BYKdb

Dataset for cluster orphancd of phylum candidatus-poribacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C3YKH9      MQEANKTDKQSTSKSISRMSFQDIMQIMLVRKWVILLVFLSAFGSTIYYIKTTPYIYESK
A0A660U501      ------------------------------------------------------------
A0A660UFG0      ------------------------------------------------------------
A0A7C2VSL0      ------------------------------------------------------------
                                                                            

A0A7C3YKH9      VLLMRETSTEKLPANIIGIDVEPEKLDKGQEMLLKSIPLLQEVQRKLSDRNISVDIKQLS
A0A660U501      ------------------------------------------------------------
A0A660UFG0      ------------------------------------------------------------
A0A7C2VSL0      ------------------------------------------------------------
                                                                            

A0A7C3YKH9      EWLSLSTPKDSTNVVQLIAKANTPEQAQAIANISAETYITKLSEMKRSELSQGLEFLKQQ
A0A660U501      ------------------------------------------------------------
A0A660UFG0      ------------------------------------------------------------
A0A7C2VSL0      ------------------------------------------------------------
                                                                            

A0A7C3YKH9      MEQIEAKNRETERALSNFRDREGIIAVTPEAESGGLLGKLGAMQSDLLQAENDVELTKTQ
A0A660U501      ------------------------------------------------------------
A0A660UFG0      ------------------------------------------------------------
A0A7C2VSL0      ------------------------------------------------------------
                                                                            

A0A7C3YKH9      LQAIEKLIEEKKKLAQTSSASGISAQMDKLRETIINLQIELSNKLETQTDKHPDVIAIKK
A0A660U501      --------------------------------------------------------MRRR
A0A660UFG0      --------------------------------------------------------MRRR
A0A7C2VSL0      --------------------------------------------------------MRRR
                                                                          ..

A0A7C3YKH9      KIEAAQAQLDSEFNKMLTGTSATSIDPITELQDLMKQYVTLTVQLNSMEKRAALMKDRLN
A0A660U501      KAR----TLPELFN----------------------------------------------
A0A660UFG0      TRN-----LPELFN----------------------------------------------
A0A7C2VSL0      RKKRKSPVLPELFD----------------------------------------------
                        * . *:                                              

A0A7C3YKH9      QFRSEHPEIASKQVELMQLERQSRIYEQAYSTLTSKYEDMRLMEQMKVAGLKVIDPAPLP
A0A660U501      -----------------------------------------------------------P
A0A660UFG0      -----------------------------------------------------------P
A0A7C2VSL0      -----------------------------------------------------------P
                                                                           *

A0A7C3YKH9      DSPISPNIRLSLAMGALLGLLLGVMLAFFLYYIDDTINTEEDAQRYLNFPVLGTIPKITP
A0A660U501      DSP-------------------GVMEVYRVL-----------------------------
A0A660UFG0      DSP-------------------GVMEVYRVL-----------------------------
A0A7C2VSL0      DSP-------------------GVIEVHRLL-----------------------------
                ***                   **: .. :                              

A0A7C3YKH9      YQVPETAINWRSSNGAVRNRDTSKNDGNLSKKSRIEMQNLLGHCILYAPKDSHKSNAKES
A0A660U501      -----TTIAGKGRDG---------------------------------------------
A0A660UFG0      -----ATIAGKGRNG---------------------------------------------
A0A7C2VSL0      -----ATIRGKGGNS---------------------------------------------
                     ::*  .. :.                                             

A0A7C3YKH9      YRNLAVNIQFSLIDEPIKSLLVTSSAPGEGKTTTACNLAITMARPDMKVLLIDADIRRPR
A0A660U501      ----------------LKSVLITSAMPREGKSILVAYLGMTAAHSGRRTLIIDLDLRRSI
A0A660UFG0      ----------------VKSVLITSAMPREGKSILAAYLGMTAAHSGRKTLMIDLDLRRSI
A0A7C2VSL0      ----------------LKSLLVTSPMPREGKSILTAYLAMTSAHLGRRTIIIDLDMRRSI
                                :**:*:**. * ***:  .. *.:* *. . ..::** *:**. 

A0A7C3YKH9      LHRILRQNRLPGLTDILVSGVEDNGHLLSDCIHTTTVNNLYLLPCGSHISNMESLL--AS
A0A660U501      QHKLFGLHRSPGVGDLLSA--EEPI-PLENLIKPTSMGNLHLMPSGSKLSSPSGVLRVNV
A0A660UFG0      LHNLFKTIRTPGLGDMLAS--EEPIHP-NELIYHTQMENLFLLPSGSRLSSPSGILRIRI
A0A7C2VSL0      QHRLFGVNRSPGMGEYLTA--DPPYKDIGGLIHATSMKNLFLLPSGKRLSSPGGVLRVNV
                 *.::   * **: : * :  :         *  * : **.*:*.*..:*.  .:*    

A0A7C3YKH9      QKMAQLIDTMRQQYDMIILDSAPILSVADSVAISNKVDGVLLVLFSGKTDSRTANRSIDV
A0A660U501      DRVKNLIAELSMSYDLLLVDSPPIVPVNDAELIAPLVDGVVLVVMGGKTFREIVARAIEL
A0A660UFG0      DRVKKLIAELSVAYDILIIDSPPIVPVNDAELIAPFVDGVVLVVMGGKTFREIVARAVEL
A0A7C2VSL0      NRVNELIRQLSAAFDMLLIDTPPIVPVNDAELIGPLVDGVILVVMGGKTFREIVQRAVEL
                :.: :**  :   :*::::*:.**:.* *:  *.  ****:**::.***    . *::::

A0A7C3YKH9      LKRVNANIIGTVVTDVNYAKHYGYYRYYRYYYHYYHHYGAESEKDEG
A0A660U501      IRKANGNLVGMVLNNVTRALPY-------YYEHKYYRYRYEPRED--
A0A660UFG0      IRKANGNLIGMVLNNVTRALPY-------YYEHKYYRYSYEAKKDD-
A0A7C2VSL0      VRKSNSNLLGMVLNNITKAMPY-------YYEYKYYRYKHESK----
                :.. *.*::* *:.::. *  *       ** : *:.*  *.     

© 1998-2021Legal notice