BYKdb

Dataset for cluster orphancd of phylum metagenomes

[Download (right click)] [Edit] [Sequences] [Repertoires]

62 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A644USI7      ----------MEETKKNIDKQVFQEEESSFDIMEWVMHFVSHWYLFLVGLAVTMSLAYMQ
A0A0W8FVN7      ------------------------------------------------------------
A0A645A3P4      ------------------------------------------------------------
A0A0F9HWF5      ------------------------------------------------------------
A0A2H9T3X6      MIGRAVARRF----------------SPDAEAGELINTPWLWFSGYGWGGEALKIERFEM
A0A6J7K3N0      --------------------------MRPADYLRIIRRRWWVL---------LVTVVIAM
A0A6J7J287      MSTPETPQDFSRANSSPNQPDLFGSSTALRHYAAVVRRRWRWI---------AAGLVLGM
A0A380TAR7      --------------------------MAERDEFTSSRSRSLLE---------IASRAAAL
A0A6J7CDW0      --------------------------MRPADYLRIIRRRWWVL---------LVTVVIAM
A0A6J6XKV0      ------------------------------------------------------------
A0A6J7P7J4      ------------------------------------------------------------
A0A6J7JYF0      ------------------------------------------------------------
A0A0F9G9C6      -----------------------------------------------NTILDLQAAIGAS
A0A0F9C030      ------------------------------------------------------------
A0A6J6AB74      ------------------------------------------MHVPMEPQLTPARTLGD-
A0A6J7HIX3      -----------------------------------------------------MSSFSDP
A0A2P2C6F5      ------------------------------------------------------MTFGD-
A0A6J7K0P4      ------------------------------------------------------MTFGD-
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      NRKWLPEFKSGGTVIIDESRSMMNSAQVLMQGFGIQESYRNVNNQVIMIGSYDLMGRVVD
A0A0W8FVN7      ------------------------------------------------------------
A0A645A3P4      -----------------------------------------MEGSSVLE-----------
A0A0F9HWF5      ---------------------------IVITSFLKRFDVKPVRNTQIAV-----------
A0A2H9T3X6      HSSLLDQPYTLVAGENGHYQLWLD--DRMILTGKVGEAAQSKDQQLRLF-----------
A0A6J7K3N0      TFVMLMRPSSSDAVERNKPGLSFKATATLINNF-GDTSVRGRDYDRLAL-----------
A0A6J7J287      VGGLISTVIATST---APKSSYFKATNTIV-------EADGSGTANLSQ-----------
A0A380TAR7      GGKDETNPGSADRQALAAQAARAASLDEVVDEFLKHLDVRPTKASRVIS-----------
A0A6J7CDW0      TFALLTRPSSSETIRANRPGVSFRATTTLISNGSANTSVNGRDYDRLAL-----------
A0A6J6XKV0      ------MDLAAHFRIIARAWKQILIAGVLVAVAM--FFWSNKADRVYEA-----------
A0A6J7P7J4      ------MDLAAHFRIIARAWKQILIAGVLVAVAM--FFWSNKADRVYEA-----------
A0A6J7JYF0      ------MDLAAHFRIIARAWKQILIAGVLVAVAM--FFWSNRAERVYEA-----------
A0A0F9G9C6      EKGKDSGIINLSLQSEKPHYAEKVLDKVAGIYVRRNVERNSAE-----------------
A0A0F9C030      -----------------QQHAFAMVDTIGREVLLRQLGLKTADPYASSR-----------
A0A6J6AB74      ------------YLSAVWRRKYLALSTTVLCACL-AAGWSVTQTSVYRA-----------
A0A6J7HIX3      ETPDASDRALWPLLAALRTRWWLVVGLVVLAGVT-AAFAVRAKAPSYTA-----------
A0A2P2C6F5      ------------FVRLTRAYVWVLIGCTVLGALL-MMAKTTRDPVLYSA-----------
A0A6J7K0P4      ------------FVRLSRAYVWVLIGCTILGALL-MIGKTTRDPVLYSA-----------
A0A645AJ49      ---------MAKLRSYQLLTAQLTVGNLLMPDFQTLLNSNRVRKKISVA-----------
X0S5W7          -----------------------QLAPLLLQMAQQGLDKSKQKESILQA-----------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      SLPHFQTEYISKGRFRTRNLYDWSPILIEPDYIAPEAYGMLFKINIHIDGTFTITSEDER
A0A0W8FVN7      ------------------------------------------------------------
A0A645A3P4      ------------------------------------------------------------
A0A0F9HWF5      ------------------------------------------------------------
A0A2H9T3X6      ------------------------------------------------------------
A0A6J7K3N0      ------------------------------------------------------------
A0A6J7J287      ------------------------------------------------------------
A0A380TAR7      ------------------------------------------------------------
A0A6J7CDW0      ------------------------------------------------------------
A0A6J6XKV0      ------------------------------------------------------------
A0A6J7P7J4      ------------------------------------------------------------
A0A6J7JYF0      ------------------------------------------------------------
A0A0F9G9C6      ------------------------------------------------------------
A0A0F9C030      ------------------------------------------------------------
A0A6J6AB74      ------------------------------------------------------------
A0A6J7HIX3      ------------------------------------------------------------
A0A2P2C6F5      ------------------------------------------------------------
A0A6J7K0P4      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      LSKSFSINGRLGQLTQHQLMFITVNDVNGDITEEELYFRFRTKVSLIDEFSSRLRLNFVN
A0A0W8FVN7      ------------------------------------------------------------
A0A645A3P4      ------------------------------------------------------------
A0A0F9HWF5      ------------------------------------------------------------
A0A2H9T3X6      ------------------------------------------------------------
A0A6J7K3N0      ------------------------------------------------------------
A0A6J7J287      ------------------------------------------------------------
A0A380TAR7      ------------------------------------------------------------
A0A6J7CDW0      ------------------------------------------------------------
A0A6J6XKV0      ------------------------------------------------------------
A0A6J7P7J4      ------------------------------------------------------------
A0A6J7JYF0      ------------------------------------------------------------
A0A0F9G9C6      ------------------------------------------------------------
A0A0F9C030      ------------------------------------------------------------
A0A6J6AB74      ------------------------------------------------------------
A0A6J7HIX3      ------------------------------------------------------------
A0A2P2C6F5      ------------------------------------------------------------
A0A6J7K0P4      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      EGSSVLEISLVSQTPQRDVDFINKLCEIYLISNLERKNDAATKTINFIDEQLENVSKSLA
A0A0W8FVN7      ------------------------------------------------------------
A0A645A3P4      -------IALSSETPHRDVDFINKLCDIYLISNLERKNDAATKTINFIDEQLVNVSKSLS
A0A0F9HWF5      -------VSFNSKSPEMAARVANAAVQAYVDYTLTTKIKANVGASGVLRKNIQEQRKKIE
A0A2H9T3X6      -------VSLLQARPGTRFNVTDQLLVSTVNQLSQRLSVSEKGK----KTGVLSLSLTGP
A0A6J7K3N0      -------LMTTGEVPQRVADAIDKV------RWPQIQAAESAACA---TTGERSKSSNCP
A0A6J7J287      -------VAFLLQSAEVQGQIATAM-----------------------------------
A0A380TAR7      -------VRFQSRDAQLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVA
A0A6J7CDW0      -------LMTTGEVPKRVAEAIDEV------RWPQIQSATANKCA---ETGADSSSPDCK
A0A6J6XKV0      -------TSLLAVTPSDT-----------GLGINADQATFLAKSYALYAETPRVTAEAAK
