|A0A644WQN3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=217 residues).
MFIVEKEPKSIAAESYRTLRTNIQYSSFDKEYKVIMVTSSEPGEGKSTTAGNLALCLAQGEKKVILVDCDLRKPSLHKKF
KISNIVGLSDVMIGKEELVTAMHRYNNNLVILTSGKIPPNPSEMLSSKAMTTLLDALKQNFDYIILDTPPVQAVTDSQIL
ATKADGAILVVRAERTKKDSVQNAISLLKKVNANIIGTVLNGLDNSRNKYYYYYGEK
>gnl|bykdb|A0A644Y2V8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=176 residues).
MASEGKTTTISNLASVMAELNKNILLIDLDLRKPTVHKQFNLSNRAGLTDLLLHKDDYVGYIQNVHPGLDVITSGKIPAN
PTEIINSNAIKELIKKLSGQYDYIFLDTPPLVLVSDPLTIATYADAVILTIAHSETEKEVIRRSIDSLKQVNANIIGTIL
NKMPVSKHNKYYYSYY
>gnl|bykdb|A0A644YH99 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=253 residues).
MINLKTPNNRKERLDLVLSPETPFAVVEAYKTARTNFMFLLSDSGCKEMVFTSAISEEGKTTSCINLAITFAQTGSRILI
IDADMRKPRIHRLMKIPSTPGLSDRLGNLTKQDCIYATSFENVFVLPAGTIPPNPAELLASESMRKLLADLNGTYDYIFI
DTPPVDVVTDAAVLASRLHGLILVARQGYSRKEIMQSAVAALEQAGVNILGILLNDVNMEKYSGRYRYNRYSKYNQYNRY
SYSDSEHKTEEEA
>gnl|bykdb|A0A644ZS66 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=217 residues).
MDEHSLRLKQNSYVTESYRKLAVNIEYANIDGNIKTIMITSSMANEGKSTTVSNLACVMTELNKRVILIDLDLRKPSVHK
YFNLSNNSGLTDLLLNKNNYKNYIHNIQPGLDVMTSGRVPSNTTEIIISKAIKELLKDLSENYDYILLDTPPIMLVSDPV
NIAIYSDAVILAIAYAETDKETIKKTIDILKQVNANIIGTVLNKVPQNKKNKYYYYY
>gnl|bykdb|A0A644ZTL6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=240 residues).
MPKLITIKNPKSPISEAYRGIRTSIQFSDLDKGMKVITVTSSKQNEGKTTVITNLATTFANLDKKVLVIDGDLRNPGVHR
MFGISNLHGLTDVLVDNTTFVDCVNCTDIKNLHVLTCGVVPPNPSEMLASQRMKEFIENLKDNYDYIFIDAPPIGIVTDA
GVISSYSDGCILVIGANETDIETAKLAKERLDSVGAKIIGTVLNKFAVKTNGHDYYAYYYQGRKSKKSNRKMNKKEKSMA
>gnl|bykdb|A0A645A3P4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=584 residues).
MEGSSVLEIALSSETPHRDVDFINKLCDIYLISNLERKNDAATKTINFIDEQLVNVSKSLSASEDNLTDFRRRNQIIDVG
SLSNELMSKATAYDNELNQVRLKETYLDYLSKYIKTNLDEGAIVAPTNLGLNEPMLMSLVEQINQLILKRGELTEKNMFY
GKYTQDINNVKQAINEVVRNMQTSNHIQKKDLDRRLGEVQKEIQQLPEKELEMIGIERNYRMNDSYYTMFLQKRAEAQIL
KASNTPDNNILDRARTTTVTNSGDKSKTTITFLILGLLLPAAFVVLKELLNNTIHSNKDVERYCSFPLIGMVRHTSSESP
YVVANNPRSSFTEMFRIIRTRIEFLARRKTDITIMVTSSESGDGKTYFSINLACIYSMASPRTLLIDMDIRKPSLYSRLG
CQNTVGVSNYLANQCTLDEIITRPPDAGFDFITAGTVPPNAGELIRSDNLIAMIRELRKKYEFIIVDTSPIGIVADAYSF
ASLSDINLFVIRSGKTNKNFVKNLSAQLKADNISHFYSILNDVQVETNSYSQYYSKRYAYGSSKQYGYSYGYGYGYGYTA
SGRKKKKDESDTYFQYYQDDEKEI
>gnl|bykdb|A0A645AJ49 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=431 residues).
