BYKdb

Dataset for cluster tad of phylum all

[Download (right click)] [Edit] [Sequences] [Repertoires]

500 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      MYGAAIAFGTTLVVSNGIGPAGAGEFFRLMALFAIATSTAVFGADTGLVRTISAQNALGR
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      YSAIPRLIRYAVLPPLALSLGITAVACIYSVAVPMPHEYAVALRMSALFVIVAAVMSVYF
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      GALRGLNHVVTFTVMQNVLLPTLRFGAIALVVFASGHLLDLVFAWTLPVAATALLTLWVV
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ESYMPRSKDRPQSEAAATTPQESAHSFWTFSSARGVATIVETILEWIDVLTVTTVLGPAA
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      GGVYGAVNRCVRVGTMVEHTGRIVTGPSISAALATQNIDRARQIFLATTRVLTAISWPFY
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      LTLAAFGPTLLGFFGKGFEEGAGILWVICPAAMLSMSAGGVQSILLMSGKSRWQLLNKLS
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      SLAVAIILNVALVPLWGLYGAVTAWASALLIDTFLASYQVFRLVGIRTSLTEMAPALTLG
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ALVPLGCSFVVLTVVGQGLLGLVLYVILLAPSYVALLYYFRTQLGIERFLASRKGGGKGA
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ---------------------------------------------MNSSIGKGGTLPGHE
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------MNSNRV
D5HFS3      ------------------------------------------------------MNSNKK
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      --------------------------------------------------------MSTE
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------MELINN
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------MNFRKG
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      -------------MNQTNQN--LKSDDEVIELGIYINVIKRAKWRILSFAIVVTLLA-I-
G9RSY8      ----------------------MKEEYETIDLLEILRLLKKNLLVILAVTILLAVAGYL-
F3CAY8      -------------MTVMNRPSLDFHQDSRIDLAAVLRMLFDHKALILWTVSLFFLIG-L-
I0UTA4      GTRSALAHQLSIQGENTMSKLSATTDAPAVSLREQLHRVWRHKMIVIITIVVCTLIAVA-
E9TE87      ---------MTEKVKQHAAPVTGSDE---IDIGRLVGTVIEARWWVIGITAVFALCA-V-
E6PYQ4      ----------MTKFPSSNTNQFADNP---IRVADVARLIRKYGIYVLGSTMLGAILF-A-
C0QCJ1      ----------------MQQIQQNQLP---ITPAQIIDILIRRRWIIVIPLCITLTVG-L-
I5B297      ----------------MADPFQSQTQ---IKPDYIIDVLIRGRWFLIVPLCISLTLG-L-
B8D0N1      ---------------MDNIPHNYEYE---IDLTEYLGILNKRKWLILAITILAGVMG-Y-
D9QTC7      -------MDNLERQTTDSDITEDMVE---IDLREYFTILWKRKMIIIGLLIVAIIGS-L-
C7LPS4      --------------------MNHELY---QQFERYARILLQRKRVVVVVALLVMTLG-V-
Q314L4      -------------MNTMLDDVEAGGG---LDILRYIRLLWEHALAFWLMAAVVMLAA-L-
G0VNK5      ---------------------MEEIT---IDLKDLFQVVMDHKKKIAAITAAFMIAG-G-
D2RIR1      -------------------MNEQE-----IDLRELWQIVRTNQKTIAKITGGFLGLA-V-
I0GRR3      -------------------MDDKEVT---IDLREVWDLMVTGRMKIAKITALFLVAA-G-
Q39U16      ---------------------MVSKT---EELNKYLKMLMKRRYLFIVVSLVVMSVI-A-
F0JCB9      ------------MTDNKLETPGAEAS---FDVMHYVQLVGNHRGLFVFIVLLAMFIA-I-
G7QCG0      ---------------------MSAFL---KEFHHYKQLIYLYKELFLAVSLLIMTGA-I-
I2Q342      ---------------------MSAFL---KEFHHYKRLIYLYKELFLAVSLLIMTGA-I-
Q74BQ7      ---------------------MQQSE---FDYRHYLTLIVARKRLFVVVALAVMAAA-V-
B5EA80      ---------------------MQSPE---TEYKKYLQLLISNKERFVVIALLLMTVA-F-
C6DZX6      ---------------------MQSPE---TEYKKYLQLLFSNKERFVVIALLLMTVA-F-
A1ARV9      ---------------------MSDSE---FDYKKYLELIVRKKELFVKLALLIMTIA-I-
E8WSZ4      -----------------------MQE---SEYKKYTQLIARRKEFFVVAALLIMTLV-F-
A5G425      --------------------MSTTNE---LDYKKYLMLIDKKKKLFIITALAIMTVI-T-
B9M2X7      --------------------MPTTND---FDYKRYLNLVKQRKTLFLVTALAVMTIT-V-
C2MBF7      -----MEYATDSIQQEPARSLEEAST---LSLQDILMILKANWLFILLSLIVCLTLG-F-
H8YYB8      ---------------------MEEQL---LSLDDYIAILKRRKWQLIIPAVLLSIVG-M-
B7B948      -----------MNTEQETNTRVEESE---LNLGDILQTVLANWYWFVLSVVVCAGAAFL-
G8AU95      AHASVLPDSLLQSGAAESSDVRSRQE---ATVFATLAVLWRRKLLLLTIILLGTATI-T-
G5IFS2      ----------------MGTNQDDEIE---IDLKELFFVMRRKLWVLILTGMLGAAVSGI-
F0G6H6      --------MSHLTMPESRGGPTARPP---HPFRRYWGMLYGGRRTIVASALICVAAG-A-
A3W0H6      --------MSAI-----------------QSFPDLIRLLHRKLWLIVLVAVVGAILS-I-
A3K8W6      --------MSQF-----------------QSVGEVFAALRRRAWVILGIFLVGCVIS-V-
Q0FMP1      --------MNQF-----------------QSIGEVLSALKRRALLILLVTVLGSAAS-V-
S9QRP2      --------MTQF-----------------QSIESVFAALRRRAWIIILVTVVGCALS-V-
F4SM98      -----------MPLIKNKKLDKDADE---IDLGRIIGELIDHRKLIIAVTALFTFISLL-
C4Z673      --------------MQEKSKETENIE---IDLREIFGVLIHRLWIIVVAALVCGSVAFM-
E3H7M4      ------------MQDNNKKEREKNEIRKEIDMVELFMIVKQNWKVLFRTIFIMVALGFT-
F8KGP2      ---------------MNSSQQTANNT---IDLHRLMMLCRKHIKMLIIWTLLAGVLGYV-
B3XL22      ---------------MNSSQQTANNT---IDLHRLMMLCRKHIKMLIIWTLLAGILGYV-
F8DRU3      ---------------MNSSQQTANNT---IDLHRLMMLCRKHIKMLIIWTLLAGVLGYV-
C2EWM2      -----------------------------------MEICRDHAKLFILWTVIMGIVGFV-
D0DSJ3      -----------------MESEKNTNA---IDLQHLWKLFVQHVRMILIWTVGLGVIAWG-
B2GF32      -----------------MESEKNTNA---IDLQHLWKLFVQHVRMILIWTVGLGVIAWG-
C0WW25      -----------------MESEKNTNA---IDLQHLWKLFVQHVRMILIWTVGLGVIAWG-
F0K0J8      --------------MSAEQQNNEEVT---IDLRRLFILIKKHIISILIWMIGLGLIAYG-
G6F8H0      --------------MSAEQQNNEEVT---IDLRRLFILIKKHIISILIWMIGLGLIAYG-
F0HVF2      --------------MSAEQQNNEEVT---IDLRRLFILIRKHIISILIWMIGLGLIAYG-
Q1G8E3      --------------MSAEQQNNEEVT---IDLRRLFILIKKHIISILIWMIGLGLIAYG-
D6S4X3      -----------------MEQIHENNT---IDLAQLLKLLRRHIGSLLIWSLGFAIIAWG-
Q5FIC6      ---------------MEQKQEQ-ENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
E4SMV6      -----------------MEQKQ-ENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
F0TGY3      ---------------MEQKQEQ-ENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
F2M2M7      ---------------MEQKQEQ-ENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
A4ZGZ7      ---------------MEQEQKQTDNT---IDLTQLLQLCRRHIWALILWSVGLALVGWG-
C2EPK4      ---------------MEQEQKQTDNT---IDLTQLLQICRRHIWALILWSIGLAVIGWG-
C7XKF2      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWG-
E3R265      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWG-
D0DJG9      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWG-
D5GZJ9      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWS-
A8YX90      ---------------MEQEQKQTDNT---IDLTQLLQLCRRHIWALILWSVGLALVGWG-
F0NWJ8      ---------------MEQEQKQTDNT---IDLTQLLQLCRRHIWALILWSVGLALVGWG-
C2JZS0      ----------------------MNEQ---INLSQLWDVLKKSFIAMILLGLIGMAVAYF-
C1J9I2      ----------------------MNEQ---IDLAQLWNVFKRSFLAMIVFGIIGMAAAYF-
Q58Z11      ----------------------MNEQ---IDLARLWNVFKHSFIVMILLGLLGMFIAYF-
B1MZT2      ----------------------MNNV---LELRQLWDIIRKHFFAIFFMALIGAGIGYG-
C2KHF2      ----------------------MNNV---LELRQLWHIIQKHFFAIIFMAIIGACAGYG-
Q03W94      ----------------------MNNV---LELRQLWQIIRKHFFSIVVMAIIGAAAGFG-
C6CW36      -----------------------------MEIKQYFRIVLKKWWLILILVLLASVISGI-
A8SQS9      ETTERDTGTQPSALSAYKAAEGEENE---IDLLDMGMALLEKLPYIILCFLVGAVLFNA-
D5HFS3      MAAVQDETTQIAAVNTYKNTEDDENE---IDLLDMGMALLEKLPYIILCFLIGAVLFNA-
B9Y883      ------------------MYENDEIE---IDLSRVFEIIKKYFKPFALIILAASIVAAL-
A5Z5P8      --------MKQQVEKIKINEKEDEVE---INLLDLFNYYRKKILFIIAGFLIGAIIAGV-
G2KUP2      -----------------------------MSFSFLGLIIKRHLKLILSSIVFFVAISSF-
G8PE07      ------------------MET--EQQ---ISIGQVLSTLRRHIGLIAASTVIVTLLSVL-
E0NHP5      ------------------METAETQQ---ISIGQILAILRKHIGLIFASTFIITLLAAL-
Q03GL9      ------------------MESVESQQ---ISIGQILSILRKHIGLIFASTFIVTLLAAF-
C6CSC7      ----------------------MSEE---LDLREYFLIVRKRLLLIVIFVLVCTVASGV-
C6CS79      ----------------------MSSQ---LDLKEIVWLIRKKLWLVVLVTVLGASAAGA-
F5LM70      ----------------------MSID---FEIKRYLAVLRKRLWLILLIVAAGCLITGV-
G0LYN8      -------------------MMDQTVS---FGF--FIRLVRKYWLTIVSFTVAGLIVAAG-
F6ITB3      -------------------MMDQAVS---FDF--FIRLVRKYWRAIIGFTVAGLIVAAG-
G0M1Y0      -------------------MMDQAVS---FDF--FIRLVRKYWRAIIGFTVAGLIVAAG-
D7VC12      -------------------MMDQAVS---FDF--FIRLIRKYWRAIVSFTLVGLIVAAG-
F9UMZ5      -------------------MMDQAVS---FDF--FIRLVRKYWRAIVSFTVVGLIVAAG-
D4JI68      --------------MEREQDFDNEIE---IDLKDLFLEIISYWQWIILVTIATGAVAFA-
D6E329      --------------MEREQDFDNEIE---IDLKDLFLEIISYWQWIILVTIATGAVAFA-
Q1AUN7      -------MSTDTTTAREAAPAGRDAF---FSAKEFLKVLRR--RAWAVVFVASALAASA-
H4GK02      --------------------METSNT---IDLRRLVKILRKNLLMLIVWTLGLGIIAAA-
F6IR92      --------------------MEQIIT---FDF--MVKLVRHYWKVLLSLTLLGGLIATV-
G0M0G0      --------------------MEQIIT---FDF--MVKLVRHYWKVLLSLTLLGGLVATV-
D7VBW5      --------------------MEQVIT---FDF--IVKLIRQYWKVLLSLMILGGTIATV-
F9UQ55      --------------------MEQVIT---FDF--IVKLIRQYWKVLLSLMILGGTIATV-
D4YHG8      --------------MLEEDEMNDTQE---ISLIEILNILTANIWKIISTTVIGIVLAAL-
F7V793      ---MNQENNTFDKQKERRLHSSEQTE---IDLGELFFCFLTRWKVLVLAFVIGAVAAGG-
C3WFM8      ------MSRKKKYEDYDEEFENDEDE---IDLADLIFTLIRRWKLIVLTAIPVVILGVI-
H7F1R6      ----------------------MEET---MNVKRLWGLLKKNKWLIFMSTCVCILLMSV-
H7F570      ----------------------MEDN---LNVKQLRNLVKKNKWILLACVSISTLLMLM-
C6LCS6      --------------MEENTSYTNEIE---FDLKAIFTAVRDRIFLLILVAAAGMIITYL-
A7VF43      NKRVSESDTAKEEKNNYIRVVQAEEDDKEIDLVDLGYALMDKLHFIVLSFLLGAVLLNA-
A7Z922      ----------------------MNEN---MSFKELFDIIKHRFLLIFIMTAVVTLVTGY-
I2CAF3      ----------------------MNEN---MSFKELFDIIKHRLLLIFIMTAVVTLVTGY-
I2HVL3      ----------------------MNEN---MSFKELFDIIKHRLLLIFIMTAVVTLVTGY-
E0U2Z4      ----------------------MNEN---MSFKELYAIVRHRFVLILLLTIGVTLITGF-
D4G1R3      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTLIMGF-
G4EQZ6      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTLIMGF-
P71050      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTLIMGF-
G4P115      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTVMTGF-
A8FHM0      ----------------------MNEN---IGFKQLFSVIKEKMALLILIVLIVTGISAY-
C0EBA5      ----------------------MNEG---LDLKQILRILVKRL-WIIVLCLIVGGLGAFS
B7BDT7      -------------MATQNNISRPKQTDDFIRIQDLFYLCLNRWYWFVI-SLAVTVGVAV-
H6LKR9      --------------------MNKTGE---VDLKELFRIVLKKWWLIILLTIVGFVGAYF-
F5LE49      ------------------------ME---SGLNQYIQILRKRIWLIIITVFVVTVMSGI-
F3AHH1      --------------MEMNQPKDNEIQ---INVREIFFALLSKMGVILLSGVLLAVLAVT-
F3Y921      ----------------------MEET---ISIQEIIKTIKSHIGFIFVCAILGVGISGI-
G4L593      ----------------------MEET---ISLSEIFDVLKKYWTTILTSLFAGLALAAV-
E6LD65      ----------------------MEKT---YTVKQLLDMFKKHIQLILTCMFAGLALSGV-
C9ALZ8      ----------------------MEET---ISLKEIFETLRKHVITILISMFAGLAISGI-
C9BUG6      ----------------------MEET---ISLKEIFETLRKHLVIIIISMFAGLAISGI-
Q3XYS7      ----------------------MEET---INFKEIFETLRKHLLTIIISMFAGLAISGI-
C9B453      ----------------------MEET---ISLKEIFGTLRKHLATIIISMFAGLAISGI-
D4RJF5      ----------------------MEET---ISLKEIFETLRKHLVTIIISMFAGLAISGI-
C8ZXT8      ----------------------MEET---ISLKEIFDILRKHLAAIFISLFAGLAFAGI-
F0EKB8      ----------------------MEET---ISLKEIFAILRKHLAAIFISMFAGLALAGI-
C9A6V4      ----------------------MEET---ISLKEIFAILRKHLAAIFISMFAGLALAGI-
C9CHY7      ----------------------MEET---ISLKEIFAILRKHLAAIFISMFAGLALAGI-
E6UHY5      ---------------------MEGKE---ISIQEILGILLSHIRMIIVVTILAGIVGYS-
E9SAU2      ---------------------MEEKE---ISVQEILGILLAHIRLIVIVTVVAGVAGYS-
F7K0U2      ----------MNQNNTNMGMENDEIT---IDLMDLFQVVFKKLHLVLLAGIIAALVAVL-