A0A6J7P7J4      -------TSLLAVTPSDT-----------GLGINADQATFLAKSYALYAETPRVTAEAAK
A0A6J7JYF0      -------TALLAVTPSDT-----------GLGINADQATFLAKSYALYAETPRVTAAAAK
A0A0F9G9C6      ----------------AQKSLEFLEVQLPEIKKQLEFAEQRFNDYQIQRQSINITLETQG
A0A0F9C030      -------INQQLIDDRGKLQAKLLLYGSAHQEVRTLQQRISLAEHFLQNQRFQDAEQARQ
A0A6J6AB74      -------STEVVID--VSRNTSLFG--PVAGAGDARRRLLNE---IAIVTGVEVRLGVQQ
A0A6J7HIX3      -------EAQVLVTPFAGEDSTLSGVRLLRNSGDPTRDVETA---ITLLRGAGTDDTTAR
A0A2P2C6F5      -------TSSGLVV--VG-NATTAG----EEQGNAALAEEKAGLYAFLVSSMPVAEKVVD
A0A6J7K0P4      -------TSSGLVR--VGTNVQSAG----EEQGNATLAEDKANLYAFLVSTTPVAEQVVE
A0A645AJ49      -------LKEIFGTDSTPAY----------------------------------------
X0S5W7          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          -------DIKNWVSIEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESAINAAFPSTTL
A0A3B1DSI5      ----------------------------------------------------QVSPNFTR
A0A645DVL5      ------------------------MGGPFTSLGPSGTRINVITVSPAGVPGTPVSPNTSM
A0A6J6WIY0      ------------------MVLQKQLSDLPALDPQAASIQANIDALNQVEAERRAQPANRV
A0A6J6AVD8      ------------------------------------------------MPTAPYAPKMLN
X0T0M9          ----------------------------------------------AISPLNRTSPNTKV
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      ISEDDLTSFRKRNQIIDVGSLSGEL-----LTKATAYDNELNQIRLKETYLSYLDKYIRT
A0A0W8FVN7      -------------------------------------------MNEQILVYKAGIFASNP
A0A645A3P4      ASEDNLTDFRRRNQIIDVGSLSNELMSKATAYDNELNQVR-----LKETYLDYLSKYIKT
A0A0F9HWF5      ESEKLLFEYKEKFKIISLEEEKNITIQKLAAHSKNLVSAENVRIEAQSKYQVAVGMLVDG
A0A2H9T3X6      SRPENSRLLEA---IIQRYVRQNIERVSAEAQNSLKFLERQLPE-MKKDVELAESKLHRF
A0A6J7K3N0      RSRRPVKAGTS---VVSLGYQGFIK-------------ASAVPDPATGSLAITA------
A0A6J7J287      --NLPVETLRG---LIAAQDQSNVSAIDVTAISTDPQFAVTLAD-TSAKILMDSWSTDSK
A0A380TAR7      RSEKAVEAFRT---QSGLLRGSQVTLISEEISEINRRLAAASADRAQATATLNEVQALQK
A0A6J7CDW0      KSGRPVSAGSG---QVQLGTGGFIK-------------ASATPDPATGSLAITA------
A0A6J6XKV0      SSGLNITA----------------------NDAASLISASAVGDLGFLEVYAKGPSVSDA
A0A6J7P7J4      SSGLNITA----------------------NDAASLISASAVGDLGFLEVYAKGPSVSDA
A0A6J7JYF0      SSGLNITA----------------------NDAASLISASAVGDLGFLEVYAKGPSVSEA
A0A0F9G9C6      VLEQVVKL-----------ETKLQELELKRLELGRKFKKDHPTYQGIIEQIAAVNEQKKA
A0A0F9C030      IIQQELGPALFDMARQQCDEAVASE-----RAISAAYEEEKQAAVSLYGTLAELQIIERD
A0A6J6AB74      QLHLSSPPPRAKFNTSTTSDVVTFFVESPDAQLAADVANAYIEQYNIYTAKISADTLAGA
A0A6J7HIX3      VLGRGTTR----------------------KDVRERVALEAIGGGSVVAVRGTAASEAEA
A0A2P2C6F5      DLDLDVPP----------------------SEIAGRFSATVNADVNALTITAIGSTPEQA
A0A6J7K0P4      DLDLAIPP----------------------SAIAGRFSASVDAEVNSLTVSAVGSTPEEA
A0A645AJ49      ------------------------------TLSARPLPKTRFVEIAVQSKS---------
X0S5W7          -----------------------------------SLDEARFEAVTHQRDTSHITMLEQN
A0A3B0VG16      ---------------------------------------MGKVSRALDKAGAPIKPDENS
A0A3B1CXE3      ---------------------------------------MSRIERAMEKAAKIRISAE--
A0A3B1CYP8      ---------------------------------------MSRIERAMEKAARIRGSAE--
A0A382GX28      ------------------------------------------------------------
K1S5Q5          TVIDPPLLASAPDRDASAKIYTIVGFAAGLVISIFAI---VLAVIAKDTVKTADDVKDKL
A0A3B1DSI5      MMTIG--------------------GLLGFLVGAGFA---FLRETFDKRFSAPEDIQQQL
A0A645DVL5      NLLLA--------------------LLAGMGLGVGMI---LLQHFLDTR------IRSEA
A0A6J6WIY0      NVAAGAHAHSTPISPHPTRSAVVAFLLTCILVGELIVASRAIGDRIGRTGDDDADVARIT
A0A6J6AVD8      NVAIA--------------------LVLGLLLGAAMA---LLFENLDTSLRSEEELKTVS
X0T0M9          NLAVG--------------------LLLGLGLGALAA---FLIEQTDNSIKNVSDIER-K
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ---------------------------------------LVFLIEYLDTSLRTIEDVEKY
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ---------------------------------------MERIKQAILRAKNHQSSEANL
A0A3B0VRL8      ---------------------------------------MGKVFKALNKAMSNPDDSASP
A0A3B1DET2      ------------------------------------------MGKITSALKKAAEERINR
A0A3B0Z1H7      ---------------------------------------------MSDQKVDVIPARRMP
A0A3B1D1Y9      ---------------------------------------MSRIEEILEKAARMREGEKNG
A0A382PKY1      ---------------------------------------NLSVLGIIPSIGNPDKKRR--
A0A645E1K8      --------------------------------------------MLWKKNKNDATERRTN
K1ULC5          ------------------------------------------------MLDTTIRGRKDI
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      NLSEGTIVAPTSLGLNEPMLMSLVQQINDLIIKRSELSEKNMFYAKYTRDIENVKVAINE
A0A0W8FVN7      AQIQQLTAKVLEEEVRYQSLLSSHKELDELVQRYEVRFNEMPKRTLDLARLQRIKEANEK
A0A645A3P4      NLDEGAIVAPTNLGLNEPMLMSLVEQINQLILKRGELTEKNMFYGKYTQDINNVKQAINE
A0A0F9HWF5      DLAGSIPE-VMSNGFITKLKTDEAVLREQLSEISRKYGSKHPKVIALNDKISTVRGMIDD
A0A2H9T3X6      QQENQTVDLTMETQAVLDQAVTIDTQLAKLDMQIEQMSQR---YTANHPVMEELQLQRQL
A0A6J7K3N0      ----QVGDAKLAAKVANLFAEKLIAYVDELGQN--EYYERIFTLTVSRNNAETLLREIDL
A0A6J7J287      RRAAESSDAVIAR-------------IDELAAKRDELESQ---IARNPSQATLLRAELDS
A0A380TAR7      ASNIEAAQAIMESPVVQQLRIQEAAVLRELAELSIELGERHPRVINKKSELEKFRAKIEA
A0A6J7CDW0      ----QVGDAVLAAKVANLFAATLVGYVDELGQK--QFDEQIFGLTLSRSNSETLIRQIDS
A0A6J6XKV0      EQLASAATVALIDAVRAQQTASLAQDIAPIQAQRVVLQKQLSDLPALDPQAASIQANIDA
A0A6J7P7J4      EQLASAATVALIDAVRAQQAASLAQDIAPIQAQRVILQKQLSALPALDPQAASIQANIDA
A0A6J7JYF0      EQLSSAATVALIDAVRAQQTASLAQDIAPIQAQRVILQKQLSNLPAFDPQAASIQANIDA
A0A0F9G9C6      L--------------VGEVGNLPETQQELLRLRR-------------DVEVSNQIYTLLL
A0A0F9C030      LEHLHAFHETLLDRVKDL------------------------------------------
A0A6J6AB74      VDSLQQQIDDLQKQIETLDHSIAASGNDDDSTRE-------------AQRRELLAQQADF
A0A6J7HIX3      VRLTQTYIDVALGARNALVEAGARRALTALDSRT-------------DPGLPTIRRQL--
A0A2P2C6F5      RDLA-----------NGVVDAVVEYAQEVDTGES-------------NPKRDPLTRVV--
A0A6J7K0P4      RDLA-----------NAVVEAVVVVAQQIETGEE-------------NPREEPLTRII--
A0A645AJ49      ----RNQTPVIIEKTVEIFT----------------------------------------
X0S5W7          VLRLRRLHDAIIDQIAGVDL----------------------------------------
A0A3B0VG16      FIPADVTPGSRDAVVERKKVPG--------------------------------------
A0A3B1CXE3      ----------RSPSVDKP--PA--------------------------------------
A0A3B1CYP8      ----------RSPAVDSPAAPV--------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          GVDVIGMVAHVNRKKKKKGEEY--------------------------------------
A0A3B1DSI5      GVPVIGHVPNISIKRRKKNALS--------------------------------------
A0A645DVL5      HLSAISHLPVLARLRQIRDPQT--------------------------------------
A0A6J6WIY0      GLPVLGRIP---------------------------------------------------
A0A6J6AVD8      GLDVLAVIP---------------------------------------------------
X0T0M9          GINVLGIIPDISKSKSATKKRN--------------------------------------
A0A645FRE7      ------------------MKRY--------------------------------------
A0A644YH99      -----------MINLKTPNNRK--------------------------------------