MAKLRSYQLLTAQLTVGNLLMPDFQTLLNSNRVRKKISVALKEIFGTDSTPAYTLSARPLPKTRFVEIAVQSKSRNQTPV
IIEKTVEIFTQEARSLLGINNTQSIDISASAIKVAPKIPLYTIVGLLLGLLVGGGGCFLIDFFDKSIRDLKELEERLQLP
VLGVLPEVASMSGDHDGELWQQDTKSVYGEAIRSLRVNIEYLLPEKGSAKVFLTTSVNKSEGKSSVVSSMAIALAKIEKK
VLLIDVDLRRPRQHRIFKLSNKVGLVDLLVSKKQFEEVVHRNVNLPGLDILTSGTVPITPSDLLGSRRLEEFLKTCANHY
DYILLDAPPALGIADPMILGKLTDTTILICDCREANVDKLAGVTERLRQADVRLGGLVLNRFSLMNKSDYYYYYQHYYYG
YHYSYTAEPGSSDEFAIIPDEPEGGNEPSQS
>gnl|bykdb|A0A645AV36 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=290 residues).
MLNLDIRSERDVARVTEIPVIGMVPNDDDAAVNPLILDADPRSARAEAYRSLRTNLQFLGLDRGKRAIVITSSVPSEGKT
TTAINIASTIAASGERVLVIDADLRRPTVAKLMRLEGSVGLTTVLIGEARLEQVIQPTNDSLMDVLASGPIPPNPAELLG
LPHMQQLITEASRRYDTVIIDAPPLLPVTDAAVLSRVADGTLVVVGSGVARRPELEKALEKLEMVDARVLGLLLTRVRGG
DAGAYHYEYVYGQDGQSSSRTSRDKNAPAPISSARARTGRRPTRAIQPVQ
>gnl|bykdb|A0A645BY58 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=244 residues).
MARQRKRDREEDINLLNDSSPFQITEAYKTLRTNLIFSLAANKSETNDHKAKIIVITSSIPSEGKSTTCANLSIAMAQKS
EKVLIIDADLRKPVQNKLFEIDNSRGLSDVLIDECVLENTISKNVRPFLDLLSSGTIAPNPSELLGSKAMEQMLKTLSEK
YDYIFIDSPPINIVSDALVASVNATGIVMVVRPEICTHEHFKHATESIKLANIKLLGVVMSNVKEDNLGFKYKRKYYSYR
KYKN
>gnl|bykdb|A0A645C306 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=224 residues).
MIAISSTVSGEGKTFVAINFAGVLAFNNKNVIVLDFDLRKPKIHLGFNTDNEKGISSILLNIDKVDDCIRQSSIPNLHFI
TAGPTPINPSELILTNETDELITYLKSKYDYIILDTPPIGLVSDAMKPLQYADYPIYVIRANYSKRSYIYNIEKLYHENN
LRFMSIILNNVDPEITGAGSSQGFAYGYGYGYGYNNSRHGYYDSEDSVKKSWREKLRDRFRRKK
>gnl|bykdb|A0A645DVL5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=338 residues).
MGGPFTSLGPSGTRINVITVSPAGVPGTPVSPNTSMNLLLALLAGMGLGVGMILLQHFLDTRIRSEAHLSAISHLPVLAR
LRQIRDPQTQSLVVESAPHTLAAEEFRRLRTNLQFIDVTTDGKHSFQVTSAMPGEGKTLTSINLALAMAEGGTRVLLVDC
DMRRPSVAKLMGLEGSVGLTTLLLRRASLEDVAQQWRDTTLDVLPAGSLPPNPGELIASDAMEMLFDQFTSSYDFVIVDA
PPVNPVTDPVLINRLVGGILMVVRLNQTGKRELTQALRSLATVDIKVSGFALNGLPNEGSDYYGHYHTEPGEQANGRSRK
RRASRSTSKRTSSHVDAA
>gnl|bykdb|A0A645E1K8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=268 residues).
