BYKdb

Dataset for cluster tadcd of phylum candidatus-stahlbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G9Y383      MQEKMVEEDGKELRTYWYLLMENRYLLLIVFLIIFISVFIFTKLSRPVYQSSSTILIESS
A0A523Z7C4      ----MELDREVDIRDYIRIIRRRLWIILGVFGVSLILTFLYFIYSPPLYTTSSTILVKKV
                    *  :   ::* *  ::  . :::* ** : :* .*::   * *:* :*****::. 

A0A2G9Y383      DK--GLSFFPIREMNPRQTFINNHIEMIKSRTLIEKVAIAIENDSTPDSIYIKDLKYSKE
A0A523Z7C4      ETLFGGGYFP----SPTEEELTNHIYLLKSDPVLRKTALSFNNEDLKRMEFESSNQAFRK
                :.  * .:**    .* :  :.*** ::** .:: *.*::::*:.     : .. :  .:

A0A2G9Y383      MRIALIKSGLSVMPIKDTDILKISYKDKTPFNAFYITNLIVNQYYNINLDMTRGELSEVR
A0A523Z7C4      IKRDIENGQIEIGTEGESRIIKIKVTETNPYRSSLIANRLALTYRDFNIDMKREDAHSTY
                :.  : :. :.: .  :: *:**. .:..*:.:  *:* :.  * ::*:**.* :  .. 

A0A2G9Y383      HFLEEQLTKIESELKFSEERLKMYKERNSILELSEETKTLVQTISTYQQQKKAIEVELHM
A0A523Z7C4      SFIENQVNVIKEDLEEVEKKLRAFKEEHGVLGVSAEVEGFVQQMAEIEKEFRRASVEADV
                 *:*:*:. *:.:*:  *:.*. :** :.:* :* *.: :** ::  ::: .  .**  :

A0A2G9Y383      IETRLNVLTENLNESQKFLAEGIFNTSNPFISRSIDELEILESNYAYYLSLGYDSLHPKI
A0A523Z7C4      LEMELKTIESRLSDREKMLLTEASKTSYEILLDLKGQLTSLENQRADLLIQGYLPTSQKI
                :*  *:.: ..*.: :*:*     :**  ::    .:*  **.: *  *  ** .   **

A0A2G9Y383      IEVKNRIEKIKSQIVKTSKTNLKEKYISSNPVEYSESIIDEILSLQVDLKAKTSMFNALT
A0A523Z7C4      QSVEHAVSSIKEKMDEVIRDLMEKRGI-LNPLEEIKDLLQKSLYLTVDWTVAKTRKEAFD
                 .*:: :..**.:: :. .  :::. *  **:*  :.:::: * * ** .. .:  :*: 

A0A2G9Y383      SAVNEYESKMKNVPLKEISLARLERDKKVSEELYLMLRSKYEESRVAEAGKLGAVRIIDK
A0A523Z7C4      GVLSYYKEKLKEIPKRDLMLARLEREKEANEKIYMMLLEKREHAQITEVSERGDISILDF
                ..:. *:.*:*::* .:: ******:*:..*::*:** .* * :.::*..: * : *:* 

A0A2G9Y383      AVLTTKPILPKTSRNLILGFFLSLIIAIGSVLLKEYIDDSIKDIDEIEREFKIKTLGSIP
A0A523Z7C4      ATMPKEPNIFSKIKKGILFIILGLLLGVGVGFIVDYIDSAIRDEGEILRLSGLPVLASIP
                *.:..:* : .. .: ** ::*.*::.:*  :: :***.:*.* .** *   : .*.***

A0A2G9Y383      LILQKLEGNGKSNGQSIKFPIITNLPEGSPISESYKILRTNITYLSEENPPQMMTVSSAT
A0A523Z7C4      LI---------DSGKKETF-VLTDKNLSSSTAEAFRRLRTNIKLSRADGLPSSLLVTGPN
                **         ..*:. .* ::*:   .*. :*::. *****.    :. *. : *:...

A0A2G9Y383      KGEGKSTTIANLGIVLSNLNKRTLMIDADLRRPKLSQFFDIPPKSKGLTHIIKENSSLKE
A0A523Z7C4      KGSGKSMIAINLALSFASVGERVLLVDTDLRRASIGSYLGI-SNVVGLTDLLIGQAKKVK
                **.***    **.: ::.:.:*.*::*:****..:..::.* .:  *** ::  ::.  :

A0A2G9Y383      CIYSTSIPNLFIMPHGERTTHSTELLESEKTKVIFNDLRSQFDYIIIDTSPMLSIADPTI
A0A523Z7C4      TFKFNGVD---VISSGTLPPNPSELLDSVKMRELLEKWEEDYDLVILDSPPFLSVSDSSI
                 :  ..:    ::. *  ..:.:***:* * . :::.  .::* :*:*:.*:**::*.:*

A0A2G9Y383      LSRISDGLLWVVQFKKAHKRDLQFANKILINMHVNVLGFIFNNINMASYYGRYYYYHYHY
A0A523Z7C4      LASEVGETLIVVSYGETTRNMISQTMDLLKRLSIKTLGFVMNKVHFHREYGYYHYYYYYK
                *:   .  * **.: :: .. :. : .:* .: ::.***::*::::   ** *:**:*: 

A0A2G9Y383      HSKEEDKQ
A0A523Z7C4      DYKGVK--
                  *  .  

© 1998-2021Legal notice