A0A645FLW1      ----MSFRLFGGKADHAVQNIK--------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          LPWPVLGIIPRFEQAFEGKIPH--------------------------------------
A0A645BY58      -------------MARQRKRDR--------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------MPNK--------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------IPQIQAPDRK--------------------------------------
K1RRH4          ---------------------M--------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ----------MLNLDIRSERDV--------------------------------------
A0A1J5SIM8      AQLRPDGQGKSFKSNISKSQDE--------------------------------------
A0A3B0VRL8      PASTPEPSIKTERQPTPAKRET--------------------------------------
A0A3B1DET2      IDKITKIQERDQMVIKKIGESN--------------------------------------
A0A3B0Z1H7      EDDLSGVRYKQTKPIKISKSQL--------------------------------------
A0A3B1D1Y9      EKSRKISPPGSKVPGVVRQARI--------------------------------------
A0A382PKY1      ----RWLMAKNRSTSNTRGLR---------------------------------------
A0A645E1K8      QQSIKQKMLGKKSSFAA-------------------------------------------
K1ULC5          EDNLAVPFLGDIPQYSGEKQR---------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      VV-------RNMQTSNDLQKQDLNRRLADVQRQIQNLPEKELEMI-----GIERNYRMND
A0A0W8FVN7      LY----------------------------------------------------------
A0A645A3P4      VV-------RNMQTSNHIQKKDLDRRLGEVQKEIQQLPEKELEMI-----GIERNYRMND
A0A0F9HWF5      EIFRVVDSMKSQYDVALRNELALKGELVRLKEESQSLGKHAVAYS-----VLARDVYTNK
A0A2H9T3X6      IVDRQDKFSDQARGLPKTQQEVMRLA-------------RDVQVSTEVYTELLNKAQELK
A0A6J7K3N0      KM--------ATPLLSASEYDSLGIR-------------REATLR-----KLANSDYE--
A0A6J7J287      VI--------NQYRLAREQFQSIAVS------------DQTVAAF-----TVFQPAIAVQ
A0A380TAR7      EMERVLKGYATAVSVATAREDSLERELNKLKSKQALANSREIELR-----ELEREAEANR
A0A6J7CDW0      QL--------AAPGLSASEYDSLDIR-------------REAVLR-----KLANADSG--
A0A6J6XKV0      LN----------------------------------------------------------
A0A6J7P7J4      LN----------------------------------------------------------
A0A6J7JYF0      LN----------------------------------------------------------
A0A0F9G9C6      SK----------------------------------------------------------
A0A0F9C030      ------------------------------------------------------------
A0A6J6AB74      RH----------------------------------------------------------
A0A6J7HIX3      ------------------------------------------------------------
A0A2P2C6F5      ------------------------------------------------------------
A0A6J7K0P4      ------------------------------------------------------------
A0A645AJ49      ------------------------------------------------------------
X0S5W7          ------------------------------------------------------------
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      SYYTMFLQKRAEAQILKASNTPDNNILDRARTTSVTNQGAKSKTTMILLL---LGVLLPA
A0A0W8FVN7      ------LLVEEKYQEAQINEQSTPGNVLIIDAARQPENPSKPNRILIIAVGLVLGLGFGF
A0A645A3P4      SYYTMFLQKRAEAQILKASNTPDNNILDRARTTTVTNSGDKSKTTITFLI---LGLLLPA
A0A0F9HWF5      EMYEVLLKRLKET-SITGGMQTTNVRVLDEAIPPTIPFR--PRRMLNILLAIVLGLFMGP
A0A2H9T3X6      IVKASAVGNVRILDHALSGITPVK-----------------PKKPLIFVLAVLLGGMCGT
A0A6J7K3N0      ------ISDIQEAGPQTSGLVTLESASRESTTVLVTQAKGSSSESTGLLYGAAFGFIIGL
A0A6J7J287      INGRAFAIRYDANLNSRGSISATQSVPKLTFSETDLTVVSGSSRAVRILIGGLVGLILGI
A0A380TAR7      KLLETFLTRLKETTPQLD--TEMQVPGATVLSPAAVPLRSLPDKRIVLAVATIIALLLGL
A0A6J7CDW0      ------ISNLEDAGPQTSGLTTLEAATKARATILVTSAKGSTSESQRLLFGAAIGFIIGL
A0A6J6XKV0      -----------QVE--AERRAQPANRVNVAAGAHAHSTPISPHPTRSAVVAFLLTCILVG
A0A6J7P7J4      -----------QVE--AERRAQPANRVNVAAGAHAHSTPISPHPTRSAVVAFLLTCILVG
A0A6J7JYF0      -----------KVE--AERRAQPANRVNVAASAHASSTPISPHPTRSAVVAFLLTCILVG
A0A0F9G9C6      -----------TQELDIVRAGTVGNVRIIDYAEVNTSKPVKPKKALIVVMTTMLGGMLAV
A0A0F9C030      ----------------NLGQDKGIIRTSILTPPKTPGGPVWPNLSMIAMFSIAIGFGMGL
A0A6J6AB74      -----------TLEQQQIDARLDTPGAKVVHPAETPGTPVRPTPIATTGLGLAIGALLGV
A0A6J7HIX3      ----------------RVWRDQGDPTFSIAQRATAPDGPDGPADWLVVLGAMVAGGLLAV
A0A2P2C6F5      ----------------PV------------QPAQLPGAPFTPDYVKAAMKGAAGGLALAY
A0A6J7K0P4      ----------------PL------------EQAQLPGAPFTPDYRNAAMKGAIGGLALAY
A0A645AJ49      ----------------QEARSLLGINNTQSIDISASAIKVAPKIPLYTIVGLLLGLLVGG
X0S5W7          ----------------RQGHG--EIQATIIKDATASGQIVSPKISRIIACWILGTLGIGF
A0A3B0VG16      ------------------------------------------------------------
A0A3B1CXE3      ------------------------------------------------------------
A0A3B1CYP8      ------------------------------------------------------------
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ------------------------------------------------------------
A0A3B1DSI5      ------------------------------------------------------------
A0A645DVL5      ------------------------------------------------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      ------------------------------------------------------------
X0T0M9          ------------------------------------------------------------
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      GYVVLKELMNNAV-RTTK---DVDRYCVFPLIGLV----RHTN-----------------
A0A0W8FVN7      GFAFVRNYFDNTV-KTPE---ELQQK-NISLLAWI----PEMF----------VADKNRA
A0A645A3P4      AFVVLKELLNNTI-HSNK---DVERYCSFPLIGMV----RHTS-----SE----------
A0A0F9HWF5      VVAISFEYMDSSV-KTPE---DIERYLRVPYLGPL----PDFH-----GQ---ESERAGG
A0A2H9T3X6      GFVFLRDMLRQGV-KTPE---EIEAKTGLSVFATI----PQSE-----QNLLLERNARKQ
A0A6J7K3N0      GILLLLEILSARI-RDVP---GTEGAARMPVIAEI----PVMN-----LD--------KS
A0A6J7J287      ATAFVLEVWDDRI-RRRD---GLEAVTGLPVIVEV----PVFT-----RA--------ER
A0A380TAR7      GLALMAERLDYGF-RHAE---QVSEATGLPVIAHL----PVAR-----SG--------RD
A0A6J7CDW0      GILLLLEILSARI-RDVP---GTEGAARMPVIAEI----PVMN-----LD--------RT
A0A6J6XKV0      ELIVASRAIGDRIGRTGDDDADVARITGLPVLGRI----PKGE-----------------
A0A6J7P7J4      ELIVASRAIGDRIGRTGDDDADVARITGLPVLGRI----PKGE-----------------
A0A6J7JYF0      ELIVASRAIGDRIGRTGDDDADVARITGLPVLGRI----PKGE-----------------
A0A0F9G9C6      AIVLVQKAMHKGV-EDPN---EIE-AIGLPVYASV----PYSDYQDKLTGFSKALKNKVS
A0A0F9C030      GIVYIQDLLDDHF-RSPE---ELRIQLGLPVLAMVGKLEPQTN----------------V
A0A6J6AB74      ALALIRQRLATTVDRPED---LVTLGIAAPLLTVV----PVTS----------------S
A0A6J7HIX3      IGTIVLQRTDHRV-ASRA---ALLENIPAPVLAGV----PTVR----------------G
A0A2P2C6F5      AFLIARRLIDRRI-RSVK---HVEDATGAAVLGII----PKED----------------A
A0A6J7K0P4      AFLVGRRLIDRRI-RSAK---HVEDATGASVLGII----PKED----------------A
A0A645AJ49      GGCFLIDFFDKSI-RDLK---ELEERLQLPVLGVLPEVASMSG----------------D
X0S5W7          VLVYVQDTIDDRF-RTPE---ELSKRVGHPLIGLVRALPELSG----------------E
A0A3B0VG16      ---------------------------------------GTKTSP----SPAPTVNTFEG
A0A3B1CXE3      ---------------------------------------IHRDQPCL--EGIETVIDKAM