MLWKKNKNDATERRTNQQSIKQKMLGKKSSFAAVEAYKSTRTNLMFIGDGEGCKKIVFTSTFVGEGKTTNCINLAITLAQ
NGQKVLLIDADMRRPTAKGVFEINTKVGLSEILAGLATWENETEEEPYIYRSKRRNLFVLHSGHIPPNPAELLASKQMKN
LLEKCEKEFDYIIIDTPPISVVTDAAVLANVVNGYVIVVRAGVTPKDSLSESVLRLEQLGANIIGFILNDVDPKTSLYKH
SSGRYKYGSSKYHKYGYGGYDDVQEDSE
>gnl|bykdb|A0A645FLW1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=247 residues).
MSFRLFGGKADHAVQNIKTERQHILGKKTPFSIVEELKTLRTNIQFSTTSEGCKIIGVTSSVAGEGKSITALNLAITFAE
TQSRVLLIDCDLRKPKVSRLLKVKAVPGLSNVLVNMNSVQEAIQTVQLETTSIDVLLSGDIPPNPSELLGSRKMKELIES
LSNRYDYILVDTPPVGVVTDAVIVSSLFTGMIFVIRASRTQQDAVHSALSQLKFAGANVLGFVLNGVNAKGNRRYSSYRS
YKEAAAR
>gnl|bykdb|A0A645FRE7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=233 residues).
MKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVVLIDCDMRK
GYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVLIDTPPIL
AVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A645GFE7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=243 residues).
MGKVTDLDPKSPLAEAYRTVRTNISFADIDSNLITIMFTSTKQNEGKSTTICHVAHAFSKLENTKVLVVDLDLRNPSVHK
MFGIGNTYGIMDYLKNTRDLEKCINKVEENIHVLTPGAMPPNPTEILASKKMERFIKEVESKYDYVFIDAPPVGIVSDGI
IISKYTDGVMFVVGANETDINHTKEVIDNMRKSDVNIIGSILNKYDMENNAYGYYGYYYQQDDGRNGRGAKKKKKNGLFR
KKK
>gnl|bykdb|A0A645HFS0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=187 residues).
MTSALAAEGKSTNCANLALTMSQTGASVLLIDADLRKSTQHKIFGISNTIGLAEILGGFCKVGDGVQEQIHPDLDIITAG
QVPPNPSELLGSQNMQKLIEIVSENYNYIFIDSPPVNIVTDALVLARYAAGLIMCTRYRQSTHDELRRAVASVEFANAKI
LGMIVCDVKDVGGGYYRKSYKSYKSYE
>gnl|bykdb|A0A6J6AB74 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=517 residues).
MHVPMEPQLTPARTLGDYLSAVWRRKYLALSTTVLCACLAAGWSVTQTSVYRASTEVVIDVSRNTSLFGPVAGAGDARRR
LLNEIAIVTGVEVRLGVQQQLHLSSPPPRAKFNTSTTSDVVTFFVESPDAQLAADVANAYIEQYNIYTAKISADTLAGAV
DSLQQQIDDLQKQIETLDHSIAASGNDDDSTREAQRRELLAQQADFRHTLEQQQIDARLDTPGAKVVHPAETPGTPVRPT
PIATTGLGLAIGALLGVALALIRQRLATTVDRPEDLVTLGIAAPLLTVVPVTSSTGDRPLATTDPTNDAVEAYRWLRTSV
QFAGTDRNLKVLQVTSAMPGEGKTTTTANLAIVLANAGALVLIVDGDLRRPRIHTMFGLSGEAGLVDALVGRNPLELVRH
TLDGPDVLPAGRSPYNSSELLSSRRMGEVLHELAAIYDFVIIDTPPVLPVSESLAVSRHADGTILVVRSGRTRSQQLQRT
LGEFDRIGSPVLGIVLNGLDRKHTRYGYGAYGYDASK
>gnl|bykdb|A0A6J6AVD8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=323 residues).
MPTAPYAPKMLNNVAIALVLGLLLGAAMALLFENLDTSLRSEEELKTVSGLDVLAVIPIYDGDSKGEEMSVISSTDPTSY
PAEAYRSLRTAVQFLAIDRPIRTVQVTSPRPGDGKTTTAANFAVAVARAGKRVVLVDCDLRNPRVHRCFGLSNEHGFTSL
LLGEGTFEGVGQRIPGEPNLLVVPSGPIPPDPSELLSGKRAQALLAGIADVADLVVIDSPPVLAVSDPLVLSAVADGVIL
VASVGNSDRNQIAKALSQLRQVDSPLIGAVLNRFKGDSSTYGYGYGYGYGVKNTQEAAKKSAKKSSNKDKEPSPTLIGSN
DNN
>gnl|bykdb|A0A6J6WIY0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=320 residues).
