BYKdb

Dataset for cluster orphancd of phylum candidatus-aerophobetes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A523VYT8 [Bacteria] Bacterial tyrosine kinase [Candidatus Aerophobetes][Candidatus Aerophobetes bacterium] (length=184 residues).
PLEGKSTTAVNLAVALAQKGSKVLLVDADLRKSIIHKILHLDNSTGLVDLITNQAQPEAAIKEFHSVDNLWVLTSGSVPS
DSSELLGSTQMRSLVEQLTKEYNYVVFDTPPLMSVSDAAVLSSQVDGVLMIIKPGKLKREMARRTKELLDRVGTPVLGCV
LNGVEPRDSSYYYYYHSYAGAEGK
© 1998-2020Legal notice