BYKdb

Dataset for cluster orphancd of phylum euryarchaeota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A534KDQ0 [Archaea] Bacterial tyrosine kinase [Euryarchaeota][Euryarchaeota archaeon] (length=262 residues).
MGASGSRWSARSCSIGLTRASATRSRCRTNSEVVEALRGLCLNLVHAHGAAGPLLVTITSPGAGDGKSFLASNLALTFAD
GGHRTLLVDGDLRRGLLHRRFNANRKPGLIEFLHGDAAREQIVQPTSYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALR
QEYDVILIDSPPLGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYYSYYSYY
LPGYEAVDEDDSLEAHSRPRVV
>gnl|bykdb|A0A662KRR8 [Archaea] Bacterial tyrosine kinase [Euryarchaeota][Thermoplasmata archaeon] (length=413 residues).
MDLLKDVLFNQVAVIELETKANEYKKLVEKYTKEFNSLPAKSLKYARLDRERQVNDKLYMLLKTKYQESRISEASKMSNV
RIVDPAIPPEEPVKPNKRLNLILGLLVGLFLGVGIAFIREYFDRSVKTAEELQSYGLSAVAIVPEIDVKTALERFQKISR
DPESEEPLKARLVTHYDPKSSVAEAYRTLRTNIQFSSPDKPIKTLVISSAGPGEGKSTTVANLAITFANLGKKTVLIDAD
LRKPILHKVFDMQRDPGLTHAIIGSHAIDDVVKKTEIDNLSIITCGEIPPNPSELLASYKLSSILGELREKYDVVLFDSP
PVIAVTDATILSTVTDGILLVVRANKTDTRALQRAVELLSHVKCNVLGAVLNGVSVSGGYGSYYYYYHYYYYYGDGHRKK
KRAKRKKRETRAY
© 1998-2020Legal notice