BYKdb

Dataset for cluster orphancd of phylum metagenomes

[Download (right click)] [Edit] [Sequences] [Repertoires]

50 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A644USI7      MEETKKNIDKQVFQEEESSFDIMEWVMHFVSHWYLFLVGLAVTMSLAYMQNRKWLPEFKS
A0A2P2C6F5      ------------------------------------------------------------
A0A0F9C030      ------------------------------------------------------------
A0A0F9G9C6      ------------------------------------------------------------
A0A645A3P4      ------------------------------------------------------------
A0A0F9HWF5      ------------------------------------------------------------
A0A2H9T3X6      -----------------------------------------MIGRAVARRFSPDAEAGEL
A0A380TAR7      -----------------------------------------------------MAERDEF
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A644USI7      GGTVIIDESRSMMNSAQVLMQGFGIQESYRNVNNQVIMIGSYDLMGRVVDSLPHFQTEYI
A0A2P2C6F5      ----------------------------------------------------------MT
A0A0F9C030      ------------------------------------------------------------
A0A0F9G9C6      ----------------------------------------------------------NT
A0A645A3P4      ------------------------------------------------------------
A0A0F9HWF5      ------------------------------------------------------------
A0A2H9T3X6      INTPWLWFSGYGWGGEALKIERFEMHSSLLDQPYTLVA-GENGHYQLWLDDRMILTGKVG
A0A380TAR7      TSSR---------------------SRSLLEIASRAAALGGKDETNPGSADRQALAAQAA
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A644USI7      SKGRFRTRNLYDWSPILIEPDYIAPEAYGMLFKINIHIDGTFTITSEDERLSKSFSINGR
A0A2P2C6F5      FGDFVRLTRAYVWVLIGCTV----------------------------------------
A0A0F9C030      --QQH--------AFAMVDT----------------------------------------
A0A0F9G9C6      ILDLQ--------AAIGASE----------------------------------------
A0A645A3P4      ------------------------------------------------------------
A0A0F9HWF5      -------IVITSFLKRFDVK----------------------------------------
A0A2H9T3X6      EAAQSKDQQLRLFVSLLQAR----------------------------------------
A0A380TAR7      RAA-SLDEVVDEFLKHLDVR----------------------------------------
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A644USI7      LGQLTQHQLMFITVNDVNGDITEEELYFRFRTKVSLIDEFSSRLRLNFVNEGSSVLEISL
A0A2P2C6F5      ------------------------------------------------LG---ALLMMAK
A0A0F9C030      ------------------------------------------------IGREVLLRQLGL
A0A0F9G9C6      ------------------------------------------------KGKDSGIINLSL
A0A645A3P4      -------------------------------------------------MEGSSVLEIAL
A0A0F9HWF5      ------------------------------------------------PVRNTQIAVVSF
A0A2H9T3X6      ------------------------------------------------P-------GTRF
A0A380TAR7      ------------------------------------------------PTKASRVISVRF
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A644USI7      VSQTP--QRDVDFINKLCEIYLISNLERKNDAATKTINFIDEQLENVSKSLAISEDDLTS
A0A2P2C6F5      TTRDPVLYSATSSGLVVVGNATTAGEEQGNAALAEEKAGLYA------------------
A0A0F9C030      KTADP--YASSRINQQLID-------DRGK---LQAKLLLYG------------------
A0A0F9G9C6      QSEKP--HYAEKVLDKVAGIYVRRNVERNS---AEAQKSL-E------------------
A0A645A3P4      SSETP--HRDVDFINKLCDIYLISNLERKNDAATKTINFIDEQLVNVSKSLSASEDNLTD
A0A0F9HWF5      NSKSP--EMAARVANAAVQAYVDYTLTTKIKANVGASGVLRKNIQEQRKKIEESEKLLFE
A0A2H9T3X6      NVTDQ--LLVSTVNQ----------LSQRLSVSEKG------------------KKTGVL
A0A380TAR7      QSRDA--QLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVARSEKAVEA
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------------------------------------
A0A645AJ49      ----------------------------------------------------------MA
X0S5W7          ------------------------------------------------------------
A0A644USI7      FRKRNQIIDVGSLSGELLTKATAYDNEL-----NQIRLKETYLSYLDKYIRTNLSEG--T
A0A2P2C6F5      -----------------------------------------FLVSSMPVAEKVVDDL---
A0A0F9C030      -----------------------------------------SAHQEVRTLQQRISLA---
A0A0F9G9C6      -----------------------------------------FLEVQLPEIKKQLEFA---
A0A645A3P4      FRRRNQIIDVGSLSNELMSKATAYDNEL-----NQVRLKETYLDYLSKYIKTNLDEG--A
A0A0F9HWF5      YKEKFKIISLEEEKNITIQKLAAHSKNLVSAENVRIEAQSKYQVAVGMLVDGDLAGSIPE
A0A2H9T3X6      SLSLTGPSRPENSRLLE-AIIQRYVRQNIERVSAEAQNSLKFLERQLPEMKKDVELA-ES
A0A380TAR7      FRTQSGLLRGSQVTLIS-EEISEINRRLAAASADRAQATATLNEVQALQKASNIEAA-QA
