BYKdb

Dataset for cluster orphancd of phylum candidatus-poribacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A660U501      MRRRKARTLPELFNPDSPGVMEVYRVLTTIAGKGRDGLKSVLITSAMPREGKSILVAYLG
A0A660UFG0      -MRRRTRNLPELFNPDSPGVMEVYRVLATIAGKGRNGVKSVLITSAMPREGKSILAAYLG
                  **.:*.*******************:*******:*:*****************.****

A0A660U501      MTAAHSGRRTLIIDLDLRRSIQHKLFGLHRSPGVGDLLSAEEPIPLENLIKPTSMGNLHL
A0A660UFG0      MTAAHSGRKTLMIDLDLRRSILHNLFKTIRTPGLGDMLASEEPIHPNELIYHTQMENLFL
                ********.**:********* *:**   *:**:**:*::****  ::**  *.* **.*

A0A660U501      MPSGSKLSSPSGVLRVNVDRVKNLIAELSMSYDLLLVDSPPIVPVNDAELIAPLVDGVVL
A0A660UFG0      LPSGSRLSSPSGILRIRIDRVKKLIAELSVAYDILIIDSPPIVPVNDAELIAPFVDGVVL
                :****.******:**:.:****:******::**:*::****************:******

A0A660U501      VVMGGKTFREIVARAIELIRKANGNLVGMVLNNVTRALPYYYEHKYYRYRYEPRED-
A0A660UFG0      VVMGGKTFREIVARAVELIRKANGNLIGMVLNNVTRALPYYYEHKYYRYSYEAKKDD
                ***************:**********:********************** **..:* 

© 1998-2020Legal notice