A0A3B1CYP8      ---------------------------------------IHRDQPCFECECIEAVIDRAL
A0A382GX28      ------------------------------------------------------------
K1S5Q5          ---------------------------------------K--------------------
A0A3B1DSI5      ---------------------------------------QLD------------------
A0A645DVL5      ---------------------------------------Q--------------------
A0A6J6WIY0      ------------------------------------------------KGEG--------
A0A6J6AVD8      ------------------------------------------IYDGDSKGEE--------
X0T0M9          ---------------------------------------ITRKTQKTPKGQEGTINIARD
A0A645FRE7      ------------------------------------------------------------
A0A644YH99      ------------------------------------------------------------
A0A645FLW1      ------------------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      ------------------------------------------------------------
X1SDZ3          ------------------------------------------------------------
A0A645BY58      ------------------------------------------------------------
A0A645GFE7      ------------------------------------------------------------
X1MSI7          ------------------------------------------------------------
J9H061          ------------------------------------------------------------
K1SQJ7          ------------------------------------------------------------
K1RRH4          ------------------------------------------------------------
W1Y9X6          ------------------------------------------------------------
A0A644ZTL6      ------------------------------------------------------------
W1YAG3          ------------------------------------------------------------
A0A645C306      ------------------------------------------------------------
A0A0F9CMN4      ------------------------------------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      ------------------------------------------------------------
A0A645AV36      ------------------------------------------ARVTEIPVIGMVPNDDDA
A0A1J5SIM8      ------------------------------------------LVDFRYENTRVVKLEKEH
A0A3B0VRL8      ---------------------------------------PTVSVTGSMDNTSGV----NN
A0A3B1DET2      ------------------------------------------------------------
A0A3B0Z1H7      ------------------------------------------------------------
A0A3B1D1Y9      ------------------------------------------------------------
A0A382PKY1      ------------------------------------------------------------
A0A645E1K8      ------------------------------------------------------------
K1ULC5          ------------------------------------------------------------
A0A0F9BMP5      ------------------------------------------------------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      SQSPYIVSDYPRSSFTEMFRIIRTRVEFL--------AKRKSDIT---------------
A0A0W8FVN7      PGSEFIVNKKSDSTASEAYRALRTRIRYS--------GVEGTIPKK--------------
A0A645A3P4      --SPYVVANNPRSSFTEMFRIIRTRIEFL--------ARRKTDIT---------------
A0A0F9HWF5      RSTMLVTSLDPKSVPAEAYRSIRTSIIF--------------------------SSPDDK
A0A2H9T3X6      GGGFMLAQSAPDDLAVESLRSLRTNLSFT--------MMEGKDNR---------------
A0A6J7K3N0      LRFQITTAADPTSLMAEAYRSFRTSLVAM--------WHRHPVNNPSGKTGSQDTEPLPL
A0A6J7J287      QELSVIALDAPRSRTAELYRTVRTSILFA--------IEAESLAALANSDSPDSPRNDRT
A0A380TAR7      GPEAAMLDSQPSLFLEGIRSTYIQ--LAL--------RSKRPA----------------I
A0A6J7CDW0      LRFQVITAVDPTSLMAEAYRSFRTSLVAM--------WQRHPTNNRAGLSGSSEPEATPL
A0A6J6XKV0      -----------GFETVEAFRVLRTNLMVL--------EAAGRPRT---------------
A0A6J7P7J4      -----------GFETVEAFRVLRTNLMVL--------EAAGRPRT---------------
A0A6J7JYF0      -----------GFETVEAFRVLRTNLMVL--------EAAGRPRT---------------
A0A0F9G9C6      KPKSILALDNPADLSIEALRSLRTSLHFA--------MMEAKNNL---------------
A0A0F9C030      GVDALHVHVQPNAVESEAFRTLRTALALA----------EGGSQR---------------
A0A6J6AB74      TGDRPLATTDPTNDAVEAYRWLRTSVQFA--------GTDRNLKV---------------
A0A6J7HIX3      FGGINMP-----PPVREAFRTLQIQLDLQ--------PKDG-CRR---------------
A0A2P2C6F5      LGRTHRGVRGDLGRAAESFRQLRTNLRFV--------DVDNEPRK---------------
A0A6J7K0P4      LGRVHRGVRGDLGRAAEAFRQLRTNLRFV--------DVDNEPRR---------------
A0A645AJ49      HDGELWQ-QDTKSVYGEAIRSLRVNIEYL--------LPEKGSAK---------------
X0S5W7          GLKKVSAFGDPVSVFVESFRTLRTSLT----------LSGVDSTR---------------
A0A3B0VG16      WDERLVAASRNFSGVVESFRKLRTRILYPVE--------GDVPRS---------------
A0A3B1CXE3      TDKCIVTLAEPQSPAAEQYRKLRARILKAIA------TKDDSGNT---------------
A0A3B1CYP8      ADKHIVTLTEPQSPAAEQYRKLRARILKAAE------TKDDSINT---------------
A0A382GX28      ------------SPHAEAYRVLRTNILFAG-------RKDESQTT---------------
K1S5Q5          --PLLISDRRSGFPFIETFKIIRTKIEHTA-------QREKYK-T---------------
A0A3B1DSI5      --PSVCTFHLPKSKASEAFRAVRTSL-YFS-------THNANHQV---------------
A0A645DVL5      ---SLVVESAPHTLAAEEFRRLRTNLQFID-------VTTDGKHS---------------
A0A6J6WIY0      ------------FETVEAFRVLRTNLMVLE-------AAGRPR-T---------------
A0A6J6AVD8      --MSVISSTDPTSYPAEAYRSLRTAVQFLA-------IDRPIR-T---------------
X0T0M9          IKRRIITKEDPRSPISEAYRSLRTSITYAS-------VDNPTK-T---------------
A0A645FRE7      KQSQLLAVGNPTDLAIEAVRSLRTSLHF-A-------MMQARNNV---------------
A0A644YH99      ERLDLVLSPETPFAVVEAYKTARTNFMF-L-------LSDSGCKE---------------
A0A645FLW1      TERQHILGKKTPFSIVEELKTLRTNIQF-S-------TTSEGCKI---------------
A0A3B0VF49      --MDLVTITDPRSPRSEAYRTLRTNLSF-Y-------SLDTPLQT---------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      -MTELITKKHSKSPVSEAYRTIRTNVQF-S-------AVNKDLKT---------------
X1SDZ3          SDIQPVVRKHPKSVPAEAYRTLKTNIQL-A-------DLDRPPRS---------------
A0A645BY58      EEDINLLNDSSPFQITEAYKTLRTNLIF-SLAANKSETNDHKAKI---------------
A0A645GFE7      MGKVTDLDPKSP--LAEAYRTVRTNISF-A-------DIDSNLIT---------------
X1MSI7          YSDWLVVKSKPKSHVSEAYRTLRTNIEF-S-------NLDKPLNT---------------
J9H061          -----MVQEGNRDVINEAFRVLRTNLEFMV-------GKDHSSNV---------------
K1SQJ7          SKPVLVLGENSSFAVRESYNTIRANLLF-T-------GKGERCPV---------------
K1RRH4          KSTDLIINVNPKSIFSESIKTIRTNLAF-S-------AIGNEMKV---------------
W1Y9X6          -MAKRGAYDEGNFELNESYREIRT---Y-V-------TINKNIKT---------------
A0A644ZTL6      -MPKLITIKNPKSPISEAYRGIRTSIQF-S-------DLDKGMKV---------------
W1YAG3          -MGRITSLEKPQSNISEAYRTIRTGIEF-S-------NLDKDLKI---------------
A0A645C306      --------------------------------------------M---------------
A0A0F9CMN4      -------------------------------------DIDNPPKS---------------
A0A644ZS66      -MDEHSLRLKQNSYVTESYRKLAVNIEY-A-------NIDGNIKT---------------
A0A644WQN3      ---MFIVEKEPKSIAAESYRTLRTNIQY-S-------SFDKEYKV---------------
A0A645AV36      AVNPLILDADPRSARAEAYRSLRTN-LQFL-------GLDRGKRA---------------
A0A1J5SIM8      LEKNRIVAFDKSNPMSMNFDLLRTHVLQKM-------EEN-GWRT---------------