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      ------------------------------MNEQILVYKAGIFASNPAQIQQLTAKVLEE
A0A645AJ49      KLRSYQLLTAQLTVGNLLMPDFQTLLNSNRVRKKISVALKEIFGTDSTPAYTLSARPLPK
X0S5W7          ------------QLAPLLLQMAQQGLDKSKQKESILQA------------------SLDE
A0A644USI7      IVAPTSLGLNEPMLMSLVQQINDLIIKRSELSEKNMFYAKYTRDIE-NVKVAINEVVRNM
A0A2P2C6F5      ---D----------------------------------------LDVPPSEIAGRFSATV
A0A0F9C030      ---EHFLQNQRFQDAEQARQIIQ-------------------QELGPALFDMARQQCDEA
A0A0F9G9C6      ---E-----QRFNDYQIQRQSINITLETQGVLEQVVKLETKLQELELKRLELGRKFKKDH
A0A645A3P4      IVAPTNLGLNEPMLMSLVEQINQLILKRGELTEKNMFYGKYTQDIN-NVKQAINEVVRNM
A0A0F9HWF5      VMSNGFITKLKTDEAVLREQLSEISRKYGSKHPKVIALNDKISTVRGMIDDEIFRVVDSM
A0A2H9T3X6      ----------KLHRFQQENQTVDLTMETQAVLDQAVTIDTQLAKLDMQIEQMSQRYTANH
A0A380TAR7      IMESPVVQQLRIQEAAVLRELAELSIELGERHPRVINKKSELEKFRAKIEAEMERVLKGY
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
K1S5Q5          ---------------DIKNWVSIEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESAIN
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ----------------------------------------------------MGGPFTSL
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0W8FVN7      EVRYQSLLSSHKELDELVQRYEVRFNEMPKRTLDLARLQRIKEANEKLYLLVEEKYQEA-
A0A645AJ49      TRFVEIAVQSKS-------------RNQTPVIIEKTVEIFTQEARSLLGI------NNT-
X0S5W7          ARFEAVTHQRDTSHITMLEQNVLRLRRLHDAIIDQIAGVDLRQGHG--EI------QAT-
A0A644USI7      QTSNDLQKQD---LNRRLADVQRQIQNLPEKELEMIGIERNYRMNDSYYTMFLQKRAEA-
A0A2P2C6F5      NADVNA-LT------------ITAIGSTPEQAR---------DLANGVVDAVVEYAQEV-
A0A0F9C030      VASERA-IS--AAYEEEKQAAVSLYGTLAELQI----IERDLEHLHAFHETLLDRVKDL-
A0A0F9G9C6      PTYQGI-IEQIAAVNEQKKALVGEVGNLPETQQELLRLRRDVEVSNQIYTLLLSKTQEL-
A0A645A3P4      QTSNHIQKKD---LDRRLGEVQKEIQQLPEKELEMIGIERNYRMNDSYYTMFLQKRAEA-
A0A0F9HWF5      KSQYDVALRNELALKGELVRLKEESQSLGKHAVAYSVLARDVYTNKEMYEVLLKRLKET-
A0A2H9T3X6      PVMEELQLQRQLIVDRQDKFSDQARGLPKTQQ-EVMRLARDVQVSTEVYTELLNKAQEL-
A0A380TAR7      ATAVSVATAREDSLERELNKLKSKQALANSREIELRELEREAEANRKLLETFLTRLKETT
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          --------------AISPLNRTSPNTKVNLAVGLLLGLGLGALAAFLIEQTDNSIKNVSD
K1S5Q5          AAFPSTTLTVIDPPLLASAPDRDASAKIYTIVGFAAGLVISIFAIVLAVIAKDTVKTADD
A0A3B1DSI5      --------------------QVSPNFTRMMTIGGLLGFLVGAGFAFLRETFDKRFSAPED
A0A645DVL5      GPSGTRINVITVSPAGVPGTPVSPNTSMNLLLALLAGMGLGVGMILLQHFLDTR------
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      --------------------------------------------MGKVSRALDKAGAPIK
A0A3B1CXE3      --------------------------------------------MSRIERAMEKAAKIRI
A0A3B1CYP8      --------------------------------------------MSRIERAMEKAARIRG
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          --------------------------------------------LVFLIEYLDTSLRTIE
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      --------------------------------------------MERIKQAILRAKNHQS
A0A3B0VRL8      --------------------------------------------MGKVFKALNKAMSNPD
A0A3B1DET2      -----------------------------------------------MGKITSALKKAAE
A0A3B0Z1H7      --------------------------------------------------MSDQKVDVIP
A0A3B1D1Y9      --------------------------------------------MSRIEEILEKAARMRE
A0A382PKY1      --------------------------------------------NLSVLGIIPSIGNPDK
A0A645E1K8      -------------------------------------------------MLWKKNKNDAT
K1ULC5          -----------------------------------------------------MLDTTIR
A0A0W8FVN7      -QINEQS----TPGNVLIID-AARQPENPSKPNRILIIAVGLVLGLGFGFGFAFVRNYFD
A0A645AJ49      -QSIDIS----ASAIKV-------------APKIPLYTIVGLLLGLLVGGGGCFLIDFFD
X0S5W7          -IIKDAT----ASGQIV-------------SPKISRIIACWILGTLGIGFVLVYVQDTID
A0A644USI7      -QILKAS----NTPDNNILD-RARTTSVTNQGAKSKTTMILLLLGVLLPAGYVVLKELMN
A0A2P2C6F5      -DTGESNPKRDPLTRVVPVQ-PAQLPGAPFTPDYVKAAMKGAAGGLALAYAFLIARRLID
A0A0F9C030      -NLGQDK----GIIRTSILT-PPKTPGGPVWPNLSMIAMFSIAIGFGMGLGIVYIQDLLD
A0A0F9G9C6      -DIVRAG----TVGNVRIIDYAEVNTSKPVKPKKALIVVMTTMLGGMLAVAIVLVQKAMH
A0A645A3P4      -QILKAS----NTPDNNILD-RARTTTVTNSGDKSKTTITFLILGLLLPAAFVVLKELLN
A0A0F9HWF5      -SITGGM----QTTNVRVLD-EAIPPTIPFRPRRMLNILLAIVLGLFMGPVVAISFEYMD
A0A2H9T3X6      -KIVKAS----AVGNVRILD-HALSGITPVKPKKPLIFVLAVLLGGMCGTGFVFLRDMLR