O06029      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
G8P3D6      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
A9QSJ3      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGGI-
F9VC43      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
G6FD41      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
G9M881      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
Q3ZK51      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
Q83VG0      ------------------MQETQEQT---IDLRVIFKIIRKRLGLILFSALIVTILGSI-
C6LDI9      NPGL----------------KNDEIR---INLIELFYALLHKMKVIIFAVILGAAAAFT-
G5F9H3      ------MEKVYQ--------DDDEIE---IDLRELLFEMKKKIWFIIAGLLIGAAITGA-
C0CZV8      -------METYMN-------DNEEIE---IDLFELFMELKRKIWVILGVAVLCAGAAGA-
G5GFW1      ETAVSTGSSFYIPLEMVNNINEEEIQ---LDIFEVLYALKKRFFLLLFSTILGFGIFGA-
H1LCW2      ----------------------MENY---LDLRQILGIIRKHIIFIMISFILCLIIAVG-
I5AV00      ----------------MDNRKNAQIE---IDLGAIMHLLFTKLPVIVITSAIFLLANLL-
H6NE44      -----------------------------MEVKHYLQILRRYIWLILGVTLITSLCTAL-
F4BS20      ----------------------MMNT---IGMVDIFKMLKKRWWVIVLLSLIGIALTTA-
E0RZL4      --------------------MNNRDDVLEINLGELFAVLMGRAFLIISAGIFFALAGLF-
C0CK72      ---------------METEHLNDELE---IDLIDLLLYLKRKIWLLLLGLLAGVLLSAL-
D9S1J8      ----------------MEEINIYEEE---ISLREIISVLKKRLRLITVVVAICIMAAAT-
C2EFR7      ----------------MDNIKKEYRE---LDLFEIFQMLLRHWWIILLSGLLCGLAAFT-
Q1WTC7      ----------------MDNIKKEYRE---LDLFEIFQMLLRHWWIILLSGLLCGLAAFT-
B0P2G1      ---------------MYELENDDEIE---IDLRELFLALKKKIVWILLTAIVFAGASGL-
D4MW28      ---------------MYELENDDEIE---IDLRELFLALKKKIVWILLTAIVFAGASGL-
E5VMX9      ---------------MYELENDDEIE---IDLREMFLALKKKIVWILLTAIVFAGASGL-
F2I6Z8      -------------------------------MASFFRGLKRQWLFIFLGILLGIVVASA-
E6U7N3      -------------MNETNEPTSYDQE---LDLGRLLLILKRGWLPILLASFLGLIVAFS-
C4Z8M6      -----MRGYVMEREQDFDN----EIE---IDLKDLFLEIISYWQWIILVTIATGAVAFA-
D4JMC3      ---------MENNEPIRDQ----EIE---IDLLALFHELVKHWKALVASMVLLAAVFGL-
D6E0V3      ---------MENNEPIRDQ----EIE---IDLLALFHELVKHWKALVASMVLLAAVFGL-
E3GPC7      -----------------------MEE---ISLHDILDMLKENWKFIVILTLCFMIVVSV-
A6BIG6      ------MSQDNNIIVLNQEADEEEIS---VNIAELIHVLCSKIHIIVLSAILTALVAFL-
C2CI43      ---------------------MNEQE---IDLIELSKKLVKHLPMIFLFAIVIGALSFV-
D4RX68      -----------MMEKLENKNKNDE-----IDLMKILRMLASKWMFIVITAVVLAGAAFI-
D4J4T5      -----------MEKKRNDN---EEME---IDLLELLMVMKKHLSAILLAGIVGLVIMFA-
I5ASF9      -----MEERAAVIQNLNLQDDGGEME---LDLVELLYEIRKKIWYVILFALIGASIAAG-
C0C0F9      ---------MNQNSVANREFENDEIN---IDLTELFLAVWSKIHLVILAGIFMALLAFA-
B6W7H3      ---------------------MDERE---IDLLELAKKLRQHLFSILCLAVIFAALSYA-
C7RGH5      ---------------------MNEQE---IDLIELSKKIGKHLPMIIIFSIIVGAASFL-
F0GT82      ---------------------MNEKEIYLIDLVDLIKKVFKHLFLIIILTILFGLGSFA-
F3AH93      -----------MEKKMEEQ------S---IDLIEIFYVLKQKILWILAAGLLFGCGAAA-
B0GAL4      -----------MGKNYDND----EME---IDLLELFYVLKSKILAILGVGLLFGCIACA-
G1WUK1      -----------MGKNYDND----EME---IDLLELFYVLKSKILAILGVGLLFGCIACA-
D4M2S1      -----------MGKTHDDD----EVE---IDLRELFYALKKRILVILAAILAGAVIAGA-
E7GL80      -----------MEKITHQHLDDDEIV---IDFRELFYEFKRRIWWILLAAVLGTGAAGA-
G5F9E3      -----------MEKITHQHLDDDEIV---IDFRELFYEFKRRIWWILLAAVLGTGAAGA-
D4CG07      -----------MEKNRYEE----NDE---IDLLELFYELKKKLWLIILAAIIGGGAFGL-
D4MP31      -----------MEKNRYEE----NDE---IDLLELFYELKKKLWLIILAAIIGGGAFGL-
G5HNC6      -----------MENKLYEDRDENEIE---IDVMELLYVFKKKAWIIILAAIAGCMAAGL-
A8RK86      -----------MEKRYRED----DME---IDLLELLFEFKKRAWVIILAAVLGCLGAGA-
G5HTB1      -----------MENNIYEDRNENEIE---IDVLELLFVFKKKAWVIILAALAGCLGSGI-
A8RSL0      -----------MEKTYDDD----EIE---IDLLELLGEFRRKIWIILGTIILFGSVAGA-
C5EN02      -----------MEKTYEDD----EIE---IDLLELLGEFRRKIWIILGVIVLFGGVAGA-
G5HG46      -----------MEKNFDDD----EIE---IDLLELLREFRRRIWIILGVIVLFGGVAGA-
E7GL39      -----------MEKVYQDD----EIE---IDLRELLFEMKKKIWFIIAGLLIGAAITGA-
E7GL56      -----------MEKMYTEDKE--EIE---IDLRELLFELKKRLWLILVALFLGIGIAGA-
G5F9B0      -----------MEKMYTEDKE--EIE---IDLRELLFELKKRLWLILVALFLGIGIAGA-
D3AC81      ----------------MGTNQDDEIE---IDLKELFYVIKRKLWIILLTGIVGAVGFGL-
D3AE79      ----------------MKDTRDDEIE---IDLLQLFWVMKRRLWIMILAVVVGAAAAML-
D4YF14      ----------------------MEKE---YELYDLWLLFKKYFIRILNMTIIGATLAAI-
B1YMM6      ----------------------MNET---ISLQELFSTLRKSLWRILALTIVAALISFA-
D4LG05      ---------------MNQKDMNDEME---IDLLDLAYMLMDHWHHLLLCLLAGALALNA-
D4LTH3      ---------------MNQKEQNEEME---IDLLDLAYMLLDNWHYLLICLLAGALLLNA-
F3ATF6      ----------------MEKTHDEEMA---IDLWELISALKKRALIILAACLLGGVVAGV-
E0I7B6      -----------------------------MELKEYIQTVMKRKWLIISIVLVACILSGI-
C9LAS2      -------------MMENT--REDELE---IDLKQIFYVLKEKILVILAVGLLFGCLSCV-
F7K8E8      -------MENTKGMEKDTVQQTDEIE---IDLWEICLVLIHNLALIISVGIMAALVAFL-
F7K9V0      -------------MEENTMQQTDEIE---IDLWEICLVLVHNLALIVSVGIMTALGTFL-
F7KL97      -------------MEENTIRQTDEIE---IDLWEICLVLIHNLALIVSVGIMVALGAFL-
D3FZP5      ----------------------MEET---ISLRELYETLKKRIIMIITITVLAVATSGV-
C0ZHV9      ----------------------MNEE---LNLREILLMLLKRWKLILLITSLCTIGTAL-
D7WMM9      ----------------------MKET---ITLQDMLKIVRENFLFIISFTLFAALVTAF-
A8U9F5      ----------------------MEEE---ISLSELFATLKKRLTLIVSLGLIGLIVAAG-
F4BSE0      ----------------------MEEE---ISLSELFATLKKRLSMVVSLSLIGLIVAAG-
E7RDR2      ----------------------MEET---ISLQDLFKTLKKRAGLIALMTILAITIAGV-
I0JRK5      ----------------------MEET---ISLKEIFEVLKKRLLLIIGLAAGAAIISTL-
G2TR26      ----------------------MEDT---ISLKELMQVLRKRLSMIALITLGAMIVTAI-
D5DBK2      ----------------------MEET---ISLRVFFQVLRKRLWLIALITVIAATISAV-
D5DY80      ----------------------MEET---ISLRELFAVLRKRLWLIVLITIVAATVSAV-
A7Z9K1      ----------------------MGES---TSIKEIFAILRKRLLFILIITAAASAAGGL-
I2CB17      ----------------------MGES---TSIKEIFAILRKRLLFILIITAAASAAGGL-
I2HW54      ----------------------MGES---TSIKEIFAILRKRLLFILIITAAASAAGGL-
G4P1M8      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
E0TTZ7      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
G4EQF2      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
P96715      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
I0F9R7      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
G9QKR5      ----------------------MEET---ISLRDLMETLKKRLRLIVLITVLAALISGL-
B5UQ74      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
B7HFH2      ----------------------MEET---ISLKELFHILRKRLGMILIIAFGAAIVSAI-
Q72XH7      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGVAIVSAI-
C2V4M3      ------------------MEELMEET---ISLKELFHILRKRLAMILVIAFGAAIVSAI-
C2YZB3      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2P8H2      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2Y451      ----------------------MEET---ISLKELFHILRKRLAMILVIAFGAAIVSAI-
C3EBC1      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C3H980      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2PN23      ------------------MEELMEET---ISLKELFHILKKRLAMILAITLIVAIVMAI-
B9IRQ7      ----------------------MEET---ISLKELFLILKKRLAMILIIAFGAAIVSAI-
A0RL71      ----------MLCANFRKLEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2XJI0      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
Q3EV65      ------------------MEELMEET---ISLKELFHIFKKRLAMILVIAFGAAIVSAI-
C2T8T7      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2RG50      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
Q814Y9      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
B3ZRD5      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
Q6HB08      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2NQN7      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C3GRR1      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2ULR7      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C3GBJ9      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2WVG7      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
B7IQS9      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
A9VRC4      ----------------------MEET---ISLKELFYILKKRLAMILVIAFGAAIVSAI-
C2MTG4      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIISAI-
B7HXB5      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGVAIVSAI-
C2SBU5      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGVAIVSAI-
C2SSX9      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
G9QCG2      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
Q2BFS6      ----------------------MEET---ISLKELFQTLRKRLGLILSIAFVAVATSGL-
I3EBB4      ----------------------MEET---ISLRELFMTLRKRLSLILIVTLMSVMVSGV-
A4ITF4      ----------------------MEET---ISLRELFETLRKRLWLIVLITALATVVSGV-
C5D962      ----------------------MEET---ISLRELFETLRKRLMLIVLITALATIISGV-
G8MZ94      ----------------------MEET---ISLRELFDTLRKRLWLIVLITALATVVSGV-
Q5KUM4      ----------------------MEET---ISLRELFDTLRKRLWLIVLITALATVVSGV-
G5SDT9      ----------MTEKAKQSAAVTGSDE---IDIGRLVGTVIEARWWVLGTTAIFALCAVI-
G5LQM7      ----------MTEKVKQSAAATGSDE---IDIGRLVGTVIEARWWVLGTTAIFALCAVI-
G5Q4J1      ----------MTEKVKQSAAVTGSDE---IDIGRLVGTVIEARWWVLGTTAIFALCAVI-
B1V0N8      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFS-A-
B1BNK2      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFS-A-
B1R3X7      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFS-A-
Q8XN77      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFS-A-
B1HR40      ----------------------MNEE---MTIQSLVKVWQKRWFFILILMILSIGIAVF-
G2Z8Q4      ----------------------MEKT---LDIKYIGQFFKKYWYIIVAACVVGMIAIAF-
F8FCE3      --------------------------------------------------MITSLCTAL-
I0BSG5      ------------------------------------------------------MCTAL-
A8YPQ6      --------------------MESTL-----ELTKIKEVLQKNLKILIILPLLFLIISAI-
P95695      --------------------MESTL-----ELTKIKEVLQKNLKILIILPLLFLIISAI-
Q2G1K8      --------------------MESTL-----ELTKIKEVLQKNLKILIILPLLFLIISAI-
C5QNG5      --------------------MENTL-----DLMRVWEIIKKNWKLLVIIPLIFLILSAI-
Q4L9H8      --------------------MENKL-----DLSNIFKIIKKNWGIWLFIPIIFLLISLI-
Q2FUV1      --------------------MKEKF-----DLVKLLNILKKNIKLLLILPAICLVVSAA-
P39850      --------------------MESTI-----DLSELLGRVRKNMKLLIILPLLGLLISAI-
D7UYE3      --------------------MGDVV-----DLSKVLKVLKQNLKWIVIIPVVFLIIAMA-
Q4A121      --------------------MEETI-----DLNKLFAILKKNMKYLIILPIVFLVLSMM-
E3HB17      -----MFKKSRYEEDINTHWMEEDDE---IELMDLLFILIRRWKMIIAIAVPVIIIG---
C9AAE4      --------------------MNKEI-----NMKKLKQVLQQRIGWILMIISIPLLAMFL-
H7F6C7      --------------------MNEQI-----DLKKMLLAIRKNSWWLIGIIVVTILSMFI-
F0SX23      ------------------MPTQLYRE---FDLWKTLNVLWKKAWIIILGTGLSGAIALG-
Q38VG4      --------------------MEQTI-----NIEQIFGILRKYSRLIILSTVIFTLLAGI-
F2I4B6      --------------------MEEEI-----SLLDLWQIIKEHIYVIFISSLVGVLLAAA-
Q8RBS6      -------------------MMEEEL-----DLREVFLILRKRIKIILLITVLAMLVSGL-
D9SR42      -----------------------------MELKEYWYIIKKRLILIISFTLLCGAISGI-
D9SVC8      -----------------------------MDLHELLYIIKKRMVLMVSITLVIGASGWI-
E7RG09      --------------------MIETI-----SLREIYSILKNKIRLILAITIVIMIITAL-
D4G2E2      ----------------------------------------------MIVTAAATAAGGL-
Q8EME7      --------------------MEETI-----SLKEIFEVIKKRLLLIFTFILVAALAAAI-
