BYKdb

Dataset for cluster orphancd of phylum candidatus-saccharibacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A563BX74 [Bacteria] Bacterial tyrosine kinase [Candidatus Saccharibacteria][TM7 phylum sp. oral taxon 351] (length=250 residues).
ALQEKLAAEKEAEEAEIDETETDEIDEDSELVLRDNPKSKVSEDFRTIRTSLYFSLNNKKSNTVLITSSTPNEGKSFIAS
NLAVAFAKTQKKVLLVDCDMRLGRQHEIFALSNKAGLSNLLAENEAKAYEKYVQKTSVKSLSVITRGVVPPNPSELLDSS
DMEELLNEAKEKYDYIILDGTPLDGLSDSLILAKKTDRTVVVCSANITTIEDLQNSKKALEAIDVKVSGVVLNRTVDERR
GDYYNKYYSY
© 1998-2020Legal notice