BYKdb

Dataset for cluster tadcd of phylum candidatus-stahlbacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A2G9Y383 [Bacteria] Bacterial tyrosine kinase [Candidatus Stahlbacteria][bacterium] (length=726 residues).
MQEKMVEEDGKELRTYWYLLMENRYLLLIVFLIIFISVFIFTKLSRPVYQSSSTILIESSDKGLSFFPIREMNPRQTFIN
NHIEMIKSRTLIEKVAIAIENDSTPDSIYIKDLKYSKEMRIALIKSGLSVMPIKDTDILKISYKDKTPFNAFYITNLIVN
QYYNINLDMTRGELSEVRHFLEEQLTKIESELKFSEERLKMYKERNSILELSEETKTLVQTISTYQQQKKAIEVELHMIE
TRLNVLTENLNESQKFLAEGIFNTSNPFISRSIDELEILESNYAYYLSLGYDSLHPKIIEVKNRIEKIKSQIVKTSKTNL
KEKYISSNPVEYSESIIDEILSLQVDLKAKTSMFNALTSAVNEYESKMKNVPLKEISLARLERDKKVSEELYLMLRSKYE
ESRVAEAGKLGAVRIIDKAVLTTKPILPKTSRNLILGFFLSLIIAIGSVLLKEYIDDSIKDIDEIEREFKIKTLGSIPLI
LQKLEGNGKSNGQSIKFPIITNLPEGSPISESYKILRTNITYLSEENPPQMMTVSSATKGEGKSTTIANLGIVLSNLNKR
TLMIDADLRRPKLSQFFDIPPKSKGLTHIIKENSSLKECIYSTSIPNLFIMPHGERTTHSTELLESEKTKVIFNDLRSQF
DYIIIDTSPMLSIADPTILSRISDGLLWVVQFKKAHKRDLQFANKILINMHVNVLGFIFNNINMASYYGRYYYYHYHYHS
KEEDKQ
>gnl|bykdb|A0A523Z7C4 [Bacteria] Bacterial tyrosine kinase [Candidatus Stahlbacteria][Candidatus Stahlbacteria bacterium] (length=703 residues).
MELDREVDIRDYIRIIRRRLWIILGVFGVSLILTFLYFIYSPPLYTTSSTILVKKVETLFGGGYFPSPTEEELTNHIYLL
KSDPVLRKTALSFNNEDLKRMEFESSNQAFRKIKRDIENGQIEIGTEGESRIIKIKVTETNPYRSSLIANRLALTYRDFN
IDMKREDAHSTYSFIENQVNVIKEDLEEVEKKLRAFKEEHGVLGVSAEVEGFVQQMAEIEKEFRRASVEADVLEMELKTI
ESRLSDREKMLLTEASKTSYEILLDLKGQLTSLENQRADLLIQGYLPTSQKIQSVEHAVSSIKEKMDEVIRDLMEKRGIL
NPLEEIKDLLQKSLYLTVDWTVAKTRKEAFDGVLSYYKEKLKEIPKRDLMLARLEREKEANEKIYMMLLEKREHAQITEV
SERGDISILDFATMPKEPNIFSKIKKGILFIILGLLLGVGVGFIVDYIDSAIRDEGEILRLSGLPVLASIPLIDSGKKET
FVLTDKNLSSSTAEAFRRLRTNIKLSRADGLPSSLLVTGPNKGSGKSMIAINLALSFASVGERVLLVDTDLRRASIGSYL
GISNVVGLTDLLIGQAKKVKTFKFNGVDVISSGTLPPNPSELLDSVKMRELLEKWEEDYDLVILDSPPFLSVSDSSILAS
EVGETLIVVSYGETTRNMISQTMDLLKRLSIKTLGFVMNKVHFHREYGYYHYYYYYKDYKGVK
© 1998-2021Legal notice