D6Y035      --------------------MEESI-----SLKEIIDVLKKRLAMIVSITMIAVIAAAS-
Q5WBB3      --------------------MEETI-----SLKEIFQTLKQRWRLLVAIPFFAMLVSAI-
Q9K6Q9      --------------------MEETI-----SLKEMFQTIMRRLKLIIALPVLAVCLAGF-
Q97EP7      --------------------MEQGND---IDFTGFIDVLNKEKAMIALVTIFFVLFSAI-
Q97ER4      --------------------MEQEND---IDFTGIFEVLNKEKAMIAAVTIFFVLFSAI-
E4S7Y7      -----------------------------MEVKEYFLIIRKRIILIITTTILSSLIAAI-
E4Q5T6      -----------------------------MEIKEYILIIRKRLPLIVATTLISTFIAAI-
E4SDX3      -----------------------------MEIKEYILIIRKRLPLIVATTLISTLIAAI-
G2FWX3      --------------------MEEEI-----DLRQYWEVLKKRWKIIAMLPLIAALVSGI-
G7WJV2      --------------------MEEKL-----DLKQYWDMLRRRWIIVVALPLIAALTSGV-
G7W774      --------------------MEEEI-----DLRQYWEILRKRWIIVVVLPLIAALTSGI-
G2FM60      --------------------MEEEM-----ELRQYWDVLRKRWMIVVVIPLIAALTSGM-
H5XZD5      --------------------MEEKV-----DLRQYWGVLRKRWIIVVALPLIAALTSGV-
I4DBG9      --------------------MEEEI-----DLRQYLEVLGKRWLIIVAIPLIAAITSGV-
G2FWT7      --------------------MEEEI-----ELRQYWDMLRKRWMIVVVLPLIAALTSGI-
H5XZG8      --------------------MEEEI-----DLRQYWEMLRKRWIIVIVLPLIAALTSGV-
G0V448      --------------------MEQEMT---LDLRDLLEIIKKRWKMIFSVTTICILISAL-
A0PZ01      --------------------MEDEIT---LDLRDLFFVLRKRFKLIVSITLIATILSGI-
B1B737      --------------------MEDEIT---LDLRNLFFVLRKRFKLIIFITLIATILSGI-
D9ST43      --------------------MEEERA---LVLGDFIRIFKKQIKLILLITILSTFLAGI-
H7F5T7      ----------------------MSQK---FNLIEIWTILFRHKWSLIIMGILGASLSLC-
G9WIR0      ----------------------MDTT---ISYQRLWELFKKNFFLLIISALVLAAVAYA-
D3LB11      ----------------------MDTT---ISYQRLWQLFKKNFFFMLVSALIFALMAFA-
A0NKF7      ----------------------MDTA---ISYQRLWELFKKNFFFMLFSALFFTAITFA-
Q04DV7      ----------------------MDTA---ISYQRLWELFKKNFFFMLFSALFFTAIAFA-
F6BI63      ---------------------MSEEE---IDLKEILEILRKRWWLILIITVAAVVMSGI-
G2MWC1      ---------------------MAEEE---IDLREIFLIMRKRAKVIVIITLLAMIVSGI-
B0K4N2      ---------------------MAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
C7ISF8      ---------------------MAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
B0KAR6      ---------MYTKERIKGGLKIAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
E8UV30      ---------MYTKERIKGGLKIAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
C0GGR6      ----------------------MEQE---IEIREIVAIVSKRWKAILALFIFAVATSLV-
A4J8V1      ------------MNDDKIESRDDFEV---IDLRDIWRIIKKGKWILISLPLIAMLTSGI-
C8VYQ7      -----------------------------MELRDILGILKKGKWFLIILPIAAMLTSGI-
C8W5K3      ------------------------ME---LEIKDIIRILKKGKLLLLILPFIAVLTSGI-
B1BNH4      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
B1V1Z3      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
B1R3V2      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
Q0SVR9      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
Q8XN47      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
G7M0Q2      ---------------------MNEDV---IRVQDLLKTLKKRWKLICIITIITVIISAA-
G7M565      ---------------------MNKDV---IKIEDIVNILIKRWKMILGITLIATALSAI-
A6M2M0      --------------------MMNNDI---IRIDEIANPIIKRWKMILLVTLVTTLLALI-
G7M1R8      --------------MNSEEIIKNEES---IRIEEIIDILMKRWKMIVSITLTATILAGL-
A5V0I4      --------------MQLSD----------------YLAVLRRRWWVILLTMVVAVASAL-
A7NQ70      --------------MQLSD----------------YLAVLRRRWWIILLTTVVAVASAL-
Q4JZ56      -----------------MN--NRIVD---ISLFDLLNVLWLRKWIIVFVSFVFGCISFL-
Q7X554      --------------------------------------------LVLFIAFYFVAFSFL-
Q7X550      --------------------------------------------LILFTAFYVAVFSFL-
Q7X562      --------------------------------------------LVLFTAFYFAAFSFL-
Q7X556      --------------------------------------------LVLFTAFYVAAFSFL-
Q7X552      --------------------------------------------LILFTAFYFAVFSFL-
Q7X558      --------------------------------------------LILFTAFYFAAFSFL-
C5NWJ9      --------------MDNQE--KDLIQ---LDIMLLLRRIWEKKVLIVLVTLLFTAASLA-
F3A498      --------------MDNQE--KDLIQ---LDIMLLLRRIWEKKILIVLVTLLFTAVSLA-
Q9AHD3      ---------------MMKE--QNTIE---IDVFQLVKSLWKRKLMILIVALVTGAGAFA-
Q4K2E2      ---------------MMKE--QNTME---IDVIQLLNTLWKRKLIIALVAIVTGAIAFA-
Q4K2F8      ---------------MMKE--QNTME---IDVFQLLNTLWKRKLIIALVAIVTGAIAFS-
Q4K046      ---------------MMKE--QNTTE---IDVFQLVKTLWKRKLMILLVALVTGAGAFV-
Q4K0R8      ---------------MMKE--QNTIE---IDVFQLLKTLWKRRLMILLVALVTGAGAFA-
Q4JYY0      ---------------MMKE--QNTIE---IDVFQLVKILWKRKLMILLVALVTGAGAFA-
Q4JZW8      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
I0J9C8      ---------------MMKE--QNMIE---IDVFQLVKTLWKRKLMILIVALVTGAGAFA-
Q4K0M4      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILIVALVTGAGAFA-
Q4JZS4      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4JZK2      ---------------MMKE--QNMIE---IDVFQLFKTLWKRKLIILIVALVTGAGAFA-
Q9AHA5      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q9X9A0      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4JYK9      ---------------MMKE--QNMIE---IDVFQLFKILWKRKLMILIVALVTGAGAFA-
Q4K006      ---------------MMKE--QNMIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4JZG8      ---------------MMKE--QNTTE---IDVFQLVKTLWKRKLMILLVALVTGAGAFA-
A6YIA7      ---------------MMKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
E5F5C4      ---------------MMKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
Q9AHB8      ---------------MMKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
Q4JZL8      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILIVALVTGAGAFA-
Q4K1B8      ---------------MMKE--QNTIE---IDVFQLLKTLWKRKLMILIVALVTGAGAFA-
Q8VU32      ---------------MMKE--QNTIE---IDVFQVLKTLWKHKLIILLVALVTGAGAFA-
D2ERX9      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLIILLVALVTGAGAFA-
G6C7Z0      ---------------MMKE--QNTIE---IDVFQLLKTLWKRKLIILLVALVTGAGAFA-
Q4K2A9      ---------------MMKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
D6ZQI7      ---------------MMKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
Q9ZFT9      ---------------MMKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
Q4K255      ---------------MMKE--QNTIE---IDVFQSLKTLWKHKLIILLVALVTGAVAFA-
F9HJP7      ---------------MNQE--NQMVE---IDIVSLLKIIWQRKFFIVLTALMTAILALG-
E8JWI4      ---------------MNQE--NQMIE---IDVLSLLKTIWKRKFLIILTALLTGILALG-
A8AZR4      ---------------MNKE--NQLVE---IDVLSLIKTVWKRKFIILLTALVAAVLALG-
D0RXH3      ---------------MNKE--NQLVE---IDVLSLIKTVWKRKFIILLTALVVAVLALG-
Q83YR6      ---------------MNKE--NQLVE---IDVLSLIKTVWKRKFIILLTALVAAVLALG-
F1Z125      --------------MNNME--KPTME---IDVLSLLKKLWTKKFLIIFMALFFGTLALL-
Q3K0S9      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
P0C0T8      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
Q67AY5      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
Q04662      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
Q8GP93      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFCFAAFSFL-
Q8GPF7      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFCFAAFSFL-
E3CP61      --------------MTQEN--TKRVE---IDVLALLHKLWSKKVFILFTAFYVAVFAFL-
E8KUY7      --------------MTQEN--TKRVE---IDVLALLHKLWSKKVFILFTAFYVAVFAFL-
C2LSE5      --------------MTQEN--TKRVE---IDVLALLHKLWTKKVFILFTAFYVAVFAFL-
E9DM16      --------------MTQEN--TKRVE---IDVLALLQKLWTKKVFVLFTAFYVAVFAFL-
I0QIK5      --------------MTQEN--TKRVE---IDVLALLQKLWTKKVFILFTAFYVAVFAFL-
Q7X560      ---------------------------------------------ILFTAFYVAAFSFL-
Q8GMA6      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
Q55204      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
Q8GPC4      --------------MNQDN--TKSVE---IDVLALLQKLWTKKVFILFTAFYVAAFSFL-
Q8GPA9      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
G6ERT2      --------------MNQDNTKTKSVE---IDILALLHKLWTKKLLILFIAFYFAAFSFL-
O87930      --------------MNQDNTKTKSVE---IDILALLHKLWTKKLLILFIAFYFAAFSFL-
Q8GP55      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAVFSFL-
F8HDC4      --------------MNQDN--TKSVE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
F8LJ76      --------------MNQDN--TKSVE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
F8LXJ5      --------------MNQDN--TKSVE---IDVLALLQKLWTKKVFILFTAFYVAAFSFL-
Q1WCR2      --------------MNQDN--TKSVE---IDVLALLHKLWTKELLILFTAFYFAVFSFL-
G3G7C0      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFFILLMGLLGAGLAFA-
G3G7J8      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFFILLMGPLGAGLAFA-
G8DU30      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
A4VTU2      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
D5AGQ4      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
Q9X4U6      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
G3G7G5      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
G7SG35      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G8DU06      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G8DUA9      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G8DTY9      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G3G7I7      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFLIIITALFGAGIAFV-
G3G7J3      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFLIIITALFGAGIAFV-
E0PD82      --------------MNSND--QASIE---IDVFYLLRKLWSKKFFIIFIALVVGTVALL-
F5X651      --------------MNSND--QASIE---IDVFYLLRKLWSKKFFIIFIALVVGTVALL-
G5JTD6      --------------MTSAE--NASFE---IDVFALLKKLWNRKFLIIFVALLFGFVTLF-
Q2KM75      --------------MNTSE--NTSIE---IDILSLLKRIWQKKVVILFVTLLAGFLALV-
G5KAJ3      --------------MNNTE--QSSIE---IDVLSLLKKLWNKKFLILFMGLFVGTLALM-
B9DUJ5      --------------MNTTE--TPSME---IDVLSLLKKLWMKKFLILFMALFFGTLALL-
G5KD12      --------------MNTNE--TPSIA---IDVLSLLKKLWMKKTLILFMAIFVGVLTLL-
E8JMT8      --------------MNSND--NASIE---IDVLYLLRKLWSRKFFIIFIALVVGTVALL-
F5X0J8      --------------MNSND--NASIE---IDVLYLLRKLWSRKFFIIFIALVVGTVALL-
H2A601      --------------MNSND--NASIE---IDVLYLLRKLWSRKFFIIFIALVVGTVALL-
E7S8W2      --------------MKNQE--SQEIE---LDVVSLFKTLWRRKFSIIITALLFAIGALG-
F8DFF5      --------------MNNQE--NQAVE---IDVFATLKVLWKRKFSIILVALVFAIAAFG-
I1ZPH8      --------------MNNQE--NQAVE---IDVFATLKVLWKRKFSIILVALVFAIAAFG-
E3CBR9      --------------MNNKE--NQAVE---IDVFAMLKTLWKRKFSIVLVALVFAIAAFG-
E8K787      --------------MNNQE--NQAVE---IDVFAMLKTLWKRKFSIVLVALVFAIAAFG-
F9M365      --------------MNNQE--NQAVE---IDVFAMLKTLWKRKFSIVLVALVFAIAAFG-
A3CQY3      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
E8KLZ0      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0FHA9      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0FQQ4      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0I4H6      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0IAY2      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0IJI1      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0IS52      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F2C9N1      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F2CH54      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F3UDW8      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F3UNJ5      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F3SM33      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F9HC66      ----------------MKE--NKEIG---IDVVQLFKILWKKKLAIILTAVVTALLAFG-
