BYKdb

Dataset for cluster orphancd of phylum candidatus-poribacteria

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bykdb|A0A660U501 [Bacteria] Bacterial tyrosine kinase [Candidatus Poribacteria][Candidatus Poribacteria bacterium] (length=236 residues).
MRRRKARTLPELFNPDSPGVMEVYRVLTTIAGKGRDGLKSVLITSAMPREGKSILVAYLGMTAAHSGRRTLIIDLDLRRS
IQHKLFGLHRSPGVGDLLSAEEPIPLENLIKPTSMGNLHLMPSGSKLSSPSGVLRVNVDRVKNLIAELSMSYDLLLVDSP
PIVPVNDAELIAPLVDGVVLVVMGGKTFREIVARAIELIRKANGNLVGMVLNNVTRALPYYYEHKYYRYRYEPRED
>gnl|bykdb|A0A660UFG0 [Bacteria] Bacterial tyrosine kinase [Candidatus Poribacteria][Candidatus Poribacteria bacterium] (length=236 residues).
MRRRTRNLPELFNPDSPGVMEVYRVLATIAGKGRNGVKSVLITSAMPREGKSILAAYLGMTAAHSGRKTLMIDLDLRRSI
LHNLFKTIRTPGLGDMLASEEPIHPNELIYHTQMENLFLLPSGSRLSSPSGILRIRIDRVKKLIAELSVAYDILIIDSPP
IVPVNDAELIAPFVDGVVLVVMGGKTFREIVARAVELIRKANGNLIGMVLNNVTRALPYYYEHKYYRYSYEAKKDD
>gnl|bykdb|A0A7C2VSL0 [Bacteria] Bacterial tyrosine kinase [Candidatus Poribacteria][Candidatus Poribacteria bacterium] (length=239 residues).
MRRRRKKRKSPVLPELFDPDSPGVIEVHRLLATIRGKGGNSLKSLLVTSPMPREGKSILTAYLAMTSAHLGRRTIIIDLD
MRRSIQHRLFGVNRSPGMGEYLTADPPYKDIGGLIHATSMKNLFLLPSGKRLSSPGGVLRVNVNRVNELIRQLSAAFDML
LIDTPPIVPVNDAELIGPLVDGVILVVMGGKTFREIVQRAVELVRKSNSNLLGMVLNNITKAMPYYYEYKYYRYKHESK
>gnl|bykdb|A0A7C3YKH9 [Bacteria] Bacterial tyrosine kinase [Candidatus Poribacteria][Candidatus Poribacteria bacterium] (length=765 residues).
MQEANKTDKQSTSKSISRMSFQDIMQIMLVRKWVILLVFLSAFGSTIYYIKTTPYIYESKVLLMRETSTEKLPANIIGID
VEPEKLDKGQEMLLKSIPLLQEVQRKLSDRNISVDIKQLSEWLSLSTPKDSTNVVQLIAKANTPEQAQAIANISAETYIT
KLSEMKRSELSQGLEFLKQQMEQIEAKNRETERALSNFRDREGIIAVTPEAESGGLLGKLGAMQSDLLQAENDVELTKTQ
LQAIEKLIEEKKKLAQTSSASGISAQMDKLRETIINLQIELSNKLETQTDKHPDVIAIKKKIEAAQAQLDSEFNKMLTGT
SATSIDPITELQDLMKQYVTLTVQLNSMEKRAALMKDRLNQFRSEHPEIASKQVELMQLERQSRIYEQAYSTLTSKYEDM
RLMEQMKVAGLKVIDPAPLPDSPISPNIRLSLAMGALLGLLLGVMLAFFLYYIDDTINTEEDAQRYLNFPVLGTIPKITP
YQVPETAINWRSSNGAVRNRDTSKNDGNLSKKSRIEMQNLLGHCILYAPKDSHKSNAKESYRNLAVNIQFSLIDEPIKSL
LVTSSAPGEGKTTTACNLAITMARPDMKVLLIDADIRRPRLHRILRQNRLPGLTDILVSGVEDNGHLLSDCIHTTTVNNL
YLLPCGSHISNMESLLASQKMAQLIDTMRQQYDMIILDSAPILSVADSVAISNKVDGVLLVLFSGKTDSRTANRSIDVLK
RVNANIIGTVVTDVNYAKHYGYYRYYRYYYHYYHHYGAESEKDEG
© 1998-2021Legal notice