A0A380TAR7      PQLDTEM----QVPGATVLS-PAAVPLRSL-PDKRIVLAVATIIALLLGLGLALMAERLD
                                                                            

A0A0F9BMP5      ------------------------------------------------------------
X0T0M9          IERK-GINVLGIIPDISKSKSATKKRNITRKTQKTPKGQEGTINIARDIKRRIITKEDPR
K1S5Q5          VKDKLGVDVIGMVAHVNRKKKKKGEEY--------------------K--PLLISDRRSG
A0A3B1DSI5      IQQQLGVPVIGHVPNISIKRRKKNALS--------------------QLDPSVCTFHLPK
A0A645DVL5      IRSEAHLSAISHLPVLARLRQIRDPQT--------------------Q---SLVVESAPH
A0A645HFS0      ------------------------------------------------------------
A0A3B0VG16      PDENSFIPADVTPGSRDAVVERKKVPGGTKTSP----SPAPTVNTFEGWDERLVAASRNF
A0A3B1CXE3      SAE------------RSPSVDKP--PAIHRDQPCL--EGIETVIDKAMTDKCIVTLAEPQ
A0A3B1CYP8      SAE------------RSPAVDSPAAPVIHRDQPCFECECIEAVIDRALADKHIVTLTEPQ
A0A382GX28      ------------------------------------------------------------
A0A645FRE7      -----------------------MKRY---------------------KQSQLLAVGNPT
A0A644YH99      ----------------MINLKTPNNRK---------------------ERLDLVLSPETP
A0A645FLW1      ---------MSFRLFGGKADHAVQNIK---------------------TERQHILGKKTP
A0A3B0VF49      --------------------------------------------------MDLVTITDPR
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      -------------------------------------------------MTELITKKHSK
X1SDZ3          DVEKYLPWPVLGIIPRFEQAFEGKIPH---------------------SDIQPVVRKHPK
A0A645BY58      ------------------MARQRKRDR---------------------EEDINLLNDSSP
A0A645GFE7      ------------------------------------------------MGKVTDLDPKSP
X1MSI7          -----------------------MPNK---------------------YSDWLVVKSKPK
J9H061          -----------------------------------------------------MVQEGNR
K1SQJ7          -----------------IPQIQAPDRK---------------------SKPVLVLGENSS
K1RRH4          --------------------------M---------------------KSTDLIINVNPK
W1Y9X6          -------------------------------------------------MAKRGAYDEGN
A0A644ZTL6      -------------------------------------------------MPKLITIKNPK
W1YAG3          -------------------------------------------------MGRITSLEKPQ
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      -------------------------------------------------MDEHSLRLKQN
A0A644WQN3      ---------------------------------------------------MFIVEKEPK
A0A645AV36      ---------------MLNLDIRSERDV---ARVTEIPVIGMVPNDDDAAVNPLILDADPR
A0A1J5SIM8      SEANLAQLRPDGQGKSFKSNISKSQDE---LVDFRYENTRVVKLEKEHLEKNRIVAFDKS
A0A3B0VRL8      DSASPPASTPEPSIKTERQPTPAKRETPTVSVTGSMDNTSGV----NNWDEKLVAFSAPS
A0A3B1DET2      ERINRIDKITKIQERDQMVIKKIGESN---------------------VDPRIVTYFDPK
A0A3B0Z1H7      ARRMPEDDLSGVRYKQTKPIKISKSQL---------------------KENRIISGMDLG
A0A3B1D1Y9      GEKNGEKSRKISPPGSKVPGVVRQARI---------------------ENPNLVTIVDPD
A0A382PKY1      KRR------RWLMAKNRSTSNTRGLR------------------------RRLITKEDPK
A0A645E1K8      ERRTNQQSIKQKMLGKKSSFAA--------------------------------------
K1ULC5          GRKDIEDNLAVPFLGDIPQYSGEKQR------------------------GSFVVRENGR
A0A0W8FVN7      NTVKTPEELQQK-NISLLAWIP----------------EMFVADKNRAPGSEFIVNKKSD
A0A645AJ49      KSIRDLKELEERLQLPVLGVLP----------------E--VASMSGDHDGELWQ-QDTK
X0S5W7          DRFRTPEELSKRVGHPLIGLVR----------------A--LPELSGEGLKKVSAFGDPV
A0A644USI7      NAVRTTKDVDRYCVFPLIGLVR----------------------HTNSQSPYIVSD-YPR
A0A2P2C6F5      RRIRSVKHVEDATGAAVLGIIPKED----------------ALGRTHRGVR------GDL
A0A0F9C030      DHFRSPEELRIQLGLPVLAMVGKLE------------------PQTNVGVDALHVHVQPN
A0A0F9G9C6      KGVEDPNEIE-AIGLPVYASVPYSDYQDKLTGFSKALKNKVSKPKSILALD------NPA
A0A645A3P4      NTIHSNKDVERYCSFPLIGMVR----------------------HTSSESPYVVAN-NPR
A0A0F9HWF5      SSVKTPEDIERYLRVPYLGPLP--------------DFHGQESERAGGRSTMLVTSLDPK
A0A2H9T3X6      QGVKTPEEIEAKTGLSVFATIPQSE----------QNLLLERNARKQGGGFMLAQS-APD
A0A380TAR7      YGFRHAEQVSEATGLPVIAHLP-----------------VARSGRDGPEAAML--D-SQP
                                                                            

A0A0F9BMP5      -----------------------------AGQAIALTSACPREGKTMLTLSLAMALNAMK
X0T0M9          SPISEAYRSLRTSI-TYA-------SVDNPTKTIIVTSPGPGEGKTTTITNLAITFANIG
K1S5Q5          FPFIETFKIIRTKI-EHT-------AQREKYKTFVVTSTAENEGKTTSAVNIALALAQNG
A0A3B1DSI5      SKASEAFRAVRTSL-YFS-------THNANHQVLQVTSPNPGDGKSTLASNLAVSIACSG
A0A645DVL5      TLAAEEFRRLRTNLQFID-------VTTDGKHSFQVTSAMPGEGKTLTSINLALAMAEGG
A0A645HFS0      -----------------------------------MTSALAAEGKSTNCANLALTMSQTG