E1LQJ6      ----------------MKE--NKEIM---IDVFQLFKVLWKKKIAIILTAIVAAVIAFG-
Q4JYU0      ----------------MKE--NKEIT---IDVFQLFKVLWKKKTSIILTAIVAAVLAFA-
Q4JZY2      ----------------MKE--NKEIT---IDVFQLFKVLWKKKTSIILTAIVAAVLAFA-
F9Q346      ----------------MKE--QNMME---IDVFQLLKILWKRKVLIALVAIVTGVVAFA-
Q6L5R1      ----------------MKE--QNMME---IDVFQLLKILWKRKVLIALVAIVTGVVAFA-
E9FEC6      ----------------MKE--QNMME---IDVFHLLKILWKRKFLIALVAFVTGTVAFA-
E0Q2S9      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFA-
F5VSH0      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFA-
A5YTV6      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFS-
Q6L5T1      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGTVAFA-
E0PPH8      ----------------MKE--KNVME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFA-
A5YTT8      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGTVAFA-
E6KKR9      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGIVAFA-
A1ILY0      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGIVAFA-
F2QF91      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGTVAFA-
Q4K0I3      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
Q8KWQ1      ----------------MKE--QNTIE---IDVFQLFKTLWKRKLMILIVALVTGAGAFA-
Q4K238      ----------------MKE--QNTIE---IDVFQSLKTLWKYKLIILLVALVTGAGAFA-
B1I966      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
G6J8A3      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
F9LZC3      ----------------MKE--QNTIE---IDVFQLFKTLWKRKLIILLVALVTGAGAFA-
F9P1W9      ----------------MKE--QNTIE---IDVFQLLKTLWKRKLIILLVALVTGAGAFA-
A5LJR9      ----------------MKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
Q9ZII7      ----------------MKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4K1K7      ----------------MEE--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
E1LPE6      ----------------MKD--QNTLE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
F9MJW6      ----------------MKD--QNTLE---IDVFQLFRTLWKRKLVILLVTIITSSVAFA-
Q4K0V3      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q54519      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
C1CBD0      ----------------MEK--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
Q7WVX1      ----------------MEK--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
Q4K0E2      ----------------MQD--QNTLE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
Q9AH96      ----------------MQD--QNALE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
A5M4L2      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
B2ILP4      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
C1CCB8      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
P72511      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
Q4K1S8      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
P96474      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q4K196      ----------------MKE--QNTLE---IDGLQLFRALWKRKLVILLVAIITSSVAFT-
Q4K0Z7      ----------------MKE--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
Q4JZ85      ----------------MKE--QNTLE---IDVLQLFRILWKRKLVILLVAIITSSVAFA-
Q4JYH6      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q4JZ19      ----------------MQD--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q4K0A1      ----------------MQD--QNTLE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
Q4K1M5      ----------------MKE--HNTLE---IDILQLFRALWKRKLVILLVAIITSSVAFA-
Q4K2Q8      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFV-
Q4K1G0      ----------------MKE--QNTLE---IDVLQLFRVLWKRKLVILLVAIITSSVAFA-
Q4K0T6      ----------------MKE--QNTLE---IDVLQLFRTLWKRKLVILLVAIITSSVAFA-
Q4K0K3      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFT-
Q4K0X6      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
E8KDN1      ----------------MKE--QDKIE---IDVVQVLKVLWKRKLMIALVAIATGVLAFG-
F9PEU3      ----------------MKE--QEKFE---IDVFQLVKVLWKRKFLIVLAALVAGLAAFA-
E8K321      ----------------MKE--QDKIE---IDVLQLVKVLWKRKFLIALVALLAGITAFA-
F9PZP6      ----------------MKE--QDKFE---IDVFQLVKVIWKRKFLIVLTAIIAGLAAFA-
D6R2T7      --------------MEKKE--NQMME---IDVLSMLRTLWLKKFTIVLGAVVFALLALG-
F3UUQ1      --------------MEKKE--NQMME---IDVLSMLRTLWLKKFTIVLGAVVFALLALG-
E6IZC3      --------------MKNQD--NQTVE---IDVLSLVKTLWRRKFLIVVTAFVIAIIALG-
G6A746      --------------MKNQD--NQTVE---IDVLSLVKSLWRRKFLIVVTAFVMAIITLG-
                                                                        

G7EJX5      MVTLTLV-P-KYTATATLLIEAE-------------------------------------
G9RSY8      VSSFAMT-P-QYEASATLIVNSR-------------------------------------
F3CAY8      GYAILAT-P-VYQATAMIQIEPR-------------------------------------
I0UTA4      -FSFLAP-P-KYTAKSSVLVNPL-------------------------VTDPAAGGNANS
E9TE87      VYTFFAT-P-IYSADALVQIEQ--NSGNSLVQDIGSALAN--------KPPASDAEIQL-
E6PYQ4      MWAHFQP-S-LYDATAMIHLDQ--------HSSISLGPSG--------ATGDEYGLKIQT
C0QCJ1      YLALTSP-R-TYMAETSILVQA------QTVPGNYVKSIV--------SSGISSRISTIS
I5B297      GMTLTAN-K-TYEAGTMILVQP------QRVPINYIKSVV--------SSSIGERISTIS
B8D0N1      ILTSYKP-A-VFQSDALLMIDE--------TPTTLNQIEL--------SPFNNNNRDLIT
D9QTC7      VASSLMT-K-IYQTSALVMVKEDKGMENLFSEQMGALGSL--------AGSTSNKLATYT
C7LPS4      ITSYVLP-R-KYEAQSTVFIEQ------SVISELVKGIAT--------TPSMEAKIKVLT
Q314L4      GFAYSLP-K-IYQAKSTVAIEQ------NVINDLVRGIAI--------TPSMGAKIRILN
G0VNK5      AYLCIAS-P-VYQSTSLLRIKQDKGLGDSIMSQVSGGNTL--------DD--KQRMMTDA
D2RIR1      AYLLIVP-N-TYQSTALLRIKQERGLSSSIMEQLPIGNAQ--------LT--KQQMNTNA
I0GRR3      AYLLITP-P-TYQSTSLLRIKQEKGLGDSILSSVA-GNAG--------MT--TQRMNTNA
Q39U16      WGSFFLP-K-KYEASSTVFIEK------SVIKDLVKGITF--------TPSVEDKVRILR
F0JCB9      VTSYVLP-K-KYEAKSIVFIEQ------NVISDLVKGIAV--------TPSMDTKIKAIK
G7QCG0      AVGYLSP-K-KYEAKSTIFIEQ------NVITDLVKGIAI--------SPSMQQKIQNLA
I2Q342      AVAYLSP-K-KYEAKSTIFIEQ------NVITDLVKGIAI--------SPSMQQKIQNLA
Q74BQ7      VYSYVLP-K-KYEARSTVFIEK------NVISELVKGIAV--------TPSMEQAIKGLS
B5EA80      VVSFVLP-R-KYEASSTVFIEK------NVISELVKGITV--------TPSMEDTINVLT
C6DZX6      VVSFVLP-R-KYQATSTVFIEK------NVISELVKGITV--------TPSMEDTINVLT
A1ARV9      VTSYVLP-K-KYEASSTVFIEK------NVISELVKGITV--------TPSMEDTIKVLT
E8WSZ4      LVSYLLP-R-KYESSSTVFIEK------NVISELVKGLAV--------TPSMDDTISVLT
A5G425      IVSYFLP-R-KYEAKSTVFIEK------SVISDLVKGIAI--------TPSMDEKIKVLN
B9M2X7      IVSYVLP-E-KYEAKCTVFIEK------ALINELVRGFAV--------TPSMEDKIKGLN
C2MBF7      LYIKSSP-H-QYSRSASLLI-KNETPMSSAMQQLAQFAGD--------KHAYSDDVSNQI
H8YYB8      ITAVVLP-P-TYRSTATILIEQQEIPDELVRSTVTSYAAQ--------R---VQTISQRV
B7B948      YLKWAPK-V-YTRTASVLIKDD------AKGGAMSESAAFEDLGLFGTKRNVDNEVLVFK
G8AU95      YVMQSLK-P-MYRATAMVQLDS------RRVELAEFKSVVS--NLTPEAPAVRSEVSIVG
G5IFS2      FTATMMK-P-VYTSSTMLYIVN------KTTTLTSLTDLQL-------GSQLTKDYKVL-
F0G6H6      LYALCAR-P-VYRSDVLFQVEQ------SPTDTKPASPTGDPSSMFDLKTDAATEIEVLK
A3W0H6      IVALNQP-K-VFQATAVIQIET------PQVGSDLAGQTI--------ATDANQRLQLIE
A3K8W6      DYALMQQ-K-VYEATAVVQIED------ARVTSTATGTAAD-------ANEASRRLQLIE
Q0FMP1      WLALNQI-K-VYEATAVVQIEE------GQMPDSLAGASAQ-------NQDGSRRVRLIE
S9QRP2      WVALNQD-K-AYEATAVVQIEE------ARVPERLTGGAAQ-------NADAARRVRLIE
F4SM98      YALFATP---IYQADALLQVEQK-------------------------------------
C4Z673      YSFFVIT-P-QYESTTKVYILNK-------------QNAS--------GSVTYSDVQLSS
E3H7M4      YSYYKAD---TYKAEVILMVSGS------------NLISP--------DRLENSQVSLNQ
F8KGP2      VAQFVVV-P-KYTATTEILVNQK---------H---ENND--------NGQAYNNQQADI
B3XL22      VAQFVVV-P-KYTATTEILVNQK---------H---ENND--------NGQAYNNQQADI
F8DRU3      VAQFVVV-P-KYTATTEILVNQK---------H---ENND--------NGQAYNNQQADI
C2EWM2      VAEFVIT-P-QYTASTQILVNQK---------H----DNA--------DGQAYNNQQADI
D0DSJ3      IATFVIP-A-KYTATTQILVNQR---------N---SNDN--------NGQAYNNQQADI
B2GF32      IATFVIP-A-KYTATTQILVNQR---------N---SNDN--------NGQAYNNQQADI
C0WW25      IATFVIP-A-KYTATTQILVNQR---------N---SNDN--------NGQAYTNQQADI
F0K0J8      VSEYVLV-P-KYTASTQLLVNRK---------TADANHAD--------ANQAYANQQADI
G6F8H0      VSEYVLV-P-KYTSSTQLLVNRK---------T-----TD--------ANQAYTNQQADI
F0HVF2      VSEYVLV-P-KYTASTQLLVNRK---------T-----ED--------ANQAYANQQADI
Q1G8E3      VSEYVLV-P-KYTASTQLLVNRK---------T-----AD--------ANQAYANQQADI
D6S4X3      VSSFMIQ-P-KYSASTQLLVNQK---------T---DEKN--------IGAAYTLQQANM
Q5FIC6      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNND--------PNAAYATQQANM
E4SMV6      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNND--------PNAAYATQQANM
F0TGY3      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNND--------PNAAYATQQANM
F2M2M7      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNND--------PNAAYATQQANM
A4ZGZ7      IANFVIS-P-KYTSSAQILVNQK---------S---NKND--------PNTAYITQQANM
C2EPK4      LAEFVVT-P-KYSSSAQILVNQK---------S---RNND--------PNAAYVTQQANM
C7XKF2      VANFIIS-P-KYTSNAQILVNQK---------A---NKND--------PNAAYNTQQANM
E3R265      VANFIIS-P-KYTSNAQILVNQK---------A---NKND--------PNAAYNTQQANM
D0DJG9      VANFIIS-P-KYTSNAQILVNQK---------A---NKND--------PNAAYNTQQANM
D5GZJ9      VANFIIS-P-KYTSNAQILVNQK---------A---NKND--------PNAAYNTQQANM
A8YX90      IANFVIS-P-KYTSSAQILVNQK---------S---NKND--------PNTAYITQQANM
F0NWJ8      LANFVIS-P-KYTSSAQILVNQK---------A---NKND--------PNAAYATQQANM
C2JZS0      GTKMLVA-P-KYQSSTSMLVNRK---------Q--DNN----------PNMQLNAQQADI
C1J9I2      GAKAFIA-P-KYESDTSLLVNRK---------Q--DND----------PNMQLNAQQADI
Q58Z11      GAKTFIA-P-KYSASTSMLVNRK---------Q--DNN----------PNMQLNAQQADI
B1MZT2      IAKFLIA-P-TYSASTSMLVNRS---------T--DNT-T--------GNANLSDQQADV
C2KHF2      VAKFVIA-P-TYSASTSMLVNRS---------A--DDTST--------ATANLSDQQADV
Q03W94      IAKFVIA-P-TYSASTSMLVNRS---------A--DDTST--------ATANLSDQQADV
C6CW36      KSSFYTT-P-IYEATAKLIVNQS-----------SGAYQQ--------GYPDVGLLQSNL
A8SQS9      YAYFFIK-P-TYQSTAKLYVVSA-------SDDS---------------IVNLQDLNIGS
D5HFS3      FAYFLIK-P-TYQSTAKLYVVSA-------SDDS---------------IVNLQDLNIGS
B9Y883      ITLFLIP-K-KYTAEAKLIIVQK-------SNPDS-------------QQISYNDLQTSQ
A5Z5P8      WTKVGIT-P-KYTATAKVYMVSA---------SK--NSVV-----------DLADLSIGT
G2KUP2      ITYGVMR-P-KYTSTTDLLVNQK---------LSKSQAAI-----------QSQQVQADV
G8PE07      VTFFIMT-P-KYSATTEILVNRK---------LPAEMQGA-----------QFQQVQADV
E0NHP5      MTFFVMT-P-KYSATTQILVNRK---------LSDDMAGA-----------QLQQTQADV
Q03GL9      MTFFVMT-P-KYSATTQILVNRK---------LSDDMAGA-----------QLQQTQADV
C6CSC7      YTKMFKD-P-IYEASTKIVVNQP---------SQ--QLAV--------GQLDLNQINSNI
C6CS79      YSAWVMK-P-VYEAYTKLIVNST---------AG--QAGS--------FKLDLNMINTNL
F5LM70      VSKYYLK-P-VYQASTKLIVNSP---------AD--NQGM--------LRLDMNAINTNI
G0LYN8      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT-----------EYAGQQADI
F6ITB3      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT-----------EYAGQQADV
G0M1Y0      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT-----------EYAGQQADV
D7VC12      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT-----------EYVGQQADV
F9UMZ5      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT-----------EYAGQQADV
D4JI68      ISRFMIT-P-MYESTSELYVLSK---------S---TSIT-----------SLADIQTGT
D6E329      ISRFMIT-P-MYESTSELYVLSK---------S---TSIT-----------SLADIQTGT
Q1AUN7      VGFGLLQTP-VYEASITILVGQK-------------SGEE-----------GPRNLSGDV
