BYKdb

Dataset for cluster orphancd of phylum candidatus-fermentibacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A163UNQ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Fermentibacteria][Candidatus Fermentibacter daniensis] (length=476 residues).
MAGEIASINDSYIDTLQEELALLEASRATLLARGAQPDDPALTELEEEISIRTEALSSSLEGLVRARYPENPSAAVQSLV
GEIIRVEADLRAETTRESVLRAQASSLESDLSRLPAAEMNLARLQRNRLVSENVYLLLRNKYEEIRIAEAGQIGNVTIID
TALPGNMIRPSRRKNLMMGLLVGLALGLGTVFLKQQLDTSISSPEQVEALGVSILGVIPHLPKSALASRASRTVPSSTLV
THFAPRDPISEAYRDLRTSLKFARADQPLESILITSAGPREGKSTTSANLAVAFAQSGRRCILVDADLRRPVIHNIFGLD
REPGLSEAAAGVTPLAECVRKTSIDNLSILPSGFIPHNPSELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTDALLLSP
EVDGTLLVVGAKLGNRRVLQTSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYTYRYYYPYYNPEGQGRGKGRRTR
>gnl|bykdb|A0A496UDX9 [Bacteria] Bacterial tyrosine kinase [Candidatus Fermentibacteria][Candidatus Fermentibacteria bacterium] (length=759 residues).
MVEGCCRLQLQASRYGECDSVNEQNMSAVHPDTYPGTPDHSEEESLDLNFYLWMFLRGKWVILAFVLAGLLVAGYVNKTT
TPVYRSSSTFMYTTDNSMSRTLDMPGTFWFQMDALRNDQIHLINSRIMAELVADSILHSSDSDSIISVLFLGDIPERPYI
RNALVSLAQSTVSVSWIKDTNFFVLSGSGYSPEASAVITNLFLFVYDKWNKQQARGENTEVRLFLEEQLQHTSQQLDLSE
SALLQFKEEHGITDIDTETRDLITTLSSFETQARTAATNAAAARVRRDYLNGLLGEQRETVTGDIVSSNSEYIDQIQSDL
ARYESARAALLADGAGNESEPVRAMEQRIDTRTQELAEALQDVAGMNYPANPQRGIEGLVSSIAEAESEYRSSTAREQAL
RAVVNDLSAGMTELPEFQYELVSLERNRRVNENIYILLRTRYEEVKIAEIGQMGNVTIVDSALPGGMIKPTTRRNLIMGI
MVGLAAGIGIVFLFHQMDTSLRNPEQLERLDIPLVGVIPESSQKTGGDRIPLMLLERSKSPNAEAIRDLRTSLSFSRPEQ
GIKSLLVTSSGPREGKSSVSANLAVAEAEAGKKVILVDCDLRRPTVNKTFGFKRKPGFTELISGKATIDEVVKKTEVEGL
FVICSGHIPHNPAEMVETAVKKGVFSQIAEACDMLIIDTPPAAVVTDAVVIAPAVDSVILVVRSGKIQKKVVQGVWQKLL
RSGGHLSGAVINGFDPIRTYTSYTYYTYKYQYYYEEQSE
>gnl|bykdb|A0A496UIN1 [Bacteria] Bacterial tyrosine kinase [Candidatus Fermentibacteria][Candidatus Fermentibacteria bacterium] (length=729 residues).
MNDGNFQEERESINISEYLWLLYHNKWIVLGFLIISITASIWMTSRIRPLFRSSATFIFDVSSNMTQTLNMSNVFWFEMD
PMRNNQIQIIRSRSMAESVADSILRSPNSDSLLTILFCDLTVPQNNLRGSLIGMVRGSISVSIMKDTDFFVLSAIGYSPV
AAATMANLMVGTYFRRNLTDARGENTLVKEFLSEQLDIMEIELAESEDSLTLFKEEYGILSLSTETAQIVRNLSIFETAA
ATSRTEQGALQAQKTYYSDQLEVGRINLPEDIANLNTAFIAQLENDIATLESSRASLMSRGGTEDDNVIMDLDTQISVRR
EALTRALEEAAYSRYPNDPAQSLQGIVSQLVTVESQLRAERIRESVLRSIVLDLEDSISVLPELELRLTRLERNWRVSEN
IYLMLRTKYEEVRIAEAGQIGNVTIVDTALPGGMIKPNKKRNLILGIFAGLAAGIGFIFLKEQLDTSVKNPEDIENLGIP
VIGVVPKVPRSDVTIPGGKQGLIMITAPRQAASEAYRDLRTSLRFSAIEEGIHSILVTSAGPGEGKSTTAGNLAVAIAQA
GSRVLIVDTDLRRPILHKVFGLKQEPGFTETITGMKTLEEAVNSTSIENLSILTSGHIPHNPSELLGSRKFKRLHALLKE
SYDMVIFDSPPIAVVTDPVVMSPEVDATLMVVGVKKIDRRVLKSAWEKLRRGSGHCVGAVLNGFDPLNTYTSYNYYTYKY
HYYYHDKKK
© 1998-2020Legal notice