A0A3B0VRL8      WDEKLVAFSAPSSIITENIRHLRNRILHPP-------SGGPALRR---------------
A0A3B1DET2      VDPRIVTYFDPKALITEQYKILRTNILSLN-------KSKP-PKT---------------
A0A3B0Z1H7      KENRIISGMDLGVE-MDAYRKLRTRVLKKM-------KKNN-WNV---------------
A0A3B1D1Y9      ENPNLVTIVDPDSPTAEEYRKLKSMVVKLT-------EMDDFRNM---------------
A0A382PKY1      --RRLITKEDPKSPVSEAYRSLRTSMLYST-------SAKE-LKS---------------
A0A645E1K8      ---------------VEAYKSTRTNLMFIG-------DGEG-CKK---------------
K1ULC5          --GSFVVRENGRDPVSEAFRMIRSNMNFMN-------LGKGEIKV---------------
A0A0F9BMP5      -----------------------------------------AGQA---------------
A0A645HFS0      ------------------------------------------------------------
A0A6J7MSL1      ----------------------------------MVLEAAGRPRT---------------
                                                                            

A0A644USI7      --IMITSS-ESGDGKTYFCINMACIYAMASP--KTLLVDMDIRKPSVYKRLGCENN----
A0A0W8FVN7      --LLVTSS-SAGEGKTTTAVNLAGSFAQANQ--KVLLLDCDLRKPRVHKIFNDERY----
A0A645A3P4      --IMVTSS-ESGDGKTYFSINLACIYSMASP--RTLLIDMDIRKPSLYSRLGCQNT----
A0A0F9HWF5      RTLLVTSS-NPTEGKSVTSSNLAVIMAQNGA--RTLLLDMDFRRPVLHKIFNVPQE----
A0A2H9T3X6      --VMITGP-SPGIGKSFVSANLALLLAESGE--KVLLIDGDMRKGRLNHYFGVKRG----
A0A6J7K3N0      RLLLVTSP-GPAEGKSISVVNLAAAFAETGM--SVVIIDGDFRRPQVHKYFSNITT----
A0A6J7J287      PVILVTSP-SPGEGKTTTTANVASVFAAAGT--RTLIVDCDYRKPSIGKYLAPIPD----
A0A380TAR7      RSLLVTSS-MPKEGKTTLAIGLTRARAIAGH--RALLIDADLRRPSVHVRLKLARE----
A0A6J7CDW0      RVLLVTSP-GPAEGKSISVVNIAAAFAETGM--SVLLIDGDFRRPQMHKYFSGATS----
A0A6J6XKV0      --VAVVSN-TQDAGKSFVSINLAQSASALDD--KVVLIDADLRRPTIHERLSVPRT----
A0A6J7P7J4      --VAVVSN-TQDAGKSFISINLAQSASALDD--KVVLIDADLRRPTIHERLNVPRT----
A0A6J7JYF0      --VAVVSN-TQDAGKSFISINLAQSASALDD--KVVLIDADLRRPTIHEQLSVPRT----
A0A0F9G9C6      --IAISGP-SPGVGKSFVSVNLAAVLAQSGK--KVLIIDADMRKGYLQTQFGLKWD----
A0A0F9C030      --LVVSSS-EPGDGKTTVISNLAVAYAQSGK--RTLLIDADMRRPGLTPMLDLKGQ----
A0A6J6AB74      --LQVTSA-MPGEGKTTTTANLAIVLANAGA--LVLIVDGDLRRPRIHTMFGLSGE----
A0A6J7HIX3      --ILVTSA-SSGDGKTTAVLNLAFALVSAGH--RVVLVDFDLRKPDLGRQLGVTGS----
A0A2P2C6F5      --IVVTSA-LAGEGKSTVSANIARLVAQAGT--PVLLIDADLRRPQIATTFEIDGT----
A0A6J7K0P4      --IVVTSA-LAGEGKSTVSSNIARLVAQAGT--PVLLIDADLRRPMIATTFEVDGA----
A0A645AJ49      --VFLTTSVNKSEGKSSVVSSMAIALAKIEK--KVLLIDVDLRRPRQHRIFKLSNK----
X0S5W7          --IAFTSS-EPGDGKTTVIANLAVVCAQSGK--KTLLIDGDLRRPGLTRLLDLKSK----
A0A3B0VG16      --ILIISA-DAQEGKSFICANLGLSLAHSVAQ-HALMIDCDLRRPSLAGIFGLDNS----
A0A3B1CXE3      --IMITSS-DKREGKTITAINLAVAMANVIDY-PVVLVDADLRNPFVHRYLGIEPE----
A0A3B1CYP8      --IMITSS-DKKEGKTITAINLAVAMAKVINY-PVVLVDADLRNPFVHKYLGIEPE----
A0A382GX28      --FSVVSG-GAGEGKTTTMFNLAVVFAQMGD--RILIVDSDLRRPSMHRYMNVSNN----
K1S5Q5          --FVVTST-AENEGKTTSAVNIALALAQNGK--SVLLVDGDLRKPAVAKLLGINAS----
A0A3B1DSI5      --LQVTSP-NPGDGKSTLASNLAVSIACSGK--QVLILDCDFRKPRIHEIFGLPND----
A0A645DVL5      --FQVTSA-MPGEGKTLTSINLALAMAEGGT--RVLLVDCDMRRPSVAKLMGLEGS----
A0A6J6WIY0      --VAVVSN-TQDAGKSFVSINLAQSASALDD--KVVLIDADLRRPTIHERLSVPRT----
A0A6J6AVD8      --VQVTSP-RPGDGKTTTAANFAVAVARAGK--RVVLVDCDLRNPRVHRCFGLSNE----
X0T0M9          --IIVTSP-GPGEGKTTTITNLAITFANIGK--RTLLVDADLRRPVIHRIFNLNIE----
A0A645FRE7      --LMLTGV-SPSIGKTFVCANLAAVISQTNK--RVVLIDCDMRKGYTHELLGTNNV----
A0A644YH99      --MVFTSA-ISEEGKTTSCINLAITFAQTGS--RILIIDADMRKPRIHRLMKIPST----
A0A645FLW1      --IGVTSS-VAGEGKSITALNLAITFAETQS--RVLLIDCDLRKPKVSRLLKVKAV----
A0A3B0VF49      --LVVTSP-VMGEGKSSTVANLAVTMAQSGR--KIVLVDCDLRRPSLHTLFNLKAE----
A0A644Y2V8      ---------MASEGKTTTISNLASVMAELNK--NILLIDLDLRKPTVHKQFNLSNR----
A0A644TLG5      --IVITSA-TANEGKSTTISNLGVVMAQAGQ--KVVIMDCDFRNPTQHKIFQLPNK----
X1SDZ3          --IAITSA-VPLEGKSTTAVNLAVALAQKGS--KVLLVDADLRKSVIHKILHLDNS----
A0A645BY58      --IVITSS-IPSEGKSTTCANLSIAMAQ-KSE-KVLIIDADLRKPVQNKLFEIDNS----
A0A645GFE7      --IMFTST-KQNEGKSTTICHVAHAFSKLENT-KVLVVDLDLRNPSVHKMFGIGNT----
X1MSI7          --IMVTSA-VPQEGKTTNTVNLALTIAESGK--KVIIVDVDLRVPTIHKVFNSDSK----
J9H061          --IVVTSF-NPGSGKSFLTMNLAVSLAVKNK--KVLVIDGDLRHATTSAYIHSPKI----
K1SQJ7          --YAVTSA-DKDEGKTLNSVNIAISYAQLGK--KVLLIDGDMRNMSVASLLKLRGR----
K1RRH4          --LLATSP-AAGDGKSFISANLAVAYAQEGK--KVLMIDCDLRRGRQHEIFEVMNL----
W1Y9X6          --ILVTSA-EMDEGKTTIICNLAKCFSELEGV-RVLLIDCDFRKRGVSRYFGIENS----
A0A644ZTL6      --ITVTSS-KQNEGKTTVITNLATTFANLDK--KVLVIDGDLRNPGVHRMFGISNL----
W1YAG3          --ICITSS-KKDEGKTTVLSNLGVSFAKIDK--KVLLIDADLRNPSISKMFDTSNA----
A0A645C306      --IAISST-VSGEGKTFVAINFAGVLAFNNK--NVIVLDFDLRKPKIHLGFNTDNE----
A0A0F9CMN4      --LVITSA-VPLEGKSTTALNLAVALAQKES--KVLLIDADLRKPIIHKLLHLDNS----
A0A644ZS66      --IMITSS-MANEGKSTTVSNLACVMTELNK--RVILIDLDLRKPSVHKYFNLSNN----
A0A644WQN3      --IMVTSS-EPGEGKSTTAGNLALCLAQGEK--KVILVDCDLRKPSLHKKFKISNI----
A0A645AV36      --IVITSS-VPSEGKTTTAINIASTIAASGER--VLVIDADLRRPTVAKLMRLEGS----
A0A1J5SIM8      --LAITSP-TPEAGKTVIAINLAMSIAQQTNR-TAMLVDFDLRRPKVGAYLGMHME----
A0A3B0VRL8      --VMTTSA-LPGEGKSMLCSNLAISMAQGLEQ-HALLVDCDLRRSSLAQMLAVNNS----
A0A3B1DET2      --IVITSS-LHSEGKTITSLNLAVALSQAIHKPKVLLVDADMRKGRIERYLGVDQK----
A0A3B0Z1H7      --LAVTSP-APGAGKTLTAINLAISIAMEVDK-TVLLIDADLRQSRVNKYFGLPETM---
A0A3B1D1Y9      --LMVTSA-IGGEGKSVTSLNLAITLAQEYDH-TVLLVDADLRQPSLNDYLGIHSE----
A0A382PKY1      --ILVSSA-GPGEGKTTTVANLAITYANL-GR-KTLLVDTDLRRPVVHKVFDLDRE----
A0A645E1K8      --IVFTST-FVGEGKTTNCINLAITLAQN-GQ-KVLLIDADMRRPTAKGVFEINTKVGLS
K1ULC5          --IMVTSS-NPHAGKTFVSTNLAMTFATT-GK-KVVIMDLDLRRRT------FSKQMGHD
A0A0F9BMP5      --IALTSA-CPREGKTMLTLSLAMALNAMKDQ-RAVILDCDLRRSRIAELLNLSQG----
A0A645HFS0      ----MTSA-LAAEGKSTNCANLALTMSQT-GA-SVLLIDADLRKSTQHKIFGISNT----
A0A6J7MSL1      --VAVVSN-TQDAGKSFISINLAQSASAL-DD-KVVLIDADLRRPTIHERLNVPRT----
                             **:     .             :::* * *                 

A0A644USI7      ---M--GVSNYLAN---QCTL----DEIIVRPP--GAEFD------FITAGTVPPNAGEL
A0A0W8FVN7      ---P--GFIDYFFG---QATF----DELIRKTE--QANLF------YITGGTIPPNPAEI
A0A645A3P4      ---V--GVSNYLAN---Q--C--TLDEIITRPP--DAGFD------FITAGTVPPNAGEL
A0A0F9HWF5      ---K--GFSNMLVG---D--A--GVDDVITHTN--VPNLD------VIPSGHIPPNPAEL
A0A2H9T3X6      ---D--GLSNILAG---TAGY--DAVREINK------KCY------LMTTGLLPPNPSEL
A0A6J7K3N0      ---P--NLSDLPHL---ATSS--DLEGILQETG--IPNIR------FVASAPTRTDPGSA
A0A6J7J287      --------------------L--EHPTNPQPTR--VENLW------FIPAPRTSASPAIV
A0A380TAR7      ---P--GLVDLLVG---D--A--SLEQVLQRDE--PTGAF------VIASGSAARDPSDL
A0A6J7CDW0      ---P--NLTDIPYQ---GTAA--DVSAVAQETG--VPNIR------FIASAPTRTDPGTA
A0A6J6XKV0      ---P--GLTSVLLG---SDLS----EALRKVAE--SPFLR------VLSSGPPVEDPSAI
A0A6J7P7J4      ---P--GLTSVLLG---SDLS----EALRKVAE--SPFLR------VLSSGPPVEDPSAI
A0A6J7JYF0      ---P--GLTSVLLG---SDLS----EALRKVAE--SPFLR------VLSSGPPVEDPSAI
A0A0F9G9C6      ---D--GLSDYLSG---QLNL----EQVIKPTA--VDGLS------VITRGQIPPNPSEL