H4GK02      DAEFLVQ-P-KYTASTQILVNNK---------ENKVQAGQ-----------AYNNQQADV
F6IR92      VTLWVVK-P-QYQANVQILVNRK---------HS--SAGT-----------DLTGQQADV
G0M0G0      VTLWVVK-P-QYQANVQILVNRK---------HS--SAGT-----------DLTGQQADV
D7VBW5      VTLWVIQ-P-EYQANVQILVNRK---------HS--SAGA-----------DLTGQQADV
F9UQ55      VTLWVIQ-P-EYQANVQILVNRK---------HS--SAGA-----------DLTGQQADV
D4YHG8      VTFFLMT-P-KYTSTTDIVVNNA-------ATATT----E--------NTITQSGLQANL
F7V793      ISYGLIT-P-KYAATSSLYMVSA-------DRNK---------------VVDLTSLTAGS
C3WFM8      -FAITRP-T-VYQAETTLIVSNN--------------MSS--------VSLDSSDISLSQ
H7F1R6      YLYAFSV-P-TYQSETEVLINQS-------VPENT--------------VVQSQDVQANL
H7F570      YLSFFST-P-IYRSSTEVLINQS-------VSENS--------------QVKSQDVQANL
C6LCS6      CSRVFIT-P-TYDSTTKIYVLNR-------QNSDA-------------AAITYSDLQSAT
A7VF43      CAYFLIK-P-TYQSTAKLYVVSA-------SEDS---------------VVNLSDLNIGT
A7Z922      IQFRVIS-P-VYQASTQVLIHET-------SGEKN----S--------NL---SDVQLNL
I2CAF3      IQFRVIS-P-VYQSSTQVLIHET-------SGEKN----S--------NL---SDVQLNL
I2HVL3      IQFRVIS-P-VYQSSTQVLIHET-------SGEKN----S--------NL---SDVQLNL
E0U2Z4      AQFKVIS-P-TYQASTQVLVHES-------DGEEN----S--------NL---SDIQRNL
D4G1R3      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----S--------NL---SDIQRNL
G4EQZ6      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----S--------NL---SDIQRNL
P71050      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----S--------NL---SDIQRNL
G4P115      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----S--------NL---SDIQRNL
A8FHM0      YQFYVST-P-VYQATTQILVHKR-------SNDAQ----A--------NL---NDIQMNL
C0EBA5      ITKFLMT-P-MYTSSATMYVNNK-------TKTDN----V--------DIISGSDLVTSQ
B7BDT7      VYLLTTP-P-VYTRSASLLIKEDSKGNSLGDAAGL--------------MGDFDLFQTNT
H6LKR9      GTAKLIT-P-IYEAKTVLYIGRE-------NSGLG----T--------IDVSLGQLEADS
F5LE49      ISYFFID-K-QYAASTKLVVNKS-------SSYQG----Y--------DILDYNAVNTNI
F3AHH1      GTKLFMT-P-QYQSVTKMYVLSK-------QDNAT---------------LTSMDMQTST
F3Y921      MTFFMIT-P-KYSSQAQLIVRLP-------QTTNA--------------N--SNEVSANL
G4L593      VTFFIMT-P-QYNSRAQMIVALP-------QDENS--------------DESLNTVNYNL
E6LD65      VTFFIVT-P-KYSSQAQLVVTLP-------QSDST--------------N--VNDVNSNL
C9ALZ8      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA--------------N--VNDVNTNL
C9BUG6      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA--------------N--VNDVNTNL
Q3XYS7      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA--------------N--VNEVNTNL
C9B453      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA--------------N--VNDVNTNL
D4RJF5      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA--------------N--VNDVNTNL
C8ZXT8      ATFFVIT-P-KYSSQAQLIVTLP-------QSETT--------------N--VNDVNTNL
F0EKB8      FTFFVIT-P-KYSSQAQLIVTLP-------QSETT--------------N--ANDVNTNL
C9A6V4      FTFFVIT-P-KYSSQAQLIVTLP-------QSETT--------------N--ANDVNTNL
C9CHY7      FTFFVIT-P-KYSSQAQLIVTLP-------QSETT--------------N--ANDVNTNL
E6UHY5      YAKFVLP-L-QYTASIKIYVTNG--KTGDQDNDDN--------------LINAQDLNTAR
E9SAU2      YAKFVLP-L-QYTSSIKIYVTNGVRNSHDDDDENE--------------LINGADINTAR
F7K0U2      VTKLFMT-P-VYTSTTKMYVLSK-------QDANS--------------AVTSSDLQAGS
O06029      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGEVTGNI
G8P3D6      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
A9QSJ3      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
F9VC43      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
G6FD41      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
G9M881      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
Q3ZK51      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
Q83VG0      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS--------------AAYAGQVTGNI
C6LDI9      VTKILIT-P-MYSSSSMIYI--V-------GDSLD--------------VSFLVNMEVGT
G5F9H3      YSKFLIT-P-QYKSEAKLYV--L-------SKETT--------------LTSLADLQIGS
C0CZV8      FSAFVLT-P-QYTSTAMVYI--L-------SKETT--------------LTSLADLQIGS
G5GFW1      YSYFILS-P-QYTSTAMLYV--F-------SKETT--------------LTSLADLQIGS
H1LCW2      LEKFVIT-P-QFTSTAQILVNQK-------KDTSV-------------PRAAFQDQQADV
I5AV00      YVNAKYA-P-YYTSSTKLYVMPK-------SSTGN----------------LNSDLQAGA
H6NE44      VSVQYLP-R-VYQASVKLLINSE-------GKGNG---------------VDISSINTNL
F4BS20      LTNYVLI-P-RYSSTTQLLVSRQ-------DMNTQ--------------SIELGEIETNI
E0RZL4      LSKFVIR-P-EYESTTKIYILNK-------EENQT---------------VTYSDVQIST
C0CK72      FTFKIVE-P-MYGASSMIYMRGA-------GNT----------------ISSLQDLQIGA
D9S1J8      YTFWIKK-P-VYESYTTIMVGKP-------VQRVQDS--S--------APITYQELQTNR
C2EFR7      YSKFAVV-P-QYTSVTKIYLSN-----------------K--------LTENQTNPTPST
Q1WTC7      YSKFAVV-P-QYTSVTKIYLSN-----------------K--------LTENQTNPTPST
B0P2G1      ITKFAMT-P-IYSSTAQLYVVSK----------------G--------GLSQLTDLTMGS
D4MW28      ITKFAMT-P-IYSSTAQLYVVSK----------------G--------GLSQLTDLTMGS
E5VMX9      ITKFAMT-P-IYSSTAQLYVVSK----------------G--------GFSQLTDLTMGT
F2I6Z8      YNFLWAE-A-EYASQTQIVVTPK-------D--------S--------DKDKADEKKAG-
E6U7N3      LAAWAIS-P-LYASSTMLVVNAN-------NNQNN----T--------TTITNDQLTTAQ
C4Z8M6      ISRFMIT-P-MYESTSELYVLSK-------S--------T--------SITSLADIQTGT
D4JMC3      YSKITFV-P-EYEASAEMYVLTK-------S--------T--------SITSLADIQVGS
D6E0V3      YSKITFV-P-EYEASAEMYVLTK-------S--------T--------SITSLADIQVGS
E3GPC7      FTIFFMN-K-EYSSYTTLMIGKS-------EGYSDT---N--------ANANYNEVLTNQ
A6BIG6      ATKLFMT-P-VYTSVTKLYVMTK-------NGEN-----S--------SSATYTELQSGS
C2CI43      LSSFIIT-P-KYDSNATMIVSNS-------TQNNDQNP-Q--------ANVDYGQIQANK
D4RX68      YFNFVVT-P-RYTSTARIMVINR-------QN-------S--------DSLTSTDLNSST
D4J4T5      YTSFLVT-P-LYSASSMMYVMPD-------NSNS-----M--------NSSTLSDMQVGQ
I5ASF9      ITKFVMT-P-MYTSSSMMIVLTK-------E--------T--------TIASIADLQMGS
C0C0F9      GTKMFIT-P-MYSSTTKMYVLTK-------QDS------S--------AGVTYSDIQTGT
B6W7H3      ASVFVIT-P-KYEATTTMIVSNS--------KNEDPNQ-K--------GDVDINQINANR
C7RGH5      LSKFVIT-P-KYDSNTTMIVSNS-------NQNNDPNNPQ--------TNVELGQIQANK
F0GT82      YSNFVVT-P-SYNANATMIISSS-------SKNEDQQD-L--------ADIDFYQIQANK
F3AH93      YTQFCIA-P-TYTSTSSMLVLSK-------E--------T--------TLTSMADLQLGT
B0GAL4      YAGFLVK-P-LYTSSSMMLVLTK-------E--------T--------TLSSLADLQMGS
G1WUK1      YAGFLVK-P-LYTSSSMMLVLTK-------E--------T--------TLSSLADLQMGS
D4M2S1      VTKLFIT-P-VYSATATMLVLTK-------E--------T--------TLSSLADLQIGS
E7GL80      YSYYLLT-P-QYISEAKIYVLSK-------E--------T--------TLTSLADLQMGT
G5F9E3      YSYYLLT-P-QYISEAKIYVLSK-------E--------T--------TLTSLADLQMGT
D4CG07      YSKMILV-P-KYTSTAMMYVLSK-------E--------T--------TLTSLADLQIGS
D4MP31      YSKMILV-P-KYTSTAMMYVLSK-------E--------T--------TLTSLADLQIGS
G5HNC6      YSVMILN-P-VYTSTSMVYVLSK-------E--------T--------TLTSLADLQIGS
A8RK86      YSRLILT-P-VYTSTAMVYVLSK-------E--------T--------TLTSLADLQIGS
G5HTB1      YSKMILK-P-VYTSTSMVYVLSK-------E--------T--------TLTSLADLQIGS
A8RSL0      FSAFVLT-P-QYKSTAMVYILSK-------E--------T--------TLTSLADLQIGS
C5EN02      FSKFVLT-P-QYKSTAMVYILSK-------E--------T--------TLTSLADLQIGS
G5HG46      FSKFVLT-P-QFKSTAMVYILSK-------E--------T--------TLTSLADLQIGS
E7GL39      YSKFLIT-P-QYKSEAKLYVLSK-------E--------T--------TLTSLADLQIGS
E7GL56      GSAFLIT-P-QYKSEAKLYILSK-------E--------T--------TLTSLADLQIGS
G5F9B0      GSAFLIT-P-QYKSEAKLYILSK-------E--------T--------TLTSLADLQIGS
D3AC81      FTAMVMK-P-VYTSSTMLYIVNK-------TTT----------------LTSLTDLQLGT
D3AE79      YTTTLVE-P-VYTSSTMIYILNK-------TNN----------------ITSLSDLQLGT
D4YF14      VVMFFVE-P-QYSSQAQLIVNQR-------SSQDT--------------SIQYNEIQTNV
B1YMM6      VSTFLIK-P-TYQAGTQILVTPK-------KQEND--------------VIDASQVQSSV
D4LG05      FAFFFIE-P-TYESTAKLYVVST-------SDDS---------------VVNLNDLNLGT
D4LTH3      YSFFCIQ-P-TYQSTSKLYIVST-------SDDS---------------VVNLNDLNLGT
F3ATF6      YTKLCIT-P-MYTATSSMLVTTQ-------ETT----------------LTSIADLQLGS
E0I7B6      KGFFYTT-P-VYSASAKLVVNQS-------YEYNG----I--------SMLDYNLIQTNL
C9LAS2      ATKLLIT-P-TYTSTSSMLLLTD-------QGLET---------------V--SDVQMGT
F7K8E8      ATQLFGV-P-KYESTTKIYILNK-------QENNA---------------VTYSDIQLGT
F7K9V0      ITQLFIT-P-KYESTTKIYILNK-------QENNA---------------VTYSDIQLGT
F7KL97      VTQIFGV-P-KYESTTKIYILNK-------QENNS---------------VTYSDIQLGT
D3FZP5      VSYFVLT-P-MYQSSTQILVSQQ-------AAGAA----S--------AALQQAGFDVDS
C0ZHV9      VSFYLLT-P-IYQAKTEILVNRS-------LDSTV----E--------SMLSVAEIDSNL
D7WMM9      ISIFVLK-P-TYEAETQILVNQK-------NIEQP--------------HLGVQQVETDL
A8U9F5      FTFFIAT-P-QYNATTQILVNRT-------TESAE--------------GLQLNDINSNV
F4BSE0      FTFFIAT-P-QYNATTQILVNRT-------TESTE--------------GLQLNDINSNV
E7RDR2      VSFLVLT-P-MYQTSTQILVNQE-------QSEAA--------------QLTNQNIQTDL
I0JRK5      VTFFVLT-P-SYEASSQFIVNQS-------QSQSQ----D--------NIYEGNELQTNI
G2TR26      VTYFVMT-P-VYESSTQILVNKA-------SDDQT--------------MYTTNAVQTNV
D5DBK2      ISFFVLT-P-VYQTNTQILVNQA-------KSEQQ--------------LYNAGAVQTNV
D5DY80      ISFFVLT-P-VYQSKTQILVNQA-------KSDEQ--------------LYNMQAVQTNI
A7Z9K1      ISFFALT-P-VYENSTQILVSQS-------KNNQK--------------EVQFNDVQTNL
I2CB17      ISFFALT-P-VYENSTQILVSQS-------KNNQK--------------EVQFNDVQTNL
I2HW54      ISFFALT-P-VYENSTQILVSQS-------KNNQK--------------EVQFNDVQTNL
G4P1M8      ISFFALT-P-IYENSTQILVNQS-------KNNQK--------------EVQFNDVQTNL
E0TTZ7      ISFFALT-P-IYENSTQILVNQS-------KNDRK--------------EVQFNDVQTNL
G4EQF2      ISFFALT-P-IYENSTQILVNQS-------KNERK--------------EVQFNDVQTNL
P96715      ISFFALT-P-IYENSTQILVNQS-------KNERK--------------EVQFNDVQTNL
I0F9R7      ISFFALT-P-IYENSTQILVNQS-------KNDRK--------------EVQFNDVQTNL
G9QKR5      VSFFILT-P-IYQASTQLLVNQS-------KNDQQ--------------MYDFNQVQANL
B5UQ74      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------VIQYNEVQTNI
B7HFH2      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT--------------ALQIGEVQTNI
Q72XH7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQYNEVQTNV
C2V4M3      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQFNEVQTNI
C2YZB3      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQYNEVQTNI
C2P8H2      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQFNEVQTNI
C2Y451      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQYNEVQTNI
C3EBC1      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS--------------AIQFNEVQTNI
C3H980      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQYNEVQTNI
C2PN23      ISFFFMT-P-LYQSSTQILVNQK-------KQEGT--------------AIQIGEIQSNI
B9IRQ7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT--------------AIQLGEIQSNI
A0RL71      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS--------------MFQAGEVQTNI
C2XJI0      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS--------------MFQAGEVQTNI
Q3EV65      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MFQAGEIQTNI
C2T8T7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQLGEIQSNI
C2RG50      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQLGEIQSNI
Q814Y9      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------AIQLGEIQSNI
B3ZRD5      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS--------------MFQAGEVQTNI
Q6HB08      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEVQTNI
C2NQN7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS--------------MFQAGEVQTNI
C3GRR1      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEVQTNI
