BYKdb

Dataset for cluster orphancd of phylum candidatus-eisenbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A538TBK1 [Bacteria] Bacterial tyrosine kinase [Candidatus Eisenbacteria][Candidatus Eisenbacteria bacterium] (length=256 residues).
MARAGRNLFTGFSLDAPYVTETRRILQTLGRRTQDSGQRVFMVTSAARGEGKSTICALLSIVAAKALGRNTLLIDADLRR
PTIHHLLGMSPRPGLFEFLEGRVSFDTAMRPTLLPKLSVISSGAHPARPGEAYRDETFAALVKRVRGAFDLVFIDSAPVV
PVVEPLLMAEHVDGVIAVVMAGKTPVPLVRRMRDILTPAAQKLVGVIVNNASSQLPYYYDYRYYGYPGQEAHSRRARQGP
TIHSDSHPSGSRAYKL
© 1998-2020Legal notice