A0A0F9C030      ---K--GLSTILRA---GLPVVQSAEANLCSSL--LENLD------VIPSGPRPINPTEL
A0A6J6AB74      ---A--GLVDALVG---RNPL----E--LVRHT--LDGPD------VLPAGRSPYNSSEL
A0A6J7HIX3      ---V--ALDATVAG---GGPL----TSIM--RS--VPRLP------PLRLVDVATGPGDL
A0A2P2C6F5      ---V--GLTQALAG---DVDV----RDVIVGSG--MANLS------VLPAGRIPPNPSEL
A0A6J7K0P4      ---V--GLTQALAG---DVDV----REVIIESG--MPNLS------LLPAGRIPPNPSEL
A0A645AJ49      ---V--GLVDLLVS---KKQFEEVVH---RNVN--LPGLD------ILTSGTVPITPSDL
X0S5W7          ---P--GLSDLLNA---DDEVSDMISDYLASTD--APNLD------VLPAGPRRQNPSEL
A0A3B0VG16      ---R--GLVDYLRG---EEDF----ARLVYETG--LPDLS------IMPAGLPPDNPAEL
A0A3B1CXE3      ---Y--GLSDYLTG---KVIL----SDILLRTG--IGELI------ILPGGLPPENPAEL
A0A3B1CYP8      ---Y--GLSDYLTG---RASL----SDILLRTG--IGELM------LLPGGFPPENPAEL
A0A382GX28      ---I--GLTNYLLG---QVTI----DEVIQTTE--LPSLH------FIPSGKLPSSSMGI
K1S5Q5          ---E--DGGVYGVI---NGEK----TLAEAIKYSEKYNLF------LLVSGKPVFDPSEL
A0A3B1DSI5      ---V--GLATTITE---GIDG----EPLAYVQNTEIPNLW------CMTCGKLPPNPSEL
A0A645DVL5      ---V--GLTTLL---------------LRRASLEDVAQQWRDTTLDVLPAGSLPPNPGEL
A0A6J6WIY0      ---P--GLTSVL-L---G-SD----LSEALRKVAESPFLR------VLSSGPPVEDPSAI
A0A6J6AVD8      ---H--GFTSLL-L---GEGT----FEGVGQRIPGEPNLL------VVPSGPIPPDPSEL
X0T0M9          ---P--GVTHYL-T---GFPR----DIRPLIKQTEIKNLQ------VITAGATPPDPSVL
A0A645FRE7      ---N--GLSEILIG---KGDI----SSSAKPTS--IPHFD------LIPRGQIPPNPSEL
A0A644YH99      ---P--GLSDRLGN----LTK----QDCIYATS--FENVF------VLPAGTIPPNPAEL
A0A645FLW1      ---P--GLSNVLVN---MNSV----QEAIQTVQLETTSID------VLLSGDIPPNPSEL
A0A3B0VF49      ---P--GFTDAILE-----NG----EPALQETA--VENLW------LLTAGTKPPNPADI
A0A644Y2V8      ---A--GLTDLLLH---KDDY----VGYIQNVH---PGLD------VITSGKIPANPTEI
A0A644TLG5      ------GLSNCIAM---HKSV----MEIIQHTD--VEGLD------VLTSGPVAPNPSEI
X1SDZ3          ---T--GLVDLITN---HAKP----EAAIKEFHS-VDNLW------VLTSGSVPSDSSEL
A0A645BY58      ---R--GLSDVLID---ECVL----ENTISKNV--RPFLD------LLSSGTIAPNPSEL
A0A645GFE7      ---Y--GIMDYLKN---TRDL----EKCINK-V--EENIH------VLTPGAMPPNPTEI
X1MSI7          ---P--GLTNVLVY---NKKL----SEVIKKADEINSNLY------YITSGPIPPNPSEL
J9H061          ------GLSDYLGG-RIDKLS----DIIVTHES--HASLD------IIPVGTIPPNPTEL
K1SQJ7          ---L--GLSQYLAGLRETPQI----VEYRQ-------NLD------VLVGGENPPNPSEL
K1RRH4          ---TSGGYSNLILNYKEDVNL----GKYIMKTS--NANVD------LLPTGPTPPNPIEL
W1Y9X6          ---F--GVSDIVFG---NNKK----SECIK--R--VGDLD------IITSGGVPSNTSIL
A0A644ZTL6      ---H--GLTDVLVD---NTTF----VDCVNCTD--IKNLH------VLTCGVVPPNPSEM
W1YAG3          ---Q--GLMDILLG---KRNI----QDCVKKTK--QENLY------ILTGGTIPPNPAEV
A0A645C306      ---K--GISSILLN---IDKV----DDCIRQSS--IPNLH------FITAGPTPINPSEL
A0A0F9CMN4      ---T--GLVDALLN---GGHP----GASVKQSKN-IDNLW------VLTSGSVPSNPSEL
A0A644ZS66      ---S--GLTDLLLN---KNNY----KNYIHNIQ---PGLD------VMTSGRVPSNTTEI
A0A644WQN3      ---V--GLSDVMIG---KEEL----VTAMHRYN---NNLV------ILTSGKIPPNPSEM
A0A645AV36      ---V--GLTTVLIG---EARL----EQVIQPTN--DSLMD------VLASGPIPPNPAEL
A0A1J5SIM8      ---K--SLNDVLNG---TDQL----PDVLVNPD--VPRLV------VLPTRNAVKNSSEI
A0A3B0VRL8      ---Q--GLSNYLQH---DREL----GEVIRQTG--LPKLS------LLPSGPRPMNPAEL
A0A3B1DET2      ---E--GLSDILSG---QKNI----EDVVFHLD--TENLT------FISSGEVPENPAEL
A0A3B0Z1H7      ---L--GLSDYLTS---DISL----ERLLINPG--IGRLI------ILPGGKLMHHSSEI
A0A3B1D1Y9      ---I--GLTDCLVD---GVGI----GSALIKTG--IGGLV------FLPSGRKVSNPGEL
A0A382PKY1      ---P--GVTTYLSS---ATDD----YASLIQTCE-ISNLS------IITAGIIPPNPSEL
A0A645E1K8      EILA--GLATWENE---TEEE----PYIYRSKR---RNLF------VLHSGHIPPNPAEL
K1ULC5          GDTN--GVSSYLSG---STEL----QAIIRKSKL-SEKLD------IIYAGIQPPNPSEM
A0A0F9BMP5      ---V--ALDSIL-----LGQT----CPLDAVRVDERFGLH------VIPVVYRDAYSPDH
A0A645HFS0      ---I--GLAEILGGFCKVGDG----VQEQIH-----PDLD------IITAGQVPPNPSEL
A0A6J7MSL1      ---P--GLTSVL-----LGSD----LSEALRKVAESPFLR------VLSSGPPVEDPSAI
                                                               :        .   

A0A644USI7      ----IRSDNLVEMFDELRKRYE--FIIVDTSPIGVVADAYSFASMSDINLFVIRSNKTNK
A0A0W8FVN7      ----LGSHKMEEFLAKLETHFD--LIVIDSPPIIAVTDSEILSQIVDGVMLVISAGVTEY
A0A645A3P4      ----IRSDNLIAMIRELRKKYE--FIIVDTSPIGIVADAYSFASLSDINLFVIRSGKTNK
A0A0F9HWF5      ----LSSDGIASFMDIFKSRYD--RIVIDSPPILSATDPVIISTFVDEVLMVIKMGETSR
A0A2H9T3X6      ----LMSHGFTELLENVSPLYD--IVLVDTPPILAVTDAAIIGRKCGRTFMVTRAEKNTA
A0A6J7K3N0      ----IEMVRVASRVGR--EIAD--LVIVDSPPILLANDAAELSTFCDATILMVRAGWTRR
A0A6J7J287      ----IE--ELGRVIDSWRDDFD--IVFLDTPPMLTTNDATDLLASADLTMLVIRSGQTRT
A0A380TAR7      ----LGSKAVKAFLDQACESFD--LVVLDSSPLMSVSDACNLAPLAEETVFVIQWGKTGR
A0A6J7CDW0      ----IELVKVAARLGR--EIAD--LVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRR
A0A6J6XKV0      ----LGARAFRVVLDTL-RAVR--LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQ
A0A6J7P7J4      ----LGARAFRVVLDTL-RAVR--LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQ
A0A6J7JYF0      ----LGARAFRVVLDTL-RAVR--LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQ
A0A0F9G9C6      ----LMHSNFSKLVAEVSAAYD--IVIVDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHI
A0A0F9C030      ----LVGDRFSELLCWAESRYD--QILVDSPPAL-VSDTAIIGRLVDGVLLTVQPHKNRR
A0A6J6AB74      ----LSSRRMGEVLHELAAIYD--FVIIDTPPVLPVSESLAVSRHADGTILVVRSGRTRS
A0A6J7HIX3      ALLPLLTTRTRAMLQDVDDVAD--YVLLDTAPVGEVGDALPLLGDVDDVLVVGRPGSTDD
A0A2P2C6F5      ----LGSLRMKQFIDDL-SQDH--LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGRTQI
A0A6J7K0P4      ----LGSLRMKQFVDEL-SVDY--LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQI
A0A645AJ49      ----LGSRRLEEFLKTCANHYD--YILLDAPPALGIADPMILGKLTDTTILICDCREANV
X0S5W7          ----LASDRLAQIFAWAETKYD--QILVDCPPTLVASDAVLVGRIVDGMVLIVRPDKNRR
A0A3B0VG16      ----IGSERMAGLLNEAVNGYVDGFVLLDCPPFQAVSESAVLAQLVDKVVLVVRWGRAGR
A0A3B1CXE3      ----LSSERMKTLVNELKIRHGGGYVIFDSSPVLLTSDPLSLGSLMDGVIFIIHAALTSE
A0A3B1CYP8      ----LSSERMKNLVNELKIRHRGGYVIFDSSPVLLTSDPLSLGSLMDGVLFIIHAALTSE
A0A382GX28      ----LSSAKMKEFVTEMKSRYD--YVFLDAPPIMGVSDASVLASMVDMCVLVVQYRKYPQ
K1S5Q5          ----LSTDAMSDIIKSAEKEFD--YIIIDTAPCGVVADASILSSYADGILLVVRNDMVAS
A0A3B1DSI5      ----LSSSIFEQFLEVAREKYD--YVIVDTPPLLAVTDPSTVAARVDAVLITLKLKKNSR
A0A645DVL5      ----IASDAMEMLFDQFTSSYD--FVIVDAPPVNPVTDPVLINRLVGGILMVVRLNQTGK
A0A6J6WIY0      ----LGARAFRVVLDTLRAV-R--LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQ
A0A6J6AVD8      ----LSGKRAQALLAGIADVAD--LVVIDSPPVLAVSDPLVLSAVADGVILVASVGNSDR
X0T0M9          ----ISSKRMHEFIKSLEIGWD--IILFDAPPAIAVTDTSLLAKEINQFIIVVKSGQTDK
A0A645FRE7      ----LMSERFGELIAWASSHYD--LVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTL
A0A644YH99      ----LASESMRKLLADLNGTYD--YIFIDTPPVDVVTDAAVLASRLHGLILVARQGYSRK
A0A645FLW1      ----LGSRKMKELIESLSNRYD--YILVDTPPVGVVTDAVIVSSLFTGMIFVIRASRTQQ
A0A3B0VF49      ----LGTPQVDQLIATLQEKAD--IILFDAPPVNVVTDAAVLGAKVDGVLLVLSAGKTRR
A0A644Y2V8      ----INSNAIKELIKKLSGQYD--YIFLDTPPLVLVSDPLTIATYADAVILTIAHSETEK