C2ULR7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MFQAGEIQTNI
C3GBJ9      ISFFFMT-P-IYQSATQILVNQK-------KQEGA--------------MFQAGEVQTNI
C2WVG7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS--------------AIQYNEVQTNI
B7IQS9      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEIQTNI
A9VRC4      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEIQTNI
C2MTG4      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEVQTNI
B7HXB5      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEVQTNI
C2SBU5      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA--------------MIQAGEVQTNI
C2SSX9      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT--------------AIQYNEVQTNI
G9QCG2      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT--------------AIQLGEIQSNI
Q2BFS6      ISYFYLT-P-IYQSSTQLLVNQA-------KSDQP--------------VYNPGEIQTNL
I3EBB4      VSYFFLT-P-IYEASTQLLVNQA-------KNEQA--------------LYNYNEVQTNL
A4ITF4      VSYFLLT-P-IYQASTQILVNQA-------KSEQQ--------------MYNVGEIQTNL
C5D962      VSYFFLT-P-IYQASTQILVNQA-------KSEQQ--------------LYNYNEIQTNV
G8MZ94      VSYFILT-P-IYEASTQILVNQA-------KSEQQ--------------LYNFNEIQTNV
Q5KUM4      VSYFLLT-P-IYQSSTQILVNQA-------KSEQQ--------------LYNFNEIQTNV
G5SDT9      YT-FFAT-P-IYSADALVQIEQN------------AGNSL--------VQDINSALANKP
G5LQM7      YT-FFAT-P-IYSADALVQIEQN------------AGNSL--------VQDINSALANKP
G5Q4J1      YT-FFAT-P-IYSADALVQIEQN------------AGNSL--------VQDINSALANKP
B1V0N8      YKAYKMK-P-SYQSRVKFFIGKE--------------GIK--------GTYSVGELEEYK
B1BNK2      YKAYKMK-P-SYQSRVKFFIGKE--------------GIK--------GTYSVGELEEYK
B1R3X7      YKAYKMK-P-SYQSRVKFFIGKE--------------GIK--------GTYSVGELEEYK
Q8XN77      YKAYKMK-P-SYQSRVKFFIGKE--------------GIK--------GTYSVGELEEYK
B1HR40      INYFLQT-P-IYEAETQLLVNQK------------SYENQ--------QLIGAQNVDTDL
G2Z8Q4      YTSYFVT-P-IYQVSTDVLV---------------NQKKN--------EQVTVSDVQSNQ
F8FCE3      VSVQYLP-R-VYQASVKLLINSE--------GKGNGVDIS--------------SINTNL
I0BSG5      VSVQYLP-R-VYQASVKLLINSE--------GKGNGVDIS--------------SINTNL
A8YPQ6      VTFFVLS-P-KYQANTQILVNQT--------KGDNPQFMA-------------QEVQSNI
P95695      VTFFVLS-P-KYQANTQILVNQT--------KGDNPQFMA-------------QEVQSNI
Q2G1K8      VTFFVLS-P-KYQANTQILVNQT--------KGDNPQFMA-------------QEVQSNI
C5QNG5      FTFFLAK-P-KYEASTQILVSQ---------KEKESKMMA-------------QEVQSNI
Q4L9H8      ITFLFMT-P-KYEATTQILINQ---------KEKNKELMA-------------QEVQSNI
Q2FUV1      LTFFVMP-D-KYTASTQILVNM---------KKSSSDLAF-------------QNVQSSL
P39850      ISFFFLD-V-KYQASTQILVNQ---------KGNDSQIMA-------------QEVQSNI
D7UYE3      LTYFFMT-P-KYASSTQILVNK---------KESNSQFMA-------------QEVQSNL
Q4A121      MTFLFIT-P-KYSSSTQVLVNQ---------KETDSQMMA-------------QQVQSDL
E3HB17      LTYAVLK-PAMYKAETTLMVSSG--------QIYSVEKLD------------SSEISKNQ
C9AAE4      YLTFFAE-P-IYQKSAQLLISQS--------ETTSGNRLE------------NQTIQADL
H7F6C7      YLQYIAT-P-IYQKSTQILVNQS--------ESTKSNSVD------------SQTVQADL
F0SX23      ITYYFMT-P-LYTASIKLYVNNS--------TELAVQITD-------------SDMKASQ
Q38VG4      LTFFVIT-P-QYSASTEVLVNRK--------QNTDANAQ-------------YNQVQTDV
F2I4B6      YAFVLAT-P-IYQSSTEILVNQS--------ESKGQNNTL------------NQDINASL
Q8RBS6      ISYYVLS-P-VYKASTSLIISRT--------QN---ITIN--------DQIQLQDIQTSR
D9SR42      ITTFVID-K-IYTADISVLIGK----------QESSDSEK--------TSTTYNDILMYQ
D9SVC8      FSTLFIN-K-LYTSDISVIIGKN--------YRNPAEGES--------SIATYSDILMYQ
E7RG09      ISYYFIT-P-IYQTSTQLLISQK--------QSEVIV--D------------SQSIDIDL
D4G2E2      ISFFALT-P-IYENSTQILVNQS--------KNERKEV-Q------------FNDVQTNL
Q8EME7      ISYFVMT-P-KYENSSQFIVNQS--------NQEQANQFT------------QTDIRTNV
D6Y035      VSYFVLT-P-KYQASTQVLVSQA--------ATGASILSS------------ANPFESDA
Q5WBB3      ISSFVLT-P-MYERSTQLLVNQA--------VPEGQL--N------------QQVVRNNL
Q9K6Q9      VSFFLLT-P-IYQSSTQILVNHS--------NDNQSF--N------------SQDIRTNI
Q97EP7      LSFFIIK-P-TYQGHVTVIIGRN--------DSKSSTNEQ------------YNDVMMSQ
Q97ER4      LSFFIIK-P-TYQGHVTVIIGKN--------DSKSSTNEQ------------YNDVMMSQ
E4S7Y7      LSFYVLE-P-VYRASVTLFAGRS--------TNNSASSDS--------IQALYSDVLLGQ
E4Q5T6      LSFYILP-P-IYKATVTLFAGRS--------TNSNGSNDN--------IQALYSDVLLGQ
E4SDX3      LSFYILP-P-IYKATVTLFAGRS--------TNSDGANDS--------IQALYSDVLLGQ
G2FWX3      VSFYCIQ-P-VFQTSTTLIVGKK--------SLDIGQPLE--------HMLDYNVLLANQ
G7WJV2      ISFFVLK-P-VYQASTTLIVGKK--------AAEPGQEAA--------KILDNNVLLANQ
G7W774      ISYFIIK-P-VYQASTTLIVGKK--------ASEEGQAAV--------QMLDNNVLLANQ
G2FM60      ISFFVMK-P-VYQASTTLIVGKK--------AAETGKDPT--------QILDNSVLLANQ
H5XZD5      ISFFVIK-P-VYQASTTLIVGKK--------AAESGQEAV--------KMLDNNVLQANQ
I4DBG9      ISFFILK-P-SYEASTTLIVGKK--------ATEEGQAAA--------QMLDNNVLLANQ
G2FWT7      ISFFVIK-P-VYQASTTLIVGKK--------AAEAGQAAT--------QMLDNSVLLANQ
H5XZG8      VSFFILK-P-VYQASTTLIVGKK--------ATESGQAAM--------QMLDNSVLLANQ
G0V448      LSFFVLP-P-IYEAKVSIIIGKE--------DTSQEKRID----------YN--DIMMYQ
A0PZ01      ISFFVIH-P-TYEATLSVFIGKN--------ENEQSQKIS----------YNESDIMMYQ
B1B737      ISFFVIH-P-TYEATLSVFIGKN--------ENEQSQKIS----------YNESDIMMYQ
D9ST43      LSFLIIE-P-TYEAKSTIVVGKA----------DRGSNDN--------PKYQFDDIMMYK
H7F5T7      IALFVIT-P-SYQMQSQVLVVPS------------SKDQS--------GVSQSAEVQANL
G9WIR0      GSRFLIH-P-KYQSTAAL-LVNR------------SNNTD--------PNAALGNQQADI
D3LB11      VCKFVIT-P-QYQSTTAL-LVNR------------SQDDT--------AATALNDQQADV
A0NKF7      ACKFVIA-P-KYQSTAAL-LVNR------------SQDDT--------AATALNDQQADV
Q04DV7      TCKFVIA-P-KYQSTAAL-LVNR------------SQDDT--------AATALNDQQADV
F6BI63      LSFYVIK-P-TYQASTSLIVSKS----------QTAQYNN--------GQIQFQDVQTNR
G2MWC1      FSYFIAT-P-VYKASTSLIVSRT----------QSSVLTN--------SQIQVQDIQTSR
B0K4N2      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNN--------SQIQVQDIQTSR
C7ISF8      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNN--------SQIQVQDIQTSR
B0KAR6      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNN--------SQIQVQDIQTSR
E8UV30      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNN--------SQIQVQDIQTSR
C0GGR6      ASLYFIQ-P-VYESSATLLVGKP--------------TEG--------TQVVIQDVQLNR
A4J8V1      ISFFVLT-P-RYEASTTLMVGKT-----------YSGQDA--------MMLQYNDILTAN
C8VYQ7      VSYFLIT-P-IYKSSTTLMVGKT-----------YAGENG--------PLLQYNDILTAN
C8W5K3      ISYYFLT-P-VYSATATILVNNK------------SQRIM--------GGLDYQDIMLST
B1BNH4      LSFFVIK-P-QYEATTKLFIGKQ-----------E-SQDN--------NAYNNNDVMMYQ
B1V1Z3      LSFFVIK-P-QYEATTKLFIGKQ-----------E-SQDN--------NAYNNNDVMMYQ
B1R3V2      LSFFVIK-P-QYEATTKLFIGKQ-----------E-SQDN--------NAYNNNDVMMYQ
Q0SVR9      LSFFVIK-P-QYEAKTKLFIGKQ-----------ETSQNA--------ANYDNNDIMMYQ
Q8XN47      LSFFVIK-P-QYEAKTKLFIGKQ-----------ETTQEN--------ASYNNNDVMMYQ
G7M0Q2      LSFLVIS-P-KYETSTKVFIGKE--------GSVIKDLPD--------QNYNGNDVEMYQ
G7M565      ISIFIIS-P-KYEASTKVFIGKE----------LNAQGQE--------QSYDTNDVQMYQ
A6M2M0      ISYFIIP-P-KYEANTKVFIGKE-----------NTTGQD--------QNYSTNDVQMYQ
G7M1R8      VSFFVIA-P-KYESNTKVFIGKE-----------NTNSKD--------QSYNSSDVQMYQ
A5V0I4      IFSRLQE-R-IYRSEASYLVVPN------------RIDNG--------LSIVLQNS----
A7NQ70      IFSRLQE-R-VYRSEASYLVVPN------------RIDNG--------LSIVLQNS----
Q4JZ56      YYQFFVP-K-TYTSDTRIYVVSK--------------GDN--------KNLSNADLQAGS
Q7X554      GTYFFIQ-P-TYTSPTRIYVANQ------------ATDDN--------N-LSAQDLQAGT
Q7X550      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGA
Q7X562      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNK--------N-LSAEDLQAGT
Q7X556      LTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q7X552      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNK--------N-LSAQDLQAGT
Q7X558      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
C5NWJ9      YSIFLVT-P-QYSSTTKVYVVNQ------------KKDDK--------A-ITTQDVQLGS
F3A498      YSIFLVT-P-QYSSTTKVYVVNQ------------KKDDK--------A-ITTQDVQLGS
Q9AHD3      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
Q4K2E2      YSSFIIK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGS
Q4K2F8      YSSFIIK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGS
Q4K046      YSTFIVR-P-EYTSVTRIYIVNR------------NQGDK--------AGLTNQDLQAGT
Q4K0R8      YSTFVVK-P-EYTSTTRIYVVNR------------NQEDK--------PGLTNQDLQAGT
Q4JYY0      YSTFIVK-P-EYTSTTRIYVVNR------------NQEDK--------PGLTNQDLQAGT
Q4JZW8      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDK--------SGLTNQDLQAGT
I0J9C8      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDK--------PGLTNQDLQAGS
Q4K0M4      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDK--------PGLTNQDLQAGS
Q4JZS4      YSAFIVK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGS
Q4JZK2      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDK--------PGLTNQDLQAGS
Q9AHA5      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGS
Q9X9A0      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGS
Q4JYK9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------LGLTNQDLQAGS
Q4K006      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDN--------PGLTNQDLQAGS
Q4JZG8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
A6YIA7      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
E5F5C4      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGT
Q9AHB8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
Q4JZL8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
Q4K1B8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
Q8VU32      YSTFIVK-P-EYTSTTRIYVVNR------------NQEGK--------SGLTNQDLQAGT
D2ERX9      YSAFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
G6C7Z0      YSTFIVN-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
Q4K2A9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
D6ZQI7      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
Q9ZFT9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
Q4K255      YSTFIVK-P-EYMSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGA
F9HJP7      YSVFIAK-P-SYQSTTRIYVVSR------------QQSDN--------NALTNQDLQAGA
E8JWI4      YSVFIAK-P-AYKSTTRIYVVNR------------QQGEN--------PTLTNQDLQAGS
A8AZR4      YSLFIAK-P-SYQSTTRIYVVNR------------QQTDN--------NTLTNQDLQAGS
D0RXH3      YSLFIAK-P-SYQSTTRIYVVNR------------QQTDN--------NTLTNQDLQAGS
Q83YR6      YSLFIAK-P-SYQSTTRIYVVNR------------QQTDN--------NTLTNQDLQAGS
F1Z125      SSIFLIK-P-SYTASTRIYVLNK------------TQQAD--------N-LSATDLQAGG
Q3K0S9      YSLFIVT-P-QYTSSTRIYVINP------------NTPNN--------S-ITAQDLQAGS
P0C0T8      YSLFIVT-P-QYTSSTRIYVINP------------NTPNN--------S-ITAQDLQAGS
Q67AY5      YSLFIVT-P-QYTSSTRIYVINP------------NTPNN--------S-ITAQDLQAGS
Q04662      YSLFIVT-P-QYTSSTRIYVINP------------NTPNN--------S-ITAQDLQAGS
Q8GP93      GTYFFIQ-P-TYTSSTRIYVVNQ------------ANDSK--------N-LSAQDLQADT
Q8GPF7      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNK--------S-LSAQDLQAGT
E3CP61      GTYFLIQ-P-TYTSSTRIYVANQ------------TNDSK--------N-ISAQDLQAGT
E8KUY7      GTYFLIQ-P-TYTSSTRIYVANQ------------TNDSK--------N-ISAQDLQAGT
C2LSE5      GTYFLIQ-P-TYTSSTRIYVVNQ------------ANDGK--------N-LSAQDLQAGT
E9DM16      GTYFFIQ-P-TYTSSTRIYVVNQ------------ADDGK--------N-LSAQDLQAGT
I0QIK5      GTYFFIQ-P-TYTSSTRIYVVNQ------------ADDGK--------N-LSAQDLQAGT
Q7X560      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q8GMA6      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q55204      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q8GPC4      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q8GPA9      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNK--------N-LSAEDLQAGT
