BYKdb

Dataset for cluster orphancd of phylum candidatus-stahlbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A523ZAC0 [Bacteria] Bacterial tyrosine kinase [Candidatus Stahlbacteria][Candidatus Stahlbacteria bacterium] (length=717 residues).
MEVELNKEGDIKRYIKIIKRRLWIVLGVIGGAIILSVIYIIFSPPLYTSSSSFMIGRLESLFADRYLRISMEEEITNHLY
LIKTEPVVQKAAYNFTPEEIEKMEFDSATQVFSRIKSDLNSGRINIGVEGESRIIKIVVSETNPYRSSLIANKLAIAYRD
FNSEINRGEAFSTRTFIESQLEKVTDDLKKAEEALKSFKEGHGIIGVSEEIRNFVEQMGVMETEYRRARLDAQTLRQELE
SVRSMLTERQQALLSEASETSYQIFDNLKSQLAGLERERADLMIRGHGASDEKIISIENSINKIRRQMSDMFRNLLQEGS
VIDPLEDVRDLLQKSLTLKVNYTVAKTKEDALEGVLSTYQNELKEMPKRDLQLARLERERTANEKLYLMLMEKKQQSQIE
EASELGNIAIISLAKTPSSQNISSKLKNCIMFLFLGIFIAIGAAFVADYMDSAIKDSEEVIGLSGLTKLASIPLISENEN
SIPIIVDDNYNLYMGEAIRRLRTNIKLSKVDKPPSLLLVTSPDVGSGKSIVAINLAISFASSGDKVLLVDADLRRPAIEE
YLKIQASKGITELLNGDDNTEILTYSNIDATFFIDILPSGKLPENPSELLDSDKMKELISEWKRYYDIVIFDSPPLLMVS
DGFILGSMVDKTLLVVAYRETTREMISQTITQLNQLDISTLGFVINKVPLEVESAYYGYYKDKYKKETVKSLPNTKI
© 1998-2021Legal notice