BYKdb

Dataset for cluster tadcd of phylum euryarchaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A534IPH3      MLEEQTRAEIDYRRLL-------------------RRIVSHWRLITILFIAVTLPVSVWA
A0A534KE17      MWCHRHRVDPVHGRMLQRRHTMPSRHCGRRRSGHERRVVHSARLVAELTVS---RLRYWC
                *   . *.:  : *:*                   **:*   **:: * ::    :  *.

A0A534IPH3      LVFVPKTYEAVAKIFIED-----------------------------------PKRVGAG
A0A534KE17      ESH-PDTHSPSSRAHVADLSPSEPGPQPVASAGLGLLDERSGYSMQPYGAPGAPDDAAVD
                  . *.*:.. :. .: *                                   *. ....

A0A534IPH3      FLRDW---------------MPASDASFQQALLRSRSLAEAVV----ANLPPESTDELLR
A0A534KE17      WRRYWSAIVRYRWWVLLGTGLGLTGGFAAGRLLKPQYRAQATVWIDAANNRPDASRGPIR
                : * *               :  :..     **...  *:*.*    **  *:::   :*

A0A534IPH3      RAMHVDYFA----------------EARNFLRRLLGRESV--------------------
A0A534KE17      QGQLLEPYAWVDLLQSYAVLDDVVRQLRLYLTPRARADSLALSSFDLAERFRPGSYRLAV
                ..  :: :*                : * :*      :*:                    

A0A534IPH3      ----------VSGSLPQQRAVT-ELQAARMTF------TPLASGEV--------------
A0A534KE17      DQSGKSFTLTASGSIVLQRGIPGEMVGSAIGFRWTPPAAALPPGAIVSFTLVTPRDAAQR
                          .***:  **.:. *: .: : *      :.*..* :              

A0A534IPH3      ----------------EIRAVAYNPQVAMGLANTYVDVLQSRSRSNIREEARVSRTFIED
A0A534KE17      LSEDLGVKLDANGNFMRLELAGTDPNIIAAVVNAVAQRLVAVAAELKRAKLTELTRILND
                                 :  .. :*::  .:.*: .: * : : .  * :      :::*

A0A534IPH3      LLNQTKASLQESEEALAKFQRGR----ASKKFPDHSALELTQVAQLENNLTEIQASKE--
A0A534KE17      QLATAARSLRDAEGALEKFRVNTITLPAEQSTPVAPGLEATRDPGFK-NFFEMRIEREQL
                 *  :  **.::* ** **. .     *.:. *  ..** *. . :: *: *:. ..*  

A0A534IPH3      ------IAKLRLNFLRGGKDPTGKPLPSAVALAQQ--QLTKRLAQLQEKLAGLQERYTEG
A0A534KE17      RRDREAVRRVLAQVADSGLAVAGLEIIGTVQRSTELTEALKELTTKQAELRALRYRYTDQ
                      : .:  :.  .*   :*  : .:*  : :  :  * *:  * :* .*. ***: 

A0A534IPH3      HPLVRATQAEIKDVQAALAASSQFSPDSATASRLYLGTAERAALTKQQADVEAEIASQEA
A0A534KE17      HPPVKRLEADME-------------------------TLERRTIPGLAGALLEEVGT---
                ** *.  :*:::                         * ** ::.   . :  *:.:   

A0A534IPH3      KEEVVKQRIARLSQNVSNLNAEEMEASKLLRKVETQRNLYSTLSEKLGMVRVQEQGEDRG
A0A534KE17      REQVLDSLVRSAGRELQQIPQRAVEEARLRREVAIAENLYTTLQQRYEEARLAEASTIPD
                .*:*:.. :   ..::.::    :* :.* *:*    ***:**.:.   .*: * .   .

A0A534IPH3      LRVIDLAVLPQSPSGAPAKRIIFLGVLLGLSLGVGVAAVIEYFNQPMETEDDVSRVTGLP
A0A534KE17      VRVLDAADVPHQPMKNTAPRLILLGLFGGLGLSLVGAVMLDRFDRHFRYPHQVTREMGLA
                :**:* * :*:.*   .* *:*:**:: **.*.:  *.::: *:. :    :*:*  **.

A0A534IPH3      VLGWLPTIEGNHTQNGADREPLRFAETSGPETLEVETCRGIRTSLQALSRQRKLRTIMLA
A0A534KE17      ILGAVPRIKRGHRGVAPD-----------DAHQVIEALRTVRLNLTHAYGSAGPLLVTIT
                :** :* *: .*   ..*                :*: * :* .*     .     : ::

A0A534IPH3      SAGPGEGKSTVVLNLGWAFWEAGQRLIIVDADLRRPSLHRPFRYPLGPGLVDLLASDVPW
A0A534KE17      SPGPGEGKSFVSGNLARAFADAGQRTLLIDGDSRRGVLHRLLRAVRKPGLTDYLAGVVPL
                *.******* *  **..** :**** :::*.* **  *** :*    ***.* **. ** 

A0A534IPH3      DRVGQAVKENLLLLPAGSIEVAKPGVLLSAEKVRHFLNLAKNQADLVIFDSAPVLAVADN
A0A534KE17      EAVVQRTDHPALWFIGSGSRKQDAPELLGAPAMAQLLASARATYQVILIDSSPLGAGVDP
                : * * ..   * : ...    ..  **.*  : ::*  *.   :::::**:*: * .* 

A0A534IPH3      LTLASMVDGVILVVRAGATQQRELVRAK-SLLEKVGAPLIGVVLNQVSRRETRRYYRTYA
A0A534KE17      FLLGTLTGSLLLVLRSGAT-DRDLAHAKLDVLARLPIRVLGAVLNDVEPRGAYRYYSYL-
                : *.::...::**:*:*** :*:*..** .:* .:   ::*.***:*. * : ***    

A0A534IPH3      GYYGVGDGRSGRKHSRSSRSWWPTVQKTSNPK
A0A534KE17      --------------------------------
                                                

© 1998-2020Legal notice