A0A644TLG5      ----LSSKRMDEVLEVLGREYD--YVLIDTPPILPVTDAAVMAAKVDGVIMLTAWGNINP
X1SDZ3          ----LGSTQMRSLVEQLTKEYN--YVVFDTPPLMSVSDTAVLASQVDGVLMIIRPGKLRR
A0A645BY58      ----LGSKAMEQMLKTLSEKYD--YIFIDSPPINIVSDALVASVNATGIVMVVRPEICTH
A0A645GFE7      ----LASKKMERFIKEVESKYD--YVFIDAPPVGIVSDGIIISKYTDGVMFVVGANETDI
X1MSI7          ----LGSEKMKVVIEELKERAD--TLIFDSAPVIGFADSLVLANQVDGVVLILNAGMVTR
J9H061          ----LFDERLQAAIGNLKQQYD--FVLIDCPPIELVADTQIIEKLAHRTIFVVRAGLLER
K1SQJ7          ----LGGERMKELLTTLRSRYD--CIIIDLPPVGIVTDALLLSYEVTAYLLVVRAGVSHM
K1RRH4          ----LASENNQKLLNELRKLYD--IIILDCPPVIGLSDTMIMTKFSDANIIVVSNKKTKI
W1Y9X6          ----LNSQSMKDLVSKLREEYD--YVFIDSPPICRLNDACIITQYVDGTIIVNAAKAIDS
A0A644ZTL6      ----LASQRMKEFIENLKDNYD--YIFIDAPPIGIVTDAGVISSYSDGCILVIGANETDI
W1YAG3          ----LSSKKMSEFIESIKDEYD--YIFIDSPPVGVVSDASIISAYSDGVIFVVGANEVDS
A0A645C306      ----ILTNETDELITYLKSKYD--YIILDTPPIGLVSDAMKPLQYADYPIYVIRANYSKR
A0A0F9CMN4      ----LGSSGMKALMEQVTKEYD--YVVFDTPPLISVSDGAILASQADGILMVVSPGKVKG
A0A644ZS66      ----IISKAIKELLKDLSENYD--YILLDTPPIMLVSDPVNIAIYSDAVILAIAYAETDK
A0A644WQN3      ----LSSKAMTTLLDALKQNFD--YIILDTPPVQAVTDSQILATKADGAILVVRAERTKK
A0A645AV36      ----LGLPHMQQLITEASRRYDT--VIIDAPPLLPVTDAAVLSRVADGTLVVVGSGVARR
A0A1J5SIM8      ----LSSKKIGDLITDLRERYKSRIVIFDLPPLLVTDDAIALLPKIDCVLLVVANGMSTK
A0A3B0VRL8      ----LDSKRVGEMFDELSNRYDDRFIIIDTPPLPMAAETTVLAEQVDGIIIVVRWGRAAR
A0A3B1DET2      ----LSSNKMKQFLSQTRAQFD--FVIIDTPPIIAVTDSGIIGAQADGIIMVVQAGRTQR
A0A3B0Z1H7      ----LSSPKMKRLVEEVKSRYESRYVIFDLPPMLASDDAMGFAPLVDATLLVVEDGVANI
A0A3B1D1Y9      ----LSSNRMKEIVKELKHRYPDRYVIFDAPPVLPFAEVLSVGALLDGIIFVVREGVTPE
A0A382PKY1      ----LGSKRMTELVKQLENDWD--MVLFDSPPMIAVTDATMISKEIDQVVLIVKVGQTDK
A0A645E1K8      ----LASKQMKNLLEKCEKEFD--YIIIDTPPISVVTDAAVLANVVNGYVIVVRAGVTPK
K1ULC5          ----LLSQRMEELIAELKLHYD--YIIIDSTPAMAVADAIITDRLADLSIYVVREGLLDR
A0A0F9BMP5      ----LSRSAFAEIIRELKTRYD--YVLVDTPPVLAVADTGLLASHCDQTYMVVRWRKTRH
A0A645HFS0      ----LGSQNMQKLIEIVSENYN--YIFIDSPPVNIVTDALVLARYAAGLIMCTRYRQSTH
A0A6J7MSL1      ----LGARAFRVVLDTL-RAVR--LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQ
                    :        .           :..* .*     :                      

A0A644USI7      LFLRNLSNQLKADDVTNFYSVLNDVEVDSGSYSQYYSRKYAYGRNKSYGVGAYGYGYGYG
A0A0W8FVN7      DILYKSLDVLKMAKSQFLGAVLNKFAYRPG--------------YGSYY---KYYYYYYN
A0A645A3P4      NFVKNLSAQLKADNISHFYSILNDVQVETNSYSQYYSKRYAYGSSKQYG---YSYGYGYG
A0A0F9HWF5      ELVQTAIGKLHHVKANLIGTVLNGVDT--G--------------QGNYY---QYQYYGDR
A0A2H9T3X6      SEISYAAKRLQQAKVNVKGCILNGMVY--T--------------SSCYG---QYGYYHYK
A0A6J7K3N0      GGVVAASDLLRRLEATTVGIVLVGAEHGAR--------------AGYYG---YYGYYGYG
A0A6J7J287      VAAERVSGLLARFGAPVIGTIFNGCSAADM--------------EGYYG---YYGAGYYG
A0A380TAR7      EVVKLALEKLTETQGVPRGIVLSRVDT-AK--------------IRLYG---Y-------
A0A6J7CDW0      GGVVAASDLLRRLEATTVGIVLVGAEHGAR--------------AGYYG---YYGYYGYG
A0A6J6XKV0      QQVRQALEELQRAGANVVGVVVNRTEVVNR--------------SAYYE---A-------
A0A6J7P7J4      QQVRQALEELQRAGANVVGVVVNRTEVVNR--------------SAYYE---A-------
A0A6J7JYF0      QQVRQALEELQRAGANVVGVVVNRTEVVNR--------------SAYYE---A-------
A0A0F9G9C6      KEIELTRNRFEQNGTDVKGVVFNGVIKKAS--------------N---------------
A0A0F9C030      RTVIRAAESFSNLGINVLGIVINRLATEKS--------------DDYYG---YGYGYGYG
A0A6J6AB74      QQLQRTLGEFDRIGSPVLGIVLNGLDRKHT--------------R--------Y------
A0A6J7HIX3      RALGAMAGYLRRAGVAPTGWIVTGV-----------------------------------
A0A2P2C6F5      EQSQQCRRILDQVGSRLLGVVLNKAPVKGA--------------S--------AIAYGGG
A0A6J7K0P4      EQSQQCRRILDQVGSRLLGVVLNKAPVKGA--------------A--------AIAYGGG
A0A645AJ49      DKLAGVTERLRQADVRLGGLVLNRFSLMNK--------------SDYYY---YYQHYYYG
X0S5W7          KLVFRATQNLTEMKIPLLGLVANGVGAENN--------------KG-YS---FGEGEGYG
A0A3B0VG16      ENVKKLVEQIG--RDKIIGIVFN-------------------------------SFEMNI
A0A3B1CXE3      KSAAQAISLIK--GCNILGIVFNDVQ----------------------NYPAKDPYPYYS
A0A3B1CYP8      KSASQAISLIK--GCNILGIVFNEVQ----------------------NYPAKDPYPYNF
A0A382GX28      MMTQRAKEMVTKVGGELVGVVLNNINIS--------------------QDSYYYYYSGYY
K1S5Q5          RRIKRAVENLENSGTKLVGCIYNDT---------------ESGMPKRFMSSYNKKYGYGY
A0A3B1DSI5      TMATRAREMLTAVNANLIGIVVNGAGHL----------EHYSYGYTGYGSSSYEQGYYGY
A0A645DVL5      RELTQALRSLATVDIKVSGFALNGL-------------------------PNEGSDYYGH
A0A6J6WIY0      QQVRQALEELQRAGANVVGVVVNRT------------------------EVVNRSAYYEA
A0A6J6AVD8      NQIAKALSQLRQVDSPLIGAVLNRF------------------------KGDSSTYGYGY
X0T0M9          FAFDRAIQMLESVNAPIAGAIMNAV------------------------SPKTSYESYYY
A0A645FRE7      KEVETSLGRFEQNGIQVKGVILNSIFRR--------------------ASGYQDYGYYEY
A0A644YH99      EIMQSAVAALEQAGVNILGILLNDVNME----------------KYSGRYRYNRYSKYNQ
A0A645FLW1      DAVHSALSQLKFAGANVLGFVLNGVNAK--------------------GNRR--YSSYRS
A0A3B0VF49      EHAERAKEILKKARVNIIGATLTNAPTD--------------------SSMEAYYG----
A0A644Y2V8      EVIRRSIDSLKQVNANIIGTILNKMPVS--------------------KHNKYYYSYY--
A0A644TLG5      EVARDAKARLVQAGANIIGVILNKVEVN------------TPGNSYGYGYGYGYYYYYGS
X1SDZ3          EMARRTKELLNRVGTPVLGCVLNGVEPR--------------------DSSY--YYYYHS
A0A645BY58      EHFKHATESIKLANIKLLGVVMSNVKED--------------------NLGFKYKRKYYS
A0A645GFE7      NHTKEVIDNMRKSDVNIIGSILNKYDME--------------------NNAYGYYGYYYQ
X1MSI7          DAAKQAKALLEKAKAKILGVVLNNVDIK--------------------REGYYHYYHYYN
J9H061          SMLPELEHIYQEKKYKNMSLILNATEGS--------------------GGRY--GYRYGY
K1SQJ7          SREKSAVTLLEQVDADICGILFNGLPPK--------------------SKD-----CNYR
K1RRH4          ESLDRAKKIFAQANAKITGVVINKASVK--------------------GSSY--YSYYSD
W1Y9X6          KGAKITLDKLNKVGANIIGVVLNKFKAE--------------------KYSY--YSNYYG
A0A644ZTL6      ETAKLAKERLDSVGAKIIGTVLNKFAVK--------------------TNGH----DYYA
W1YAG3          NLAKIAKERLDNVKANIVGVILNKFKTD--------------------TNS-----EYYN
A0A645C306      SYIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSQGFAYGYGYGYGYNNSR--HGYYDS
A0A0F9CMN4      EIGRHTKELLERIGTPVLGCVFNGVELS--------------------HRNY--YYYYNY
A0A644ZS66      ETIKKTIDILKQVNANIIGTVLNKVPQN--------------------KKNK--YYYYY-
A0A644WQN3      DSVQNAISLLKKVNANIIGTVLNGLDNS--------------------RNKY--YYYYGE
A0A645AV36      PELEKALEKLEMVDARVLGLLLTRVR---------------------G--GDAGAYHYEY
A0A1J5SIM8      REIEDSLRLLP--AENLIGTILNKAD------------------------VEPKAYYYD-
A0A3B0VRL8      EQVKQMTENLN--KDKIIGVLYNAFE---------------------KYILRAKLTCYE-
A0A3B1DET2      GIVRRAQELLYQSHSKVLGQVLTNIE------------------------YHLPEYIYRY
A0A3B0Z1H7      DELKSSIELLED--ANLIGTVLNKSR------------------------EPVKDYYYGK
A0A3B1D1Y9      DNMKDAVTMLKD--NNILGVVYNAAE---------------TVPLSDY-------YNYSH
A0A382PKY1      KAFHHTINNLRNINAPLGGIIMNAVT-----------------SKSSYGSYYYYYYQYYH
A0A645E1K8      DSLSESVLRLEQLGANIIGFILNDVDPK-------TSLYKHSSGRYKYGSSKYHKYGYGG
K1ULC5          RQLPDIERLYREKKFHNMAIILNGAS---------------STKRHGYGYGYGYGYGYG-