MVLQKQLSDLPALDPQAASIQANIDALNQVEAERRAQPANRVNVAAGAHAHSTPISPHPTRSAVVAFLLTCILVGELIVA
SRAIGDRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFVSINLA
QSASALDDKVVLIDADLRRPTIHERLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVV
LDTLRAVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|A0A6J6XKV0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=475 residues).
MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNKADRVYEATSLLAVTPSDTGLGINADQATFLAKSYALYAETPRVTAE
AAKSSGLNITANDAASLISASAVGDLGFLEVYAKGPSVSDAEQLASAATVALIDAVRAQQTASLAQDIAPIQAQRVVLQK
QLSDLPALDPQAASIQANIDALNQVEAERRAQPANRVNVAAGAHAHSTPISPHPTRSAVVAFLLTCILVGELIVASRAIG
DRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFVSINLAQSASA
LDDKVVLIDADLRRPTIHERLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|A0A6J7CDW0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=635 residues).
MRPADYLRIIRRRWWVLLVTVVIAMTFALLTRPSSSETIRANRPGVSFRATTTLISNGSANTSVNGRDYDRLALLMTTGE
VPKRVAEAIDEVRWPQIQSATANKCAETGADSSSPDCKKSGRPVSAGSGQVQLGTGGFIKASATPDPATGSLAITAQVGD
AVLAAKVANLFAATLVGYVDELGQKQFDEQIFGLTLSRSNSETLIRQIDSQLAAPGLSASEYDSLDIRREAVLRKLANAD
SGISNLEDAGPQTSGLTTLEAATKARATILVTSAKGSTSESQRLLFGAAIGFIIGLGILLLLEILSARIRDVPGTEGAAR
MPVIAEIPVMNLDRTLRFQVITAVDPTSLMAEAYRSFRTSLVAMWQRHPTNNRAGLSGSSEPEATPLRVLLVTSPGPAEG
KSISVVNIAAAFAETGMSVLLIDGDFRRPQMHKYFSGATSPNLTDIPYQGTAADVSAVAQETGVPNIRFIASAPTRTDPG
TAIELVKVAARLGREIADLVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAE
HGARAGYYGYYGYYGYGYGYAHPGEVPKMSRLFPWRKPTNGAGTVRRKPDPEQVGASASNQGAPASTEAFDDTSA
>gnl|bykdb|A0A6J7HIX3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=502 residues).
MSSFSDPETPDASDRALWPLLAALRTRWWLVVGLVVLAGVTAAFAVRAKAPSYTAEAQVLVTPFAGEDSTLSGVRLLRNS
GDPTRDVETAITLLRGAGTDDTTARVLGRGTTRKDVRERVALEAIGGGSVVAVRGTAASEAEAVRLTQTYIDVALGARNA
LVEAGARRALTALDSRTDPGLPTIRRQLRVWRDQGDPTFSIAQRATAPDGPDGPADWLVVLGAMVAGGLLAVIGTIVLQR
TDHRVASRAALLENIPAPVLAGVPTVRGFGGINMPPPVREAFRTLQIQLDLQPKDGCRRILVTSASSGDGKTTAVLNLAF
ALVSAGHRVVLVDFDLRKPDLGRQLGVTGSVALDATVAGGGPLTSIMRSVPRLPPLRLVDVATGPGDLALLPLLTTRTRA
MLQDVDDVADYVLLDTAPVGEVGDALPLLGDVDDVLVVGRPGSTDDRALGAMAGYLRRAGVAPTGWIVTGVDAALSPYYD
AAPRRRSGAVWRTARRIVQGSG
>gnl|bykdb|A0A6J7J287 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=636 residues).