A0A3B0VG16      SGVVESFRKLRTRILYPVE--------GDVPRSILIISADAQEGKSFICANLGLSLAHSV
A0A3B1CXE3      SPAAEQYRKLRARILKAIA------TKDDSGNTIMITSSDKREGKTITAINLAVAMANVI
A0A3B1CYP8      SPAAEQYRKLRARILKAAE------TKDDSINTIMITSSDKKEGKTITAINLAVAMAKVI
A0A382GX28      SPHAEAYRVLRTNILFAG-------RKDESQTTFSVVSGGAGEGKTTTMFNLAVVFAQMG
A0A645FRE7      DLAIEAVRSLRTSLHF-A-------MMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTN
A0A644YH99      FAVVEAYKTARTNFMF-L-------LSDSGCKEMVFTSAISEEGKTTSCINLAITFAQTG
A0A645FLW1      FSIVEELKTLRTNIQF-S-------TTSEGCKIIGVTSSVAGEGKSITALNLAITFAETQ
A0A3B0VF49      SPRSEAYRTLRTNLSF-Y-------SLDTPLQTLVVTSPVMGEGKSSTVANLAVTMAQSG
A0A644Y2V8      ---------------------------------------MASEGKTTTISNLASVMAELN
A0A644TLG5      SPVSEAYRTIRTNVQF-S-------AVNKDLKTIVITSATANEGKSTTISNLGVVMAQAG
X1SDZ3          SVPAEAYRTLKTNIQL-A-------DLDRPPRSIAITSAVPLEGKSTTAVNLAVALAQKG
A0A645BY58      FQITEAYKTLRTNLIF-SLAANKSETNDHKAKIIVITSSIPSEGKSTTCANLSIAMAQ-K
A0A645GFE7      --LAEAYRTVRTNISF-A-------DIDSNLITIMFTSTKQNEGKSTTICHVAHAFSKLE
X1MSI7          SHVSEAYRTLRTNIEF-S-------NLDKPLNTIMVTSAVPQEGKTTNTVNLALTIAESG
J9H061          DVINEAFRVLRTNLEFMV-------GKDHSSNVIVVTSFNPGSGKSFLTMNLAVSLAVKN
K1SQJ7          FAVRESYNTIRANLLF-T-------GKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLG
K1RRH4          SIFSESIKTIRTNLAF-S-------AIGNEMKVLLATSPAAGDGKSFISANLAVAYAQEG
W1Y9X6          FELNESYREIRT---Y-V-------TINKNIKTILVTSAEMDEGKTTIICNLAKCFSELE
A0A644ZTL6      SPISEAYRGIRTSIQF-S-------DLDKGMKVITVTSSKQNEGKTTVITNLATTFANLD
W1YAG3          SNISEAYRTIRTGIEF-S-------NLDKDLKIICITSSKKDEGKTTVLSNLGVSFAKID
A0A645C306      --------------------------------MIAISSTVSGEGKTFVAINFAGVLAFNN
A0A0F9CMN4      -------------------------DIDNPPKSLVITSAVPLEGKSTTALNLAVALAQKE
A0A644ZS66      SYVTESYRKLAVNIEY-A-------NIDGNIKTIMITSSMANEGKSTTVSNLACVMTELN
A0A644WQN3      SIAAESYRTLRTNIQY-S-------SFDKEYKVIMVTSSEPGEGKSTTAGNLALCLAQGE
A0A645AV36      SARAEAYRSLRTN-LQFL-------GLDRGKRAIVITSSVPSEGKTTTAINIASTIAASG
A0A1J5SIM8      NPMSMNFDLLRTHVLQKM-------EEN-GWRTLAITSPTPEAGKTVIAINLAMSIAQQT
A0A3B0VRL8      SIITENIRHLRNRILHPP-------SGGPALRRVMTTSALPGEGKSMLCSNLAISMAQGL
A0A3B1DET2      ALITEQYKILRTNILSLN-------KSKP-PKTIVITSSLHSEGKTITSLNLAVALSQAI
A0A3B0Z1H7      VE-MDAYRKLRTRVLKKM-------KKNN-WNVLAVTSPAPGAGKTLTAINLAISIAMEV
A0A3B1D1Y9      SPTAEEYRKLKSMVVKLT-------EMDDFRNMLMVTSAIGGEGKSVTSLNLAITLAQEY
A0A382PKY1      SPVSEAYRSLRTSMLYST-------SAKE-LKSILVSSAGPGEGKTTTVANLAITYANL-
A0A645E1K8      ---VEAYKSTRTNLMFIG-------DGEG-CKKIVFTSTFVGEGKTTNCINLAITLAQN-
K1ULC5          DPVSEAFRMIRSNMNFMN-------LGKGEIKVIMVTSSNPHAGKTFVSTNLAMTFATT-
A0A0W8FVN7      STASEAYRALRTRIRYSG-------VEGTIPKKLLVTSSSAGEGKTTTAVNLAGSFAQAN
A0A645AJ49      SVYGEAIRSLRVNIEYLL-------PEKGSAKVFLTTSVNKSEGKSSVVSSMAIALAKIE
X0S5W7          SVFVESFRTLRTSLT--L-------SGVDSTRIAFTSS-EPGDGKTTVIANLAVVCAQSG
A0A644USI7      SSFTEMFRIIRTRVEFLA-------KRKSDITIMITSS-ESGDGKTYFCINMACIYAMAS
A0A2P2C6F5      GRAAESFRQLRTNLRFVD-------VDNEPRKIVVTSA-LAGEGKSTVSANIARLVAQAG
A0A0F9C030      AVESEAFRTLRTAL--AL-------AEGGSQRLVVSSS-EPGDGKTTVISNLAVAYAQSG
A0A0F9G9C6      DLSIEALRSLRTSLHFAM-------MEAKNNLIAISGP-SPGVGKSFVSVNLAAVLAQSG
A0A645A3P4      SSFTEMFRIIRTRIEFLA-------RRKTDITIMVTSS-ESGDGKTYFSINLACIYSMAS
A0A0F9HWF5      SVPAEAYRSIRTSIIFSS-------PDDK-RTLLVTSS-NPTEGKSVTSSNLAVIMAQNG
A0A2H9T3X6      DLAVESLRSLRTNLSFTM-------MEGKDNRVMITGP-SPGIGKSFVSANLALLLAESG
A0A380TAR7      SLFLEGIRSTYIQLALRS-------KRPAIRSLLVTSS-MPKEGKTTLAIGLTRARAIAG
                                                           **:     .        

A0A0F9BMP5      DQ-RAVILDCDLRRSRIAELLNLSQG-------V--ALDSILLG---QTCP----LDAV-
X0T0M9          K--RTLLVDADLRRPVIHRIFNLNIE-------P--GVTHYL-T-GFPRDI----RPLI-
K1S5Q5          K--SVLLVDGDLRKPAVAKLLGINAS-------E--DGGVYGVI-NGEKTL----AEAI-
A0A3B1DSI5      K--QVLILDCDFRKPRIHEIFGLPND-------V--GLATTITE-GIDGEP----LAYV-
A0A645DVL5      T--RVLLVDCDMRRPSVAKLMGLEGS-------V--GLTTLL-------------LRRA-
A0A645HFS0      A--SVLLIDADLRKSTQHKIFGISNT-------I--GLAEILGG---FCKV----GDGV-
A0A3B0VG16      AQ-HALMIDCDLRRPSLAGIFGLDNS-------R--GLVDYLRG---EEDF----ARLV-
A0A3B1CXE3      DY-PVVLVDADLRNPFVHRYLGIEPE-------Y--GLSDYLTG---KVIL----SDIL-
A0A3B1CYP8      NY-PVVLVDADLRNPFVHKYLGIEPE-------Y--GLSDYLTG---RASL----SDIL-
A0A382GX28      D--RILIVDSDLRRPSMHRYMNVSNN-------I--GLTNYLLG---QVTI----DEVI-