G6ERT2      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
O87930      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q8GP55      GTYFFIQ-P-TYTSTTRIYVVNK------------ATDNN--------N-LSAQDLQAGT
F8HDC4      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNK--------N-LSAQDLQAGT
F8LJ76      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNK--------N-LSAQDLQAGT
F8LXJ5      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
Q1WCR2      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNN--------N-LSAQDLQAGT
G3G7C0      YSSFLVT-P-QYKSTTRIYVVGQ------------HAEAG--------AGLTNQDLQAGS
G3G7J8      YSSFLVT-P-QYKSTTRIYVVGQ------------HAEAG--------AGLTNQDLQAGS
G8DU30      YSSFLVT-P-QYESTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
A4VTU2      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
D5AGQ4      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
Q9X4U6      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
G3G7G5      YSSFLVT-P-QYDATTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
G7SG35      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
G8DU06      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
G8DUA9      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
G8DTY9      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAG--------AGLTNQDLQAGS
G3G7I7      YSSFLVT-P-PYDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
G3G7J3      YSSFLVT-P-QFDSTTRIYVVSQ------------NVEAG--------AGLTNQELQAGT
E0PD82      GSIFLIK-P-KYTSTTRIYVVSK------------TADN-----------ITSQDLQAGS
F5X651      GSIFLIK-P-KYTSTTRIYVVSK------------TADN-----------ITSQDLQAGS
G5JTD6      VSVFIIP-K-TYTAGTRIYVVNN------------STSDS----------INYQDIQAGT
Q2KM75      ASMFLIK-P-SYTSTTRLYVINR------------QQSDN----------LTATDLQAGG
G5KAJ3      ASLFLIK-P-SYTSTTRLYVINR------------QQSDN----------LTATDLQAGG
B9DUJ5      GSVFLIK-P-SYSASTRIYVINQ------------QNAEN----------ITATDLQAGS
G5KD12      VSAFLIK-P-SYTSSTRIYVINQ------------QNSDN----------LTALDLQAGG
E8JMT8      GSIFFIK-P-KYTSTTRIYVVSR------------SSD----------SSLTNQDLQAGS
F5X0J8      GSVFLIK-P-KYTSTTRIYVVSR------------SSD----------SSLTNQDLQAGS
H2A601      GSVFFLK-P-KYTSTTRIYVVSR------------SSD----------GSLTNQDLQAGS
E7S8W2      YSAFVAK-K-IYQSTSRIYVVSR------------QNQEN--------NALTNQDLQAGS
F8DFF5      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDN--------NALTNSDLQAGA
I1ZPH8      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDN--------NALTNSDLQAGA
E3CBR9      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDN--------NALTNSDLQAGS
E8K787      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDN--------NALTNSDLQAGS
F9M365      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDN--------NALTNSDLQAGS
A3CQY3      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
E8KLZ0      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F0FHA9      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F0FQQ4      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F0I4H6      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F0IAY2      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F0IJI1      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F0IS52      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F2C9N1      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F2CH54      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F3UDW8      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F3UNJ5      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F3SM33      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQ--------AALTNQDLQAGS
F9HC66      LSSFVLK-P-EYASTTRIYVVSR------------NQSEN--------TGLTNQDLQAGT
E1LQJ6      VSSFVLT-P-EYSSTTRIYVVNR------------NQSEK--------AGLTNQDLQAGT
Q4JYU0      VSSFVLT-P-EYSSTTRIYVVNR------------NQSEK--------AGLTNQDLQAGT
Q4JZY2      VSSFVLT-P-EYSSTTRIYVVNR------------NQSEK--------AGLTNQDLQAGT
F9Q346      YSSFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
Q6L5R1      YSSFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
E9FEC6      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
E0Q2S9      YSSFIVK-S-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
F5VSH0      YSSFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
A5YTV6      YSSFIVK-P-EFTSTTRIYVVNR------------NQGNK--------PGLTNQDLQAGS
Q6L5T1      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
E0PPH8      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
A5YTT8      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
E6KKR9      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
A1ILY0      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
F2QF91      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
Q4K0I3      YSIFIVK-P-EYTSTTRIYVVNR------------NQENK--------PGLTNQDLQAGT
Q8KWQ1      YSTFIVK-P-EYTSTTRIYVVNH------------NQGNK--------LGLTNQDLQAGS
Q4K238      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
B1I966      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
G6J8A3      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
F9LZC3      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
F9P1W9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGS
A5LJR9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------PGLTNQDLQAGT
Q9ZII7      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDK--------SGLTNQDLQAGS
Q4K1K7      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGT
E1LPE6      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEK--------SGLTNQDLQAGS
F9MJW6      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEK--------SGLTNQDLQAGS
Q4K0V3      YSTFVIK-P-EFTSMTRIYVVNR------------NQGEK--------SGLTNQDLQAGS
Q54519      YSTFVIK-P-EFTSMTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
C1CBD0      YSTFVIK-P-EFTSTTRIYVVSR------------DQGEK--------SGLTNQDLQAGS
Q7WVX1      YSTFVIK-P-EFTSTTRIYVVSR------------DQGEK--------SGLTNQDLQAGS
Q4K0E2      YSTFIIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGS
Q9AH96      YSTFVIK-P-EFTSTTRIYVVNR------------NKEEK--------SGLTNQDLQAGS
A5M4L2      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
B2ILP4      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
C1CCB8      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
P72511      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
Q4K1S8      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
P96474      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEK--------PGLTNQDLQAGA
Q4K196      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------PGLTNQDLQAGS
Q4K0Z7      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGT
Q4JZ85      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGS
Q4JYH6      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGS
Q4JZ19      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGT
Q4K0A1      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGS
Q4K1M5      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGT
Q4K2Q8      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEK--------SGLTNQDLQAGS
Q4K1G0      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEK--------SGLTNQDLQAGS
Q4K0T6      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGS
Q4K0K3      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEK--------SGLTNQDLQAGT
Q4K0X6      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEK--------SGLTNQDLQAGS
E8KDN1      FSSFIVK-P-QFTSTTRIYVVNR------------NQGDK--------PGLSNQDLQAGS
F9PEU3      YSSFVIQ-P-QYTSTTRIYVVNR------------NQADK--------PGLTNQDLQAGS
E8K321      YSSFVIK-P-QYTSTTRIYVVNR------------NQADK--------PGLTNQDLQAGA
F9PZP6      YSSFVIK-P-QYTSTTRIYVVNR------------NQADK--------PGLTNQDLQAGA
D6R2T7      YSAFIAP-K-VYQTTTRIYVVSR------------QNTTE--------SALTNQDLQAGS
F3UUQ1      YSAFIAP-K-VYQTTTRIYVVSR------------QNTTE--------SALTNQDLQAGS
E6IZC3      YSTFIIK-P-TYTSSTRIYVVNR------------QPGDN--------STLTNQDLQAGS
G6A746      YNTFIIK-P-NYTSSTRIYVVNR------------QPSDN--------STLTNQDLQAGS
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      LKVDISTESRAA-GSREVADKA-----------ADNLRSEGVDTDS--------------
E9TE87      -----------I-RSRLVLGKT-----------VDDLD----------------------
E6PYQ4      Q-------IIGL-RNPDVAIST-----------MKKLK----------------------
C0QCJ1      Q-------Q--I-MSMSNLEKI-----------IDQFG----------------------
I5B297      Q-------Q--V-LSRSNLEQI-----------IEQFG----------------------
B8D0N1      Y-------SKLL-KTRKLLKKV-----------SQHFD----------------------
D9QTC7      Q-------I--L-KSRSIIQQT-----------IEELE----------------------
C7LPS4      V-------A--M-LSRETLFKV-----------MRILD----------------------
Q314L4      V-------S--L-LSRSSLLSV-----------MKELD----------------------
G0VNK5      E-------I--L-KSRNVVLPV-----------IEKTE----------------------
D2RIR1      E-------I--L-KSRHVVIPV-----------IEQTE----------------------
I0GRR3      E-------I--L-KSRNVIEPV-----------IEKTE----------------------
Q39U16      Y-------A--M-LSRTFVTNV-----------LKSLD----------------------
F0JCB9      V-------T--M-LSRNMLSKV-----------INALD----------------------
G7QCG0      V-------S--L-TSRNLLLPV-----------IKQLD----------------------
I2Q342      V-------S--L-TSRNLLLPV-----------IKQLD----------------------
Q74BQ7      E-------A--I-TSRTLVTKV-----------INDLD----------------------
B5EA80      Y-------E--I-TSRTLLTKV-----------MDSLD----------------------
C6DZX6      Y-------E--I-TSRTLLAKV-----------VDNLD----------------------
A1ARV9      Y-------A--I-TSRTLLSKA-----------AENLD----------------------
E8WSZ4      Y-------A--I-TSRTLLNKV-----------VESLD----------------------
A5G425      Y-------A--I-TSRTLLLKV-----------IDDLD----------------------
B9M2X7      Y-------A--M-ASRPLLQKV-----------VSDLD----------------------
C2MBF7      I-------I--L-STERVVSET-----------VRRLG----------------------
H8YYB8      MTTENLGKI--I-ESYQLYPEL-----------MQRYG----------------------
B7B948      S-------R--R-LMTEVARNLHLDVSYTVKDGLRTVE----------------------
G8AU95      S-------R--A-LAE----RV-----------VEKLG----------------------
G5IFS2      -----------V-TSRPVTSKV-----------IENLD----------------------
F0G6H6      S-------R--A-V----MARA-----------VDTTK----------------------
A3W0H6      Q-------R--L-MARDNLVKV-----------IERHG----------------------
A3K8W6      Q-------R--L-MSRDNLVSL-----------MDKYD----------------------
Q0FMP1      Q-------R--L-MSRDNLLAL-----------MEEHG----------------------
S9QRP2      Q-------R--L-MSRDNLMRI-----------MEEHD----------------------
F4SM98      -------------QGNAILNSL-----------SQMLP----------------------
C4Z673      TLSKDYEQL--V-TSRYVIEGV-----------INDLK----------------------
E3H7M4      KLVSTYTEI--A-QSSSIMRDV-----------VQKL-D---------------------
F8KGP2      QMINTYKDI--I-TNQVILSKA-----------SKQLKNPVKV-IKPAQPA---EYRRNA
B3XL22      QMINTYKDI--I-TNQVILSKA-----------SKQLKNPVRV-IKPAQPA---EYRRNA
F8DRU3      QMINTYKDI--I-TNQVILSKA-----------SKQLKNPVRV-IKPAQPA---EYRRNA
C2EWM2      QVINTYKDI--I-TNQVILSKA-----------SKQLENPVRV-ITPAKKA---VYERNA
D0DSJ3      QMINTYKDI--I-TNQVILKSA-----------SKQLANP--------------------
B2GF32      QMINTYKDI--I-TNQVILKSA-----------SKQLANP--------------------