MSTPETPQDFSRANSSPNQPDLFGSSTALRHYAAVVRRRWRWIAAGLVLGMVGGLISTVIATSTAPKSSYFKATNTIVEA
DGSGTANLSQVAFLLQSAEVQGQIATAMNLPVETLRGLIAAQDQSNVSAIDVTAISTDPQFAVTLADTSAKILMDSWSTD
SKRRAAESSDAVIARIDELAAKRDELESQIARNPSQATLLRAELDSVINQYRLAREQFQSIAVSDQTVAAFTVFQPAIAV
QINGRAFAIRYDANLNSRGSISATQSVPKLTFSETDLTVVSGSSRAVRILIGGLVGLILGIATAFVLEVWDDRIRRRDGL
EAVTGLPVIVEVPVFTRAERQELSVIALDAPRSRTAELYRTVRTSILFAIEAESLAALANSDSPDSPRNDRTPVILVTSP
SPGEGKTTTTANVASVFAAAGTRTLIVDCDYRKPSIGKYLAPIPDLEHPTNPQPTRVENLWFIPAPRTSASPAIVIEELG
RVIDSWRDDFDIVFLDTPPMLTTNDATDLLASADLTMLVIRSGQTRTVAAERVSGLLARFGAPVIGTIFNGCSAADMEGY
YGYYGAGYYGSGYYGSGYYGSGYYGSGYYSSGEGQPAQTGQPAQLGQRVRPTPVAPMDAPQTPTSTNGSAEGDAQS
>gnl|bykdb|A0A6J7JYF0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=475 residues).
MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNRAERVYEATALLAVTPSDTGLGINADQATFLAKSYALYAETPRVTAA
AAKSSGLNITANDAASLISASAVGDLGFLEVYAKGPSVSEAEQLSSAATVALIDAVRAQQTASLAQDIAPIQAQRVILQK
QLSNLPAFDPQAASIQANIDALNKVEAERRAQPANRVNVAASAHASSTPISPHPTRSAVVAFLLTCILVGELIVASRAIG
DRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFISINLAQSASA
LDDKVVLIDADLRRPTIHEQLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|A0A6J7K0P4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=514 residues).
MTFGDFVRLSRAYVWVLIGCTILGALLMIGKTTRDPVLYSATSSGLVRVGTNVQSAGEEQGNATLAEDKANLYAFLVSTT
PVAEQVVEDLDLAIPPSAIAGRFSASVDAEVNSLTVSAVGSTPEEARDLANAVVEAVVVVAQQIETGEENPREEPLTRII
PLEQAQLPGAPFTPDYRNAAMKGAIGGLALAYAFLVGRRLIDRRIRSAKHVEDATGASVLGIIPKEDALGRVHRGVRGDL
GRAAEAFRQLRTNLRFVDVDNEPRRIVVTSALAGEGKSTVSSNIARLVAQAGTPVLLIDADLRRPMIATTFEVDGAVGLT
QALAGDVDVREVIIESGMPNLSLLPAGRIPPNPSELLGSLRMKQFVDELSVDYLVILDAPPLLPVTDAGLLSAFCDGALL
VQAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGAAAIAYGGGYGSYGGYGGYKAEYASREAYSTAGKGRRRKQAK
SEAKAEAKAQSKAGSKTEATAAKNADAPEKAAKS
>gnl|bykdb|A0A6J7K3N0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=634 residues).
MRPADYLRIIRRRWWVLLVTVVIAMTFVMLMRPSSSDAVERNKPGLSFKATATLINNFGDTSVRGRDYDRLALLMTTGEV
PQRVADAIDKVRWPQIQAAESAACATTGERSKSSNCPRSRRPVKAGTSVVSLGYQGFIKASAVPDPATGSLAITAQVGDA
KLAAKVANLFAEKLIAYVDELGQNEYYERIFTLTVSRNNAETLLREIDLKMATPLLSASEYDSLGIRREATLRKLANSDY
EISDIQEAGPQTSGLVTLESASRESTTVLVTQAKGSSSESTGLLYGAAFGFIIGLGILLLLEILSARIRDVPGTEGAARM
PVIAEIPVMNLDKSLRFQITTAADPTSLMAEAYRSFRTSLVAMWHRHPVNNPSGKTGSQDTEPLPLRLLLVTSPGPAEGK
SISVVNLAAAFAETGMSVVIIDGDFRRPQVHKYFSNITTPNLSDLPHLATSSDLEGILQETGIPNIRFVASAPTRTDPGS
AIEMVRVASRVGREIADLVIVDSPPILLANDAAELSTFCDATILMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAEH
GARAGYYGYYGYYGYGYGYAHPGEVPKMSRLFPWRKPTRGEGTVRRQPDSKQVGVGASIQGESSSSEAFDDTSA
>gnl|bykdb|A0A6J7MSL1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=191 residues).
