BYKdb

Dataset for cluster tadcd of phylum euryarchaeota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A534IPH3 [Archaea] Bacterial tyrosine kinase [Euryarchaeota][Euryarchaeota archaeon] (length=761 residues).
MLEEQTRAEIDYRRLLRRIVSHWRLITILFIAVTLPVSVWALVFVPKTYEAVAKIFIEDPKRVGAGFLRDWMPASDASFQ
QALLRSRSLAEAVVANLPPESTDELLRRAMHVDYFAEARNFLRRLLGRESVVSGSLPQQRAVTELQAARMTFTPLASGEV
EIRAVAYNPQVAMGLANTYVDVLQSRSRSNIREEARVSRTFIEDLLNQTKASLQESEEALAKFQRGRASKKFPDHSALEL
TQVAQLENNLTEIQASKEIAKLRLNFLRGGKDPTGKPLPSAVALAQQQLTKRLAQLQEKLAGLQERYTEGHPLVRATQAE
IKDVQAALAASSQFSPDSATASRLYLGTAERAALTKQQADVEAEIASQEAKEEVVKQRIARLSQNVSNLNAEEMEASKLL
RKVETQRNLYSTLSEKLGMVRVQEQGEDRGLRVIDLAVLPQSPSGAPAKRIIFLGVLLGLSLGVGVAAVIEYFNQPMETE
DDVSRVTGLPVLGWLPTIEGNHTQNGADREPLRFAETSGPETLEVETCRGIRTSLQALSRQRKLRTIMLASAGPGEGKST
VVLNLGWAFWEAGQRLIIVDADLRRPSLHRPFRYPLGPGLVDLLASDVPWDRVGQAVKENLLLLPAGSIEVAKPGVLLSA
EKVRHFLNLAKNQADLVIFDSAPVLAVADNLTLASMVDGVILVVRAGATQQRELVRAKSLLEKVGAPLIGVVLNQVSRRE
TRRYYRTYAGYYGVGDGRSGRKHSRSSRSWWPTVQKTSNPK
>gnl|bykdb|A0A534KE17 [Archaea] Bacterial tyrosine kinase [Euryarchaeota][Euryarchaeota archaeon] (length=854 residues).
MWCHRHRVDPVHGRMLQRRHTMPSRHCGRRRSGHERRVVHSARLVAELTVSRLRYWCESHPDTHSPSSRAHVADLSPSEP
GPQPVASAGLGLLDERSGYSMQPYGAPGAPDDAAVDWRRYWSAIVRYRWWVLLGTGLGLTGGFAAGRLLKPQYRAQATVW
IDAANNRPDASRGPIRQGQLLEPYAWVDLLQSYAVLDDVVRQLRLYLTPRARADSLALSSFDLAERFRPGSYRLAVDQSG
KSFTLTASGSIVLQRGIPGEMVGSAIGFRWTPPAAALPPGAIVSFTLVTPRDAAQRLSEDLGVKLDANGNFMRLELAGTD
PNIIAAVVNAVAQRLVAVAAELKRAKLTELTRILNDQLATAARSLRDAEGALEKFRVNTITLPAEQSTPVAPGLEATRDP
GFKNFFEMRIEREQLRRDREAVRRVLAQVADSGLAVAGLEIIGTVQRSTELTEALKELTTKQAELRALRYRYTDQHPPVK
RLEADMETLERRTIPGLAGALLEEVGTREQVLDSLVRSAGRELQQIPQRAVEEARLRREVAIAENLYTTLQQRYEEARLA
EASTIPDVRVLDAADVPHQPMKNTAPRLILLGLFGGLGLSLVGAVMLDRFDRHFRYPHQVTREMGLAILGAVPRIKRGHR
GVAPDDAHQVIEALRTVRLNLTHAYGSAGPLLVTITSPGPGEGKSFVSGNLARAFADAGQRTLLIDGDSRRGVLHRLLRA
VRKPGLTDYLAGVVPLEAVVQRTDHPALWFIGSGSRKQDAPELLGAPAMAQLLASARATYQVILIDSSPLGAGVDPFLLG
TLTGSLLLVLRSGATDRDLAHAKLDVLARLPIRVLGAVLNDVEPRGAYRYYSYL
© 1998-2020Legal notice