A0A645FRE7      K--RVVLIDCDMRKGYTHELLGTNNV-------N--GLSEILIG---KGDI----SSSA-
A0A644YH99      S--RILIIDADMRKPRIHRLMKIPST-------P--GLSDRLGN----LTK----QDCI-
A0A645FLW1      S--RVLLIDCDLRKPKVSRLLKVKAV-------P--GLSNVLVN---MNSV----QEAI-
A0A3B0VF49      R--KIVLVDCDLRRPSLHTLFNLKAE-------P--GFTDAILE-----NG----EPAL-
A0A644Y2V8      K--NILLIDLDLRKPTVHKQFNLSNR-------A--GLTDLLLH---KDDY----VGYI-
A0A644TLG5      Q--KVVIMDCDFRNPTQHKIFQLPNK----------GLSNCIAM---HKSV----MEII-
X1SDZ3          S--KVLLVDADLRKSVIHKILHLDNS-------T--GLVDLITN---HAKP----EAAI-
A0A645BY58      SE-KVLIIDADLRKPVQNKLFEIDNS-------R--GLSDVLID---ECVL----ENTI-
A0A645GFE7      NT-KVLVVDLDLRNPSVHKMFGIGNT-------Y--GIMDYLKN---TRDL----EKCI-
X1MSI7          K--KVIIVDVDLRVPTIHKVFNSDSK-------P--GLTNVLVY---NKKL----SEVI-
J9H061          K--KVLVIDGDLRHATTSAYIHSPKI----------GLSDYLGG-RIDKLS----DIIV-
K1SQJ7          K--KVLLIDGDMRNMSVASLLKLRGR-------L--GLSQYLAGLRETPQI----VEYR-
K1RRH4          K--KVLMIDCDLRRGRQHEIFEVMNL-------TSGGYSNLILNYKEDVNL----GKYI-
W1Y9X6          GV-RVLLIDCDFRKRGVSRYFGIENS-------F--GVSDIVFG---NNKK----SECI-
A0A644ZTL6      K--KVLVIDGDLRNPGVHRMFGISNL-------H--GLTDVLVD---NTTF----VDCV-
W1YAG3          K--KVLLIDADLRNPSISKMFDTSNA-------Q--GLMDILLG---KRNI----QDCV-
A0A645C306      K--NVIVLDFDLRKPKIHLGFNTDNE-------K--GISSILLN---IDKV----DDCI-
A0A0F9CMN4      S--KVLLIDADLRKPIIHKLLHLDNS-------T--GLVDALLN---GGHP----GASV-
A0A644ZS66      K--RVILIDLDLRKPSVHKYFNLSNN-------S--GLTDLLLN---KNNY----KNYI-
A0A644WQN3      K--KVILVDCDLRKPSLHKKFKISNI-------V--GLSDVMIG---KEEL----VTAM-
A0A645AV36      ER--VLVIDADLRRPTVAKLMRLEGS-------V--GLTTVLIG---EARL----EQVI-
A0A1J5SIM8      NR-TAMLVDFDLRRPKVGAYLGMHME-------K--SLNDVLNG---TDQL----PDVL-
A0A3B0VRL8      EQ-HALLVDCDLRRSSLAQMLAVNNS-------Q--GLSNYLQH---DREL----GEVI-
A0A3B1DET2      HKPKVLLVDADMRKGRIERYLGVDQK-------E--GLSDILSG---QKNI----EDVV-
A0A3B0Z1H7      DK-TVLLIDADLRQSRVNKYFGLPETM------L--GLSDYLTS---DISL----ERLL-
A0A3B1D1Y9      DH-TVLLVDADLRQPSLNDYLGIHSE-------I--GLTDCLVD---GVGI----GSAL-
A0A382PKY1      GR-KTLLVDTDLRRPVVHKVFDLDRE-------P--GVTTYLSS---ATDD----YASL-
A0A645E1K8      GQ-KVLLIDADMRRPTAKGVFEINTKVGLSEILA--GLATWENE---TEEE----PYIY-
K1ULC5          GK-KVVIMDLDLRRRT------FSKQMGHDGDTN--GVSSYLSG---STEL----QAII-
A0A0W8FVN7      Q--KVLLLDCDLRKPRVHKIFNDERY-------P--GFIDYFFG---QATF----DELI-
A0A645AJ49      K--KVLLIDVDLRRPRQHRIFKLSNK-------V--GLVDLLVS---KKQF----EEVVH
X0S5W7          K--KTLLIDGDLRRPGLTRLLDLKSK-------P--GLSDLLNA---DDEV----SDMIS
A0A644USI7      P--KTLLVDMDIRKPSVYKRLGCENN-------M--GVSNYLAN---QCTL----DEII-
A0A2P2C6F5      T--PVLLIDADLRRPQIATTFEIDGT-------V--GLTQALAG---DVDV----RDVI-
A0A0F9C030      K--RTLLIDADMRRPGLTPMLDLKGQ-------K--GLSTILRA---GLPVVQSAEANL-
A0A0F9G9C6      K--KVLIIDADMRKGYLQTQFGLKWD-------D--GLSDYLSG---QLNL----EQVI-
A0A645A3P4      P--RTLLIDMDIRKPSLYSRLGCQNT-------V--GVSNYLAN---QCTL----DEII-
A0A0F9HWF5      A--RTLLLDMDFRRPVLHKIFNVPQE-------K--GFSNMLVG---DAGV----DDVI-
A0A2H9T3X6      E--KVLLIDGDMRKGRLNHYFGVKRG-------D--GLSNILAG---TAGY----DAV--
A0A380TAR7      H--RALLIDADLRRPSVHVRLKLARE-------P--GLVDLLVG---DASL----EQVL-
                     :::* *:*                                               

A0A0F9BMP5      ---RVDE--RFGLH------VIPVVYRDAYSPDHLSRSAFAEIIRELKTRYD--YVLVDT
X0T0M9          ---KQTE--IKNLQ------VITAGATPPDPSVLISSKRMHEFIKSLEIGWD--IILFDA
K1S5Q5          ---KYSE--KYNLF------LLVSGKPVFDPSELLSTDAMSDIIKSAEKEFD--YIIIDT
A0A3B1DSI5      ---QNTE--IPNLW------CMTCGKLPPNPSELLSSSIFEQFLEVAREKYD--YVIVDT
A0A645DVL5      ---SLED--VAQQWRDTTLDVLPAGSLPPNPGELIASDAMEMLFDQFTSSYD--FVIVDA
A0A645HFS0      ---QEQI--HPDLD------IITAGQVPPNPSELLGSQNMQKLIEIVSENYN--YIFIDS
A0A3B0VG16      ---YETG--LPDLS------IMPAGLPPDNPAELIGSERMAGLLNEAVNGYVDGFVLLDC
A0A3B1CXE3      ---LRTG--IGELI------ILPGGLPPENPAELLSSERMKTLVNELKIRHGGGYVIFDS
A0A3B1CYP8      ---LRTG--IGELM------LLPGGFPPENPAELLSSERMKNLVNELKIRHRGGYVIFDS
A0A382GX28      ---QTTE--LPSLH------FIPSGKLPSSSMGILSSAKMKEFVTEMKSRYD--YVFLDA
A0A645FRE7      ---KPTS--IPHFD------LIPRGQIPPNPSELLMSERFGELIAWASSHYD--LVLIDT
A0A644YH99      ---YATS--FENVF------VLPAGTIPPNPAELLASESMRKLLADLNGTYD--YIFIDT
A0A645FLW1      ---QTVQLETTSID------VLLSGDIPPNPSELLGSRKMKELIESLSNRYD--YILVDT
A0A3B0VF49      ---QETA--VENLW------LLTAGTKPPNPADILGTPQVDQLIATLQEKAD--IILFDA
A0A644Y2V8      ---QNVH---PGLD------VITSGKIPANPTEIINSNAIKELIKKLSGQYD--YIFLDT