MVLEAAGRPRTVAVVSNTQDAGKSFISINLAQSASALDDKVVLIDADLRRPTIHERLNVPRTPGLTSVLLGSDLSEALRK
VAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLRAVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQ
ALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|A0A6J7P7J4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][freshwater metagenome] (length=475 residues).
MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNKADRVYEATSLLAVTPSDTGLGINADQATFLAKSYALYAETPRVTAE
AAKSSGLNITANDAASLISASAVGDLGFLEVYAKGPSVSDAEQLASAATVALIDAVRAQQAASLAQDIAPIQAQRVILQK
QLSALPALDPQAASIQANIDALNQVEAERRAQPANRVNVAAGAHAHSTPISPHPTRSAVVAFLLTCILVGELIVASRAIG
DRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFISINLAQSASA
LDDKVVLIDADLRRPTIHERLNVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|J9H061 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][gut metagenome] (length=234 residues).
MVQEGNRDVINEAFRVLRTNLEFMVGKDHSSNVIVVTSFNPGSGKSFLTMNLAVSLAVKNKKVLVIDGDLRHATTSAYIH
SPKIGLSDYLGGRIDKLSDIIVTHESHASLDIIPVGTIPPNPTELLFDERLQAAIGNLKQQYDFVLIDCPPIELVADTQI
IEKLAHRTIFVVRAGLLERSMLPELEHIYQEKKYKNMSLILNATEGSGGRYGYRYGYHYGYGNGYHYGNSTKTN
>gnl|bykdb|K1RRH4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=240 residues).
MKSTDLIINVNPKSIFSESIKTIRTNLAFSAIGNEMKVLLATSPAAGDGKSFISANLAVAYAQEGKKVLMIDCDLRRGRQ
HEIFEVMNLTSGGYSNLILNYKEDVNLGKYIMKTSNANVDLLPTGPTPPNPIELLASENNQKLLNELRKLYDIIILDCPP
VIGLSDTMIMTKFSDANIIVVSNKKTKIESLDRAKKIFAQANAKITGVVINKASVKGSSYYSYYSDEYYRDTDSKKKRKR
>gnl|bykdb|K1S5Q5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=371 residues).
DIKNWVSIEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESAINAAFPSTTLTVIDPPLLASAPDRDASAKIYTIVGFA
AGLVISIFAIVLAVIAKDTVKTADDVKDKLGVDVIGMVAHVNRKKKKKGEEYKPLLISDRRSGFPFIETFKIIRTKIEHT
AQREKYKTFVVTSTAENEGKTTSAVNIALALAQNGKSVLLVDGDLRKPAVAKLLGINASEDGGVYGVINGEKTLAEAIKY
SEKYNLFLLVSGKPVFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKR
AVENLENSGTKLVGCIYNDTESGMPKRFMSSYNKKYGYGYGYGYGYGSNQK
>gnl|bykdb|K1SQJ7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=241 residues).
IPQIQAPDRKSKPVLVLGENSSFAVRESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLI
DGDMRNMSVASLLKLRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDL
PPVGIVTDALLLSYEVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEA
V
>gnl|bykdb|K1ULC5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=268 residues).
MLDTTIRGRKDIEDNLAVPFLGDIPQYSGEKQRGSFVVRENGRDPVSEAFRMIRSNMNFMNLGKGEIKVIMVTSSNPHAG
KTFVSTNLAMTFATTGKKVVIMDLDLRRRTFSKQMGHDGDTNGVSSYLSGSTELQAIIRKSKLSEKLDIIYAGIQPPNPS
EMLLSQRMEELIAELKLHYDYIIIDSTPAMAVADAIITDRLADLSIYVVREGLLDRRQLPDIERLYREKKFHNMAIILNG
ASSTKRHGYGYGYGYGYGYGLDEEETTT
>gnl|bykdb|W1Y9X6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=239 residues).