A0A0F9BMP5      AQIRDVFERLYDLDINVTGTILNFVNPK--------------------KEANYRGIPYAS
A0A645HFS0      DELRRAVASVEFANAKILGMIVCDVKDV--------------------GGGYYRK-SYKS
A0A6J7MSL1      QQVRQALEELQRAGANVVGVVVNRTEVV--------------------NRSAYYE-A---
                                                                            

A0A644USI7      YGYTSGSGKNKGKSSDSYYQYYQDDAKDI-------------------------------
A0A0W8FVN7      TGNGKEDKKKLLKV----------------------------------------------
A0A645A3P4      YGYTASG---------------------------------------RKKKKDESDTYFQY
A0A0F9HWF5      QPETEQGVFGRLRKPFLMRK----------------------------------------
A0A2H9T3X6      YGSES-------------------------------------------------------
A0A6J7K3N0      YGYAHPGEVPKMSRLFPWRKPTRGEGTVRRQPDSKQVG--------VGASIQGESSSSEA
A0A6J7J287      SGYY--GSGYYGSGYYGSGYYSSGEGQPAQTGQPAQLGQRVRPTPVAPMDAPQTPTSTNG
A0A380TAR7      ------GDAAYYDR-----------------------------------------TVREY
A0A6J7CDW0      YGYAHPGEVPKMSRLFPWRKPTNGAGTVRRKPDPEQVG--------ASASNQGAPASTEA
A0A6J6XKV0      ------------------------------------------------------------
A0A6J7P7J4      ------------------------------------------------------------
A0A6J7JYF0      ------------------------------------------------------------
A0A0F9G9C6      --AYGYYGYYNYEYKSNEKS----------------------------------------
A0A0F9C030      YGSGYGYGHDDEPQSDAGLSEGSTDDMPMEIVRRVA------------------------
A0A6J6AB74      -----GYGAYGYDASK--------------------------------------------
A0A6J7HIX3      -------------DAALSPYYDAAPRRRSGAVWRTARRIVQGSG----------------
A0A2P2C6F5      YSGYGGYGGYRAEEATREAYSTAGKGRRRKLVKSSSDKD---------------------
A0A6J7K0P4      YGSYGGYGGYKAEYASREAYSTAGKGRRRKQAKSEAKAEAKAQSKAGSKTEATAAKNADA
A0A645AJ49      YHYSYTAEPGSSDEFAIIPDEPEGGNEPSQS-----------------------------
X0S5W7          YGYGYGDDENNDEDEGEIEQQGNGDSYQGISFQSKTSDQSENDQENLPANFRKT------
A0A3B0VG16      LDRKMQDVGYHNYYSERY------------------------------------------
A0A3B1CXE3      ADEAQSGQG---------------------------------------------------
A0A3B1CYP8      PEDKDAGRIAGKTKTQGA------------------------------------------
A0A382GX28      YDNYYKSREKEGSAEDDTKSRKKTKLLASAKTGEEDEKPKY-------------------
K1S5Q5          GYGYGYGSNQK-------------------------------------------------
A0A3B1DSI5      DYAYSVKNDHNTTQPLPVMYDSQKKGHLQEALYQNENNDDV-------------------
A0A645DVL5      YHTEPGEQANGRSR--------KRRASRSTSKRTSSHVDAA-------------------
A0A6J6WIY0      ------------------------------------------------------------
A0A6J6AVD8      GYGYGVKNTQEAAKKSAKKSSNKDKEPSPTLIGSNDNN----------------------
X0T0M9          YHEYY------------------------HYYGKDKNK----------------------
A0A645FRE7      EYTSDSK-----------------------------------------------------
A0A644YH99      YNRYSYSDSEHKTEEEA-------------------------------------------
A0A645FLW1      YKEAAAR-----------------------------------------------------
A0A3B0VF49      ------------------------------------------------------------
A0A644Y2V8      ------------------------------------------------------------
A0A644TLG5      GEGKEDGEKKHRHSKEK-------------------------------------------
X1SDZ3          YAGAEG------------------------------------------------------
A0A645BY58      YRKYKN------------------------------------------------------
A0A645GFE7      QDDGRNGRGAKKKKKNGLFRKKK-------------------------------------
X1MSI7          YSKYYNTEE---------------------------------------------------
J9H061          HYGYGNGYHYGNSTKTN-------------------------------------------
K1SQJ7          LQQYWQEYKQQNGEAV--------------------------------------------
K1RRH4          E--YYRDTDSKKKRKR--------------------------------------------
W1Y9X6          YSNYYGEHKHKLFGRKKKRRRKTS------------------------------------
A0A644ZTL6      Y--YYQGRKSKKSNRKMNKKEKSMA-----------------------------------
W1YAG3          Y--YYNENK---------------------------------------------------
A0A645C306      EDSVKKSWREKLRDRFRRKK----------------------------------------
A0A0F9CMN4      YRYYAGSAGEKKVGKREKKESNVLD-----------------------------------
A0A644ZS66      ------------------------------------------------------------
A0A644WQN3      K-----------------------------------------------------------
A0A645AV36      VYGQDGQSSSRTSRDKNAPAPISSARARTGRRPTRAIQPVQ-------------------
A0A1J5SIM8      ------------------------------------------------------------
A0A3B0VRL8      ------------------------------------------------------------
A0A3B1DET2      L-----------------------------------------------------------
A0A3B0Z1H7      Y-----------------------------------------------------------
A0A3B1D1Y9      YYQNR-------------------------------------------------------
A0A382PKY1      YYGSEKESD---------------------------------------------------
A0A645E1K8      YDDVQEDSE---------------------------------------------------
K1ULC5          -LDEEETTT---------------------------------------------------
A0A0F9BMP5      YNEYRHV-----------------------------------------------------
A0A645HFS0      YKSYE-------------------------------------------------------
A0A6J7MSL1      ------------------------------------------------------------
                                                                            

A0A644USI7      --------
A0A0W8FVN7      --------
A0A645A3P4      YQDDEKEI
A0A0F9HWF5      --------
A0A2H9T3X6      --------
A0A6J7K3N0      FDDTSA--
A0A6J7J287      SAEGDAQS
A0A380TAR7      YTRGSA--
A0A6J7CDW0      FDDTSA--
A0A6J6XKV0      --------
A0A6J7P7J4      --------
A0A6J7JYF0      --------
A0A0F9G9C6      --------
A0A0F9C030      --------
A0A6J6AB74      --------
A0A6J7HIX3      --------
A0A2P2C6F5      --------
A0A6J7K0P4      PEKAAKS-
A0A645AJ49      --------
X0S5W7          --------
A0A3B0VG16      --------
A0A3B1CXE3      --------
A0A3B1CYP8      --------
A0A382GX28      --------
K1S5Q5          --------
A0A3B1DSI5      --------
A0A645DVL5      --------
A0A6J6WIY0      --------
A0A6J6AVD8      --------
X0T0M9          --------
A0A645FRE7      --------
A0A644YH99      --------
A0A645FLW1      --------
A0A3B0VF49      --------
A0A644Y2V8      --------
A0A644TLG5      --------
X1SDZ3          --------
A0A645BY58      --------
A0A645GFE7      --------
X1MSI7          --------
J9H061          --------
K1SQJ7          --------
K1RRH4          --------
W1Y9X6          --------
A0A644ZTL6      --------
W1YAG3          --------
A0A645C306      --------
A0A0F9CMN4      --------
A0A644ZS66      --------
A0A644WQN3      --------
A0A645AV36      --------
A0A1J5SIM8      --------
A0A3B0VRL8      --------
A0A3B1DET2      --------
A0A3B0Z1H7      --------
A0A3B1D1Y9      --------
A0A382PKY1      --------
A0A645E1K8      --------
K1ULC5          --------
A0A0F9BMP5      --------
A0A645HFS0      --------
A0A6J7MSL1      --------
                        

© 1998-2021Legal notice