A0A644TLG5      ---QHTD--VEGLD------VLTSGPVAPNPSEILSSKRMDEVLEVLGREYD--YVLIDT
X1SDZ3          ---KEFHS-VDNLW------VLTSGSVPSDSSELLGSTQMRSLVEQLTKEYN--YVVFDT
A0A645BY58      ---SKNV--RPFLD------LLSSGTIAPNPSELLGSKAMEQMLKTLSEKYD--YIFIDS
A0A645GFE7      ---NK-V--EENIH------VLTPGAMPPNPTEILASKKMERFIKEVESKYD--YVFIDA
X1MSI7          ---KKADEINSNLY------YITSGPIPPNPSELLGSEKMKVVIEELKERAD--TLIFDS
J9H061          ---THES--HASLD------IIPVGTIPPNPTELLFDERLQAAIGNLKQQYD--FVLIDC
K1SQJ7          ---Q-------NLD------VLVGGENPPNPSELLGGERMKELLTTLRSRYD--CIIIDL
K1RRH4          ---MKTS--NANVD------LLPTGPTPPNPIELLASENNQKLLNELRKLYD--IIILDC
W1Y9X6          ---K--R--VGDLD------IITSGGVPSNTSILLNSQSMKDLVSKLREEYD--YVFIDS
A0A644ZTL6      ---NCTD--IKNLH------VLTCGVVPPNPSEMLASQRMKEFIENLKDNYD--YIFIDA
W1YAG3          ---KKTK--QENLY------ILTGGTIPPNPAEVLSSKKMSEFIESIKDEYD--YIFIDS
A0A645C306      ---RQSS--IPNLH------FITAGPTPINPSELILTNETDELITYLKSKYD--YIILDT
A0A0F9CMN4      ---KQSKN-IDNLW------VLTSGSVPSNPSELLGSSGMKALMEQVTKEYD--YVVFDT
A0A644ZS66      ---HNIQ---PGLD------VMTSGRVPSNTTEIIISKAIKELLKDLSENYD--YILLDT
A0A644WQN3      ---HRYN---NNLV------ILTSGKIPPNPSEMLSSKAMTTLLDALKQNFD--YIILDT
A0A645AV36      ---QPTN--DSLMD------VLASGPIPPNPAELLGLPHMQQLITEASRRYDT--VIIDA
A0A1J5SIM8      ---VNPD--VPRLV------VLPTRNAVKNSSEILSSKKIGDLITDLRERYKSRIVIFDL
A0A3B0VRL8      ---RQTG--LPKLS------LLPSGPRPMNPAELLDSKRVGEMFDELSNRYDDRFIIIDT
A0A3B1DET2      ---FHLD--TENLT------FISSGEVPENPAELLSSNKMKQFLSQTRAQFD--FVIIDT
A0A3B0Z1H7      ---INPG--IGRLI------ILPGGKLMHHSSEILSSPKMKRLVEEVKSRYESRYVIFDL
A0A3B1D1Y9      ---IKTG--IGGLV------FLPSGRKVSNPGELLSSNRMKEIVKELKHRYPDRYVIFDA
A0A382PKY1      ---IQTCE-ISNLS------IITAGIIPPNPSELLGSKRMTELVKQLENDWD--MVLFDS
A0A645E1K8      ---RSKR---RNLF------VLHSGHIPPNPAELLASKQMKNLLEKCEKEFD--YIIIDT
K1ULC5          ---RKSKL-SEKLD------IIYAGIQPPNPSEMLLSQRMEELIAELKLHYD--YIIIDS
A0A0W8FVN7      ---RKTE--QANLF------YITGGTIPPNPAEILGSHKMEEFLAKLETHFD--LIVIDS
A0A645AJ49      ---RNVN--LPGLD------ILTSGTVPITPSDLLGSRRLEEFLKTCANHYD--YILLDA
X0S5W7          DYLASTD--APNLD------VLPAGPRRQNPSELLASDRLAQIFAWAETKYD--QILVDC
A0A644USI7      ---VRPP--GAEFD------FITAGTVPPNAGELIRSDNLVEMFDELRKRYE--FIIVDT
A0A2P2C6F5      ---VGSG--MANLS------VLPAGRIPPNPSELLGSLRMKQFIDDLSQDH---LVILDA
A0A0F9C030      ---CSSL--LENLD------VIPSGPRPINPTELLVGDRFSELLCWAESRYD--QILVDS
A0A0F9G9C6      ---KPTA--VDGLS------VITRGQIPPNPSELLMHSNFSKLVAEVSAAYD--IVIVDT
A0A645A3P4      ---TRPP--DAGFD------FITAGTVPPNAGELIRSDNLIAMIRELRKKYE--FIIVDT
A0A0F9HWF5      ---THTN--VPNLD------VIPSGHIPPNPAELLSSDGIASFMDIFKSRYD--RIVIDS
A0A2H9T3X6      ----REI--NKKCY------LMTTGLLPPNPSELLMSHGFTELLENVSPLYD--IVLVDT
A0A380TAR7      ---QRDE--PTGAF------VIASGSAARDPSDLLGSKAVKAFLDQACESFD--LVVLDS
                                     :        .   :        .           :..* 

A0A0F9BMP5      PPVLAVADTGLLASHCDQTYMVVRWRKTRHAQIRDVFERLYDLDINVTGTILNFVNPK--
X0T0M9          PPAIAVTDTSLLAKEINQFIIVVKSGQTDKFAFDRAIQMLESVNAPIAGAIMNAV-----
K1S5Q5          APCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENLENSGTKLVGCIYNDT-----
A0A3B1DSI5      PPLLAVTDPSTVAARVDAVLITLKLKKNSRTMATRAREMLTAVNANLIGIVVNGAGHL--
A0A645DVL5      PPVNPVTDPVLINRLVGGILMVVRLNQTGKRELTQALRSLATVDIKVSGFALNGL-----
A0A645HFS0      PPVNIVTDALVLARYAAGLIMCTRYRQSTHDELRRAVASVEFANAKILGMIVCDVKDV--
A0A3B0VG16      PPFQAVSESAVLAQLVDKVVLVVRWGRAGRENVKKLVEQIG--RDKIIGIVFN-------
A0A3B1CXE3      SPVLLTSDPLSLGSLMDGVIFIIHAALTSEKSAAQAISLIK--GCNILGIVFNDVQ----
A0A3B1CYP8      SPVLLTSDPLSLGSLMDGVLFIIHAALTSEKSASQAISLIK--GCNILGIVFNEVQ----
A0A382GX28      PPIMGVSDASVLASMVDMCVLVVQYRKYPQMMTQRAKEMVTKVGGELVGVVLNNINIS--
A0A645FRE7      PPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRR--
A0A644YH99      PPVDVVTDAAVLASRLHGLILVARQGYSRKEIMQSAVAALEQAGVNILGILLNDVNME--
A0A645FLW1      PPVGVVTDAVIVSSLFTGMIFVIRASRTQQDAVHSALSQLKFAGANVLGFVLNGVNAK--
A0A3B0VF49      PPVNVVTDAAVLGAKVDGVLLVLSAGKTRREHAERAKEILKKARVNIIGATLTNAPTD--
A0A644Y2V8      PPLVLVSDPLTIATYADAVILTIAHSETEKEVIRRSIDSLKQVNANIIGTILNKMPVS--
A0A644TLG5      PPILPVTDAAVMAAKVDGVIMLTAWGNINPEVARDAKARLVQAGANIIGVILNKVEVN--
X1SDZ3          PPLMSVSDTAVLASQVDGVLMIIRPGKLRREMARRTKELLNRVGTPVLGCVLNGVEPR--
A0A645BY58      PPINIVSDALVASVNATGIVMVVRPEICTHEHFKHATESIKLANIKLLGVVMSNVKED--
A0A645GFE7      PPVGIVSDGIIISKYTDGVMFVVGANETDINHTKEVIDNMRKSDVNIIGSILNKYDME--
X1MSI7          APVIGFADSLVLANQVDGVVLILNAGMVTRDAAKQAKALLEKAKAKILGVVLNNVDIK--