MAKRGAYDEGNFELNESYREIRTYVTINKNIKTILVTSAEMDEGKTTIICNLAKCFSELEGVRVLLIDCDFRKRGVSRYF
GIENSFGVSDIVFGNNKKSECIKRVGDLDIITSGGVPSNTSILLNSQSMKDLVSKLREEYDYVFIDSPPICRLNDACIIT
QYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAEKYSYYSNYYGYSNYYGEHKHKLFGRKKKRRRKTS
>gnl|bykdb|W1YAG3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=223 residues).
MGRITSLEKPQSNISEAYRTIRTGIEFSNLDKDLKIICITSSKKDEGKTTVLSNLGVSFAKIDKKVLLIDADLRNPSISK
MFDTSNAQGLMDILLGKRNIQDCVKKTKQENLYILTGGTIPPNPAEVLSSKKMSEFIESIKDEYDYIFIDSPPVGVVSDA
SIISAYSDGVIFVVGANEVDSNLAKIAKERLDNVKANIVGVILNKFKTDTNSEYYNYYYNENK
>gnl|bykdb|X0S5W7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=433 residues).
QLAPLLLQMAQQGLDKSKQKESILQASLDEARFEAVTHQRDTSHITMLEQNVLRLRRLHDAIIDQIAGVDLRQGHGEIQA
TIIKDATASGQIVSPKISRIIACWILGTLGIGFVLVYVQDTIDDRFRTPEELSKRVGHPLIGLVRALPELSGEGLKKVSA
FGDPVSVFVESFRTLRTSLTLSGVDSTRIAFTSSEPGDGKTTVIANLAVVCAQSGKKTLLIDGDLRRPGLTRLLDLKSKP
GLSDLLNADDEVSDMISDYLASTDAPNLDVLPAGPRRQNPSELLASDRLAQIFAWAETKYDQILVDCPPTLVASDAVLVG
RIVDGMVLIVRPDKNRRKLVFRATQNLTEMKIPLLGLVANGVGAENNKGYSFGEGEGYGYGYGYGDDENNDEDEGEIEQQ
GNGDSYQGISFQSKTSDQSENDQENLPANFRKT
>gnl|bykdb|X0T0M9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=326 residues).
AISPLNRTSPNTKVNLAVGLLLGLGLGALAAFLIEQTDNSIKNVSDIERKGINVLGIIPDISKSKSATKKRNITRKTQKT
PKGQEGTINIARDIKRRIITKEDPRSPISEAYRSLRTSITYASVDNPTKTIIVTSPGPGEGKTTTITNLAITFANIGKRT
LLVDADLRRPVIHRIFNLNIEPGVTHYLTGFPRDIRPLIKQTEIKNLQVITAGATPPDPSVLISSKRMHEFIKSLEIGWD
IILFDAPPAIAVTDTSLLAKEINQFIIVVKSGQTDKFAFDRAIQMLESVNAPIAGAIMNAVSPKTSYESYYYYHEYYHYY
GKDKNK
>gnl|bykdb|X1MSI7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=237 residues).
MPNKYSDWLVVKSKPKSHVSEAYRTLRTNIEFSNLDKPLNTIMVTSAVPQEGKTTNTVNLALTIAESGKKVIIVDVDLRV
PTIHKVFNSDSKPGLTNVLVYNKKLSEVIKKADEINSNLYYITSGPIPPNPSELLGSEKMKVVIEELKERADTLIFDSAP
VIGFADSLVLANQVDGVVLILNAGMVTRDAAKQAKALLEKAKAKILGVVLNNVDIKREGYYHYYHYYNYSKYYNTEE
>gnl|bykdb|X1SDZ3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=270 residues).
LVFLIEYLDTSLRTIEDVEKYLPWPVLGIIPRFEQAFEGKIPHSDIQPVVRKHPKSVPAEAYRTLKTNIQLADLDRPPRS
IAITSAVPLEGKSTTAVNLAVALAQKGSKVLLVDADLRKSVIHKILHLDNSTGLVDLITNHAKPEAAIKEFHSVDNLWVL
TSGSVPSDSSELLGSTQMRSLVEQLTKEYNYVVFDTPPLMSVSDTAVLASQVDGVLMIIRPGKLRREMARRTKELLNRVG
TPVLGCVLNGVEPRDSSYYYYYHSYAGAEG
© 1998-2021Legal notice