BYKdb

Dataset for cluster orphancd of phylum candidatus-calescamantes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A7C5XC78 [Bacteria] Bacterial tyrosine kinase [Candidatus Calescamantes][Candidatus Calescamantes bacterium] (length=213 residues).
HGIDGVRTNIELLSMRKNIIVLCFSSIPSEGKTTISLHLAKSFVNAGKRVLLVDLDLRHESLSNLLGFINSPGFVDAVTY
DMKPDNLVKEIENNLYFLPCGSRHPSPSAFLSHQKVKDFLLSLKEKFDYVVLDSSPISAVYDILNVMHLSDFNLLIVGMD
RVSKVQVKRVSTIINQVKAKIDGVVLNLVDEKVFPYISYYVNKYTYYYYYSDS
© 1998-2021Legal notice