J9H061          PPIELVADTQIIEKLAHRTIFVVRAGLLERSMLPELEHIYQEKKYKNMSLILNATEGS--
K1SQJ7          PPVGIVTDALLLSYEVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPK--
K1RRH4          PPVIGLSDTMIMTKFSDANIIVVSNKKTKIESLDRAKKIFAQANAKITGVVINKASVK--
W1Y9X6          PPICRLNDACIITQYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAE--
A0A644ZTL6      PPIGIVTDAGVISSYSDGCILVIGANETDIETAKLAKERLDSVGAKIIGTVLNKFAVK--
W1YAG3          PPVGVVSDASIISAYSDGVIFVVGANEVDSNLAKIAKERLDNVKANIVGVILNKFKTD--
A0A645C306      PPIGLVSDAMKPLQYADYPIYVIRANYSKRSYIYNIEKLYHENNLRFMSIILNNVDPEIT
A0A0F9CMN4      PPLISVSDGAILASQADGILMVVSPGKVKGEIGRHTKELLERIGTPVLGCVFNGVELS--
A0A644ZS66      PPIMLVSDPVNIAIYSDAVILAIAYAETDKETIKKTIDILKQVNANIIGTVLNKVPQN--
A0A644WQN3      PPVQAVTDSQILATKADGAILVVRAERTKKDSVQNAISLLKKVNANIIGTVLNGLDNS--
A0A645AV36      PPLLPVTDAAVLSRVADGTLVVVGSGVARRPELEKALEKLEMVDARVLGLLLTRVR----
A0A1J5SIM8      PPLLVTDDAIALLPKIDCVLLVVANGMSTKREIEDSLRLLP--AENLIGTILNKAD----
A0A3B0VRL8      PPLPMAAETTVLAEQVDGIIIVVRWGRAAREQVKQMTENLN--KDKIIGVLYNAFE----
A0A3B1DET2      PPIIAVTDSGIIGAQADGIIMVVQAGRTQRGIVRRAQELLYQSHSKVLGQVLTNIE----
A0A3B0Z1H7      PPMLASDDAMGFAPLVDATLLVVEDGVANIDELKSSIELLED--ANLIGTVLNKSR----
A0A3B1D1Y9      PPVLPFAEVLSVGALLDGIIFVVREGVTPEDNMKDAVTMLKD--NNILGVVYNAAE----
A0A382PKY1      PPMIAVTDATMISKEIDQVVLIVKVGQTDKKAFHHTINNLRNINAPLGGIIMNAVT----
A0A645E1K8      PPISVVTDAAVLANVVNGYVIVVRAGVTPKDSLSESVLRLEQLGANIIGFILNDVDPK--
K1ULC5          TPAMAVADAIITDRLADLSIYVVREGLLDRRQLPDIERLYREKKFHNMAIILNGAS----
A0A0W8FVN7      PPIIAVTDSEILSQIVDGVMLVISAGVTEYDILYKSLDVLKMAKSQFLGAVLNKFA----
A0A645AJ49      PPALGIADPMILGKLTDTTILICDCREANVDKLAGVTERLRQADVRLGGLVLNRFSLM--
X0S5W7          PPTLVASDAVLVGRIVDGMVLIVRPDKNRRKLVFRATQNLTEMKIPLLGLVANGVGAE--
A0A644USI7      SPIGVVADAYSFASMSDINLFVIRSNKTNKLFLRNLSNQLKADDVTNFYSVLNDVEVD--
A0A2P2C6F5      PPLLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVK--
A0A0F9C030      PPAL-VSDTAIIGRLVDGVLLTVQPHKNRRRTVIRAAESFSNLGINVLGIVINRLATE--
A0A0F9G9C6      PPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNGTDVKGVVFNGVIKK--
A0A645A3P4      SPIGIVADAYSFASLSDINLFVIRSGKTNKNFVKNLSAQLKADNISHFYSILNDVQVE--
A0A0F9HWF5      PPILSATDPVIISTFVDEVLMVIKMGETSRELVQTAIGKLHHVKANLIGTVLNGVDTG--
A0A2H9T3X6      PPILAVTDAAIIGRKCGRTFMVTRAEKNTASEISYAAKRLQQAKVNVKGCILNGMVYT--
A0A380TAR7      SPLMSVSDACNLAPLAEETVFVIQWGKTGREVVKLALEKLTETQGVPRGIVLSRVDTA--
                .*     :                                                    

A0A0F9BMP5      ------------------KEANYRGIPYASYNEYRHV-----------------------
X0T0M9          ---------------SPKTSYESYYYYHEYYHYYGKDKNK--------------------
K1S5Q5          --------ESGMPKRFMSSYNKKYGYGYGYGYGYGSNQK---------------------
A0A3B1DSI5      -----EHYSYGYTGYGSSSYEQGY---YGYDYAYSVKNDHNTTQPLPVMYDSQKKGHLQE
A0A645DVL5      -----------------PNEGSDY---YGHYHTEPGEQANGRSR--------KRRASRST
A0A645HFS0      ----------------GGGYYRKSYKSYKSYE----------------------------
A0A3B0VG16      ------------------------SFEMNILDRKMQDVGYHNYYSERY------------
A0A3B1CXE3      ------------------NYPAKDPYPYYSADEAQSGQG---------------------
A0A3B1CYP8      ------------------NYPAKDPYPYNFPEDKDAGRIAGKTKTQGA------------
A0A382GX28      ------------------QDSYYYYYSGYYYDNYYKSREKEGSAEDDTKSRKKTKLLASA
A0A645FRE7      ------------------ASGYQDYGYYEYEYTSDSK-----------------------
A0A644YH99      --------------KYSGRYRYNRYSKYNQYNRYSYSDSEHKTEEEA-------------
A0A645FLW1      ------------------GNRR--YSSYRSYKEAAAR-----------------------
A0A3B0VF49      ------------------SSMEAYYG----------------------------------
A0A644Y2V8      ------------------KHNKYYYSYY--------------------------------
A0A644TLG5      ----------TPGNSYGYGYGYGYYYYYGSGEGKEDGEKKHRHSKEK-------------
X1SDZ3          ------------------DSSY--YYYYHSYAGAEG------------------------
A0A645BY58      ------------------NLGFKYKRKYYSYRKYKN------------------------
A0A645GFE7      ------------------NNAYGYYGYYYQQDDGRNGRGAKKKKKNGLFRKKK-------
X1MSI7          ------------------REGYYHYYHYYNYSKYYNTEE---------------------
J9H061          ------------------GGRY--GYRYGYHYGYGNGYHYGNSTKTN-------------
K1SQJ7          ------------------SKD-----CNYRLQQYWQEYKQQNGEAV--------------
K1RRH4          ------------------GSSY--YSYYSDE--YYRDTDSKKKRKR--------------
W1Y9X6          ------------------KYSY--YSNYYGYSNYYGEHKHKLFGRKKKRRRKTS------
