BYKdb

Dataset for cluster orphancd of phylum euryarchaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A534KDQ0      ------------------------------------------------------------
A0A662KRR8      MDLLKDVLFNQVAVIELETKANEYKKLVEKYTKEFNSLPAKSLKYARLDRERQVNDKLYM
                                                                            

A0A534KDQ0      ----------MGASGSRWSARSCSIGLTRASATRSRCRTN--------------------
A0A662KRR8      LLKTKYQESRISEASKMSNVRIVDPAIPPEEPVKPNKRLNLILGLLVGLFLGVGIAFIRE
                          :. :..  ..*  . .:.  ...... * *                    

A0A534KDQ0      -----------------------------------------------------------S
A0A662KRR8      YFDRSVKTAEELQSYGLSAVAIVPEIDVKTALERFQKISRDPESEEPLKARLVTHYDPKS
                                                                           *

A0A534KDQ0      EVVEALRGLCLNLVHAHGAAGPLLVTITSPGAGDGKSFLASNLALTFADGGHRTLLVDGD
A0A662KRR8      SVAEAYRTLRTNIQFSSPDKPIKTLVISSAGPGEGKSTTVANLAITFANLGKKTVLIDAD
                .*.** * *  *: .:        :.*:*.*.*:***  .:***:***: *:.*:*:*.*

A0A534KDQ0      LRRGLLHRRFNANRKPGLIEFLHGDAAREQIVQPTSYPWLYLIGCGTRTNRAPELLGSAA
A0A662KRR8      LRKPILHKVFDMQRDPGLTHAIIGSHAIDDVVKKTEIDNLSIITCGEIPPNPSELLASYK
                **. :**. *: :*.***   : *. * :::*: *.  .* :* **  . ...***.*  

A0A534KDQ0      MGQLVAALRQEYDVILIDSPPLGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLN
A0A662KRR8      LSSILGELREKYDVVLFDSPPVIAVTDATILSTVTDGILLVVRANKTDTRALQRAVELLS
                :..::. **::***:*:****: * .*. **.***..:***:*:. :   *    :*:*.

A0A534KDQ0      RLPVRTLGAVLNDVPRGAAYG----YYSYYSYYLPGYEAVDEDDSLEAHSRPRVV
A0A662KRR8      HVKCNVLGAVLNGVSVSGGYGSYYYYYHYYYYYGDGHRKKKRAKRKKRETRAY--
                .:  ..******.*. ...**    ** ** **  *:   .  .  :  :*.   

© 1998-2020Legal notice