A0A644ZTL6      ------------------TNGH----DYYAY--YYQGRKSKKSNRKMNKKEKSMA-----
W1YAG3          ------------------TNS-----EYYNY--YYNENK---------------------
A0A645C306      GAGSSQGFAYGYGYGYGYNNSR--HGYYDSEDSVKKSWREKLRDRFRRKK----------
A0A0F9CMN4      ------------------HRNY--YYYYNYYRYYAGSAGEKKVGKREKKESNVLD-----
A0A644ZS66      ------------------KKNK--YYYYY-------------------------------
A0A644WQN3      ------------------RNKY--YYYYGEK-----------------------------
A0A645AV36      -----------------G--GDAGAYHYEYVYGQDGQSSSRTSRDKNAPAPISSARARTG
A0A1J5SIM8      --------------------VEPKAYYYD-------------------------------
A0A3B0VRL8      -----------------KYILRAKLTCYE-------------------------------
A0A3B1DET2      --------------------YHLPEYIYRYL-----------------------------
A0A3B0Z1H7      --------------------EPVKDYYYGKY-----------------------------
A0A3B1D1Y9      -----------TVPLSDY-------YNYSHYYQNR-------------------------
A0A382PKY1      -------------SKSSYGSYYYYYYQYYHYYGSEKESD---------------------
A0A645E1K8      -----TSLYKHSSGRYKYGSSKYHKYGYGGYDDVQEDSE---------------------
K1ULC5          -----------STKRHGYGYGYGYGYGYG--LDEEETTT---------------------
A0A0W8FVN7      -----------------------YRPGYGSYYKYYYYYYNTGNGKEDKKKLLKV------
A0A645AJ49      ------------------NKSDYYYYYQHYYYGYHYSYTAEPGSSDEFAIIPDEPEGGNE
X0S5W7          ------------------NNKG-YSFGEGEGYGYGYGYGDDENNDEDEGEIEQQGNGDSY
A0A644USI7      ------------------SGSYSQYYSRKYAYGRNKSYGVGAYGYGYGYGYGYTSGSGKN
A0A2P2C6F5      ------------------GASAIAYGGGYSGYGGYGGYR---AEEATREAYSTAGKGRRR
A0A0F9C030      ------------------KSDDYYGYGYGYGYGYGSGY-----------GYGHDDEPQSD
A0A0F9G9C6      ------------------ASNAYGYYGY---------Y-----------NYEYKSNEKS-
A0A645A3P4      ------------------TNSYSQYYSKRYAYGSSKQYG---YSYGYGYGYGYTASGRKK
A0A0F9HWF5      ------------------Q---GNYYQYQY-YGDRQPET---EQGVFGRLRKPFLMRK--
A0A2H9T3X6      ------------------S---SCYGQYGY-Y------H---YKYGSES-----------
A0A380TAR7      ------------------KIRLYGYGDAAY-YDRTVREY---YTRGSA------------
                                                                            

A0A0F9BMP5      ---------------------------
X0T0M9          ---------------------------
K1S5Q5          ---------------------------
A0A3B1DSI5      ALYQNENNDDV----------------
A0A645DVL5      SKRTSSHVDAA----------------
A0A645HFS0      ---------------------------
A0A3B0VG16      ---------------------------
A0A3B1CXE3      ---------------------------
A0A3B1CYP8      ---------------------------
A0A382GX28      KTGEEDEKPKY----------------
A0A645FRE7      ---------------------------
A0A644YH99      ---------------------------
A0A645FLW1      ---------------------------
A0A3B0VF49      ---------------------------
A0A644Y2V8      ---------------------------
A0A644TLG5      ---------------------------
X1SDZ3          ---------------------------
A0A645BY58      ---------------------------
A0A645GFE7      ---------------------------
X1MSI7          ---------------------------
J9H061          ---------------------------
K1SQJ7          ---------------------------
K1RRH4          ---------------------------
W1Y9X6          ---------------------------
A0A644ZTL6      ---------------------------
W1YAG3          ---------------------------
A0A645C306      ---------------------------
A0A0F9CMN4      ---------------------------
A0A644ZS66      ---------------------------
A0A644WQN3      ---------------------------
A0A645AV36      RRPTRAIQPVQ----------------
A0A1J5SIM8      ---------------------------
A0A3B0VRL8      ---------------------------
A0A3B1DET2      ---------------------------
A0A3B0Z1H7      ---------------------------
A0A3B1D1Y9      ---------------------------
A0A382PKY1      ---------------------------
A0A645E1K8      ---------------------------
K1ULC5          ---------------------------
A0A0W8FVN7      ---------------------------
A0A645AJ49      PSQS-----------------------
X0S5W7          QGISFQSKTSDQSENDQENLPANFRKT
A0A644USI7      KGKSSDSYYQYYQDDAKDI--------
A0A2P2C6F5      KLVKSSSDKD-----------------
A0A0F9C030      AGLSEGSTDDMPMEIVRRVA-------
A0A0F9G9C6      ---------------------------
A0A645A3P4      KKDESDTYFQYYQDDEKEI--------
A0A0F9HWF5      ---------------------------
A0A2H9T3X6      ---------------------------
A0A380TAR7      ---------------------------
                                           

© 1998-2020Legal notice