C0WW25      QMINTYKDI--I-TNQVILKSA-----------SKQLANP--------------------
F0K0J8      NAITTYKDI--I-TSNVILKGA-----------SKYLANPVTL-VKKATPA---------
G6F8H0      NAVTTYKDI--I-TSNVILKGA-----------SKYLANPVTL-VKKATPAKKAVYKTN-
F0HVF2      NAVTTYKDI--I-TSNVILKGA-----------SKYLANPVTL-VKKATPAKKAVYKTND
Q1G8E3      NAITTYKDI--I-TSNVILKGA-----------SKYLANPVTL-VKKATPA---------
D6S4X3      QVITTYKDI--V-TSPKILKAA-----------SKQLANPVKV-VKEAVPA---KYETLA
Q5FIC6      QMVTTYKDI--V-TSNKILTEA-----------SNRLANPTVV-VKKAQKA---VYRTDE
E4SMV6      QMVTTYKDI--V-TSNKILTEA-----------SNRLANPTVV-VKKAQKA---VYRTDE
F0TGY3      QMVTTYKDI--V-TSNKILTEA-----------SNRLANPTVV-VKKAQKA---VYRTDE
F2M2M7      QMVTTYKDI--V-TSNKILTEA-----------SNRLANPTVV-VKKAQKA---VYRTDE
A4ZGZ7      QLVNTYKDI--V-TSHVILQDA-----------SDRLANPVRV-VKKAKPA---KYKT-I
C2EPK4      QMVTTYKDI--V-TSHKILEEA-----------SNRLANPTVV-VKKAKKA---VYRIDE
C7XKF2      QMVTTYKDI--V-TSHVILQDA-----------SNRLANPVRV-VKKAKPA---KYKTNA
E3R265      QMVTTYKDI--V-TSHVILQDA-----------SNRLANPVRV-VKKAKPA---KYKTNA
D0DJG9      QMVTTYKDI--V-TSHVILKDA-----------SDRLANPVRV-VRKARPA---KYRTNE
D5GZJ9      QMVTTYKDI--V-TSHVILKDA-----------SDRLANPVRV-VRKARPA---KYRTNE
A8YX90      QLVNTYKDI--V-TSHVILQDA-----------SDRLANPVRV-VKKAKPA---KYRTNA
F0NWJ8      QMVTTYKDI--V-TSHVILQDA-----------SDRLANPVRV-VMKAKPA---KYRTNA
C2JZS0      QLINTYKDI--I-TRPLVLKTV-----------SKNLTSPQKVKVQKAEKA---VYGTRY
C1J9I2      QIINTYKDI--I-TRPVVLQAV-----------AEDLTSPQRVMVKKAKPA---VYGTRY
Q58Z11      QIINTYKDI--I-TRPVILREV-----------ADDLTSPRRVKVKKAQKA---VYGTRY
B1MZT2      QIINTYKNL--V-ISSNVLGDV-----------ADKLKQPKTEVVQPAKPA---VYETLA
C2KHF2      QLINTYKNL--I-ISSNVLGTV-----------SDKLKNPAPIVVQKAKDA---VYKTLA
Q03W94      QLINTYKNL--I-ISSNVLGTV-----------SKELKNPAPIVVQEAQDA---EYKTLA
C6CW36      MLMDSYKEI--I-SSAAILDKV-----------VEKNPS---------------------
A8SQS9      SLTADYEEL--I-LSYPVLDQV-----------IDKM-N---------------------
D5HFS3      SLTKDYEDL--I-LSYPVLDQV-----------IEKL-G---------------------
B9Y883      KLVNTYSEI--L-KSEAISDEV-----------IQNLKL---------------------
A5Z5P8      SLSEDYAEL--L-HVRPIIEAI-----------NEE--N---------------------
G2KUP2      QRVYTYKDI--I-TSPVIQNTV-----------KKDLAG---------------------
G8PE07      QMISTYKDI--I-MSPAVLRDV-----------DSSLAG---------------------
E0NHP5      QMINTYKDI--I-TSPTVLREA-----------DEKLTG---------------------
Q03GL9      QMISTYKDI--I-TSPTVLKTV-----------NTKLQG---------------------
C6CSC7      KMIDTYKEV--I-KTPAILGKV-----------AEK-YP---------------------
C6CS79      SLINTYKEI--I-KTPAIMDLV-----------VKK-HP---------------------
F5LM70      SLIHTYKEI--I-KTPAIMDLV-----------VKE-HP---------------------
G0LYN8      QMVTTYKEL--I-AGQVVLKPA-----------KQQLSK---------------------
F6ITB3      QMITTYKEL--I-AGQVVLKPA-----------KQQLSK---------------------
G0M1Y0      QMITTYKEL--I-AGQVVLKPA-----------KQQLSK---------------------
D7VC12      QMITTYKEL--I-AGQVVLNPA-----------KQQLSK---------------------
F9UMZ5      QMITTYKEL--I-AGQVVLKPA-----------KQQLSK---------------------
D4JI68      SLTNDYIVV--V-KG----RPV-----------LDQVIE---------------------
D6E329      SLTNDYIVV--V-KG----RPV-----------LDQVIE---------------------
Q1AUN7      EGLQQLAQT--V-AEAVATRPI-----------AEAAAQ---------------------
H4GK02      QLINTYKDI--I-TNQVILQEA-----------TKDLAN---------------------
F6IR92      QMITTYKEL--I-TNSVVLKPA-----------RQDLMD---------------------
G0M0G0      QMITTYKEL--I-TNSVVLKPA-----------RQDLMD---------------------
D7VBW5      QMITTYKEL--I-TKPVVLKPA-----------RQTLMA---------------------
F9UQ55      QMITTYKEL--I-TKPVVLKPA-----------RQTLMA---------------------
D4YHG8      TLLNTYQSL--V-SRPLVLDPA-----------IADVPE---------------------
F7V793      SMATDYEQL--I-RVRTIADDT-----------IKDL-H---------------------
C3WFM8      RLVITYSEI--A-KNKSILNKV-----------INKY-D---------------------
H7F1R6      QLVNTYTSI--I-TSPRILSAV-----------SAIL-D---------------------
H7F570      QLVNTYASI--L-KSPGLLNGV-----------AQKI-N---------------------
C6LCS6      QLTKDYMEL--V-TTRPVLEAV-----------ISAL-E---------------------
A7VF43      SLTKDYEDL--M-LSYPLLEQV-----------IAKL-D---------------------
A7Z922      HYNNTFQTI--M-KSPVVLEKV-----------KQTL-H---------------------
I2CAF3      HYNNTFQTI--M-KSPVVLEKV-----------KQTL-H---------------------
I2HVL3      HYNNTFQTI--M-KSPVVLEKV-----------KQTL-H---------------------
E0U2Z4      QYSSTFQSI--M-KSTALMEEV-----------KAEL-H---------------------
D4G1R3      QYSSTFQSI--M-KSTALMEEV-----------KAEL-H---------------------
G4EQZ6      QYSSTFQSI--M-KSTALMEEV-----------KAEL-H---------------------
P71050      QYSSTFQSI--M-KSTALMEEV-----------KAEL-H---------------------
G4P115      QYSSTFQSI--M-KSTALMEEV-----------KAEL-H---------------------
A8FHM0      QYTRTFQVL--L-KSPIVIEKV-----------KETL-N---------------------
C0EBA5      KLISTYSQI--A-QTPEVIDQV-----------IRKL-K---------------------
B7BDT7      NVNNEIQSL----QSPAVMLDV-----------VKRL-H---------------------
H6LKR9      QLIIDYKEI--A-LTRLVIDAV-----------VKNT-G---------------------
F5LE49      MLVNTYKEI--I-KTPAIMEKV-----------ASRFTG---------------------
F3AHH1      LLTKDYAEL--I-LSRTVTEAV-----------IGKL-D---------------------
F3Y921      QMINTYKDL--I-KSDSLIGEI-----------HKQL-N---------------------
G4L593      QMLNTYKDI--IEEGDALAASM-----------QDRL-A---------------------
E6LD65      QMINTYKDF--I-VSDLVLNQV-----------QSRL-D---------------------
C9ALZ8      QMINTYKDM--I-VSDLVLNEV-----------KDRL-E---------------------
C9BUG6      QMINTYKDM--I-VSDLVLNEV-----------KDRL-E---------------------
Q3XYS7      QMINTYKDM--I-VSDLVLNEV-----------KNRL-E---------------------
C9B453      QMINTYKDM--I-VSDLVLNEV-----------KDRL-E---------------------
D4RJF5      QMINTYKDM--I-VSDLVLNEV-----------KDRL-E---------------------
C8ZXT8      QMINTYKDM--I-VSDLVLNEV-----------KDRL-E---------------------
F0EKB8      QMINTYKDM--I-VSDLVMTQV-----------KDRL-E---------------------
C9A6V4      QMINTYKDM--I-VSDLVMTQV-----------KDRL-E---------------------
C9CHY7      QMINTYKDM--I-VSDLVMTQV-----------KDRL-E---------------------
E6UHY5      SLATTYIVI--L-DDPLLYESI-----------SDKL-L---------------------
E9SAU2      SLAATYIVI--L-DDASVYEAI-----------SDRL-L---------------------
F7K0U2      QLTKDYMEL--I-KSRSVMEQV-----------ISQL-Q---------------------
O06029      QMANTINQV--I-VSPVILDKV-----------RSNL-N---------------------
G8P3D6      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
A9QSJ3      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
F9VC43      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
G6FD41      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
G9M881      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
Q3ZK51      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
Q83VG0      QMANTINQV--I-VSPVILDKV-----------QSNL-N---------------------
C6LDI9      ALTADYQMI--A-TSRPVVDQV-----------IENL-E---------------------
G5F9H3      QLTQDYKVL--V-GSRPVLQGV-----------VDHM-K---------------------
C0CZV8      QLTKDYKII--V-TSRPVLEDV-----------IEGL-E---------------------
G5GFW1      QLTKDYKII--I-SSRPVLQKV-----------INTL-D---------------------
H1LCW2      QMISTYKDI--I-TNQLVLKTA-----------SERLANPVKVIRSARKAR-------YH
I5AV00      TLTKDYVEL--I-QSREVTEAV-----------SARL-S---------------------
H6NE44      KLIKTYSEI--L-RTSAVLEKV-----------AAAYPE---------------------
F4BS20      QMINTYRDI--I-EDPVVIDKV-----------INEL-G---------------------
E0RZL4      QLTQDYAEL--I-KSRRVLEEV-----------IQRLHL---------------------
C0CK72      ELTNDYEII--F-TSRPILQEV-----------IDEL-K---------------------
D9S1J8      LLVSTYGEI--A-KSRSTLEEV-----------LRRL-N---------------------
C2EFR7      ELIKDYEEM--V-KSRAVLENI-----------IEKQ-D---------------------
Q1WTC7      ELIKDYEEM--V-KSRAVLENI-----------IEKH-D---------------------
B0P2G1      QLTQDYMVI--V-KTRPVLEQV-----------IADL-K---------------------
D4MW28      QLTQDYMVI--V-KTRPVLEQV-----------IADL-K---------------------
E5VMX9      QLTQDYMVI--V-KTRPVLEQV-----------IADL-K---------------------
F2I6Z8      --LKTYDDL--L-HTPLILQPV-----------AQAH-Q---------------------
E6U7N3      ELVNTYSVI--L-TSDTVLDQV-----------ISDL-N---------------------
C4Z8M6      SLTNDYIVV--V-KGRPVLDQV-----------IENL-N---------------------
D4JMC3      SLTNDYEYV--I-TGRTVLSQV-----------IDNL-D---------------------
D6E0V3      SLTNDYEYV--I-TGRTVLSQV-----------IDNL-D---------------------
E3GPC7      KLVGTYSEI--A-KSKSVVSEV-----------ENNL-N---------------------
A6BIG6      MLTKDYMEM--V-KSRPVLEKV-----------ISEL-N---------------------
C2CI43      ALISTYSEI--V-KSKGIADKV-----------IKNL-G---------------------
D4RX68      TLSSDYVEI--V-KSRTVLEQV-----------IANL-D---------------------
D4J4T5      QLTSDYSSM--I-KSRSFMEDV-----------IKKL-N---------------------
I5ASF9      QLTNDYKVL--I-LSRPVLEKT-----------IKKT-G---------------------
C0C0F9      QLTKDYMEL--V-KSRPVLEQV-----------IAVL-N---------------------
B6W7H3      ALVSTYSEI--V-KSKGVADKV-----------IDNL-K---------------------
C7RGH5      ALISTYSEI--V-KSKGIAERV-----------INNL-G---------------------
F0GT82      ALISTYSEI--V-KSKGIADQV-----------IKNL-S---------------------
F3AH93      QLASDYQVL--I-KSKPVMEQV-----------IENL-N---------------------
B0GAL4      QLTKDYSIL--I-TSRPVLTDV-----------IDQL-D---------------------
G1WUK1      QLTKDYSIL--I-TSRPVLTDV-----------IDQL-D---------------------
D4M2S1      QLTKDYNIL--I-TSRTVLQDV-----------VDEL-N---------------------
E7GL80      QLTQDYKEL--I-GSRPVMQEV-----------INTL-N---------------------
G5F9E3      QLTQDYKEL--I-GSRPVMQEV-----------INTL-N---------------------
D4CG07      QLTQDYKVM--I-TSRPVLQQV-----------VDEL-G---------------------
D4MP31      QLTQDYKVM--I-TSRPVLQQV-----------VDEL-G---------------------
G5HNC6      QLTKDYSVM--I-TSRPVLEQV-----------IEKQ-G---------------------
A8RK86      QLTKDYSVM--I-TSRPVLEQV-----------IKNQ-G---------------------
G5HTB1      QLTKDYSVM--I-TSRPVLEQV-----------IENQ-G---------------------
A8RSL0      QLTKDYKII--V-TSRRVLNQV-----------IEDM-E---------------------
C5EN02      QLTKDYKII--V-TSRRVLNQV-----------IDDM-K---------------------
G5HG46      QLTKDYKII--V-TSRRVLNQV-----------IDEM-E---------------------
E7GL39      QLTQDYKVL--V-GSRPVLQGV-----------VDHM-K---------------------
E7GL56      QLTQDYKVL--V-SSRPVMEGV-----------INHL-K---------------------
G5F9B0      QLTQDYKVL--V-SSRPVMEGV-----------IKHL-K---------------------
D3AC81      QLTKDYKVL--V-TSRPVTAQV-----------ITNL-D---------------------
D3AE79      QLTKDYKVL--V-TSRPVLEQV-----------TENL-G---------------------
D4YF14      TLVSTYRDI--I-LGDGVLTEV-----------NNSL-D---------------------
B1YMM6      TLVNTYRVI--I-KSPAILEKV-----------QAEVKN---------------------
D4LG05      SLTSDYEEL--M-FSYPVLNRV-----------IEKL-K---------------------
D4LTH3      SLTSDYEEL--M-LSYPVLNRV-----------IEKL-D---------------------
F3ATF6      ALTGDYSIL--A-TSRSVLEEV-----------IEDL-G---------------------
E0I7B6      MVINSYKEI--I-KSKAIMDKV-----------AAAYPD---------------------
C9LAS2      QLTKDYSVL--I-TSRPVLDET-----------VKNL-D---------------------
F7K8E8      QLTKDYAEL--I-QSRFVLEEV-----------VQGM-G---------------------
F7K9V0      QLTKDYAEL--I-QSRFVLEEV-----------VQGM-G---------------------
F7KL97      QLTKDYAEL--I-QSRFVLEEV-----------VQGM-G---------------------
D3FZP5      KYIQTYNVI--M-KSPYILDQV-----------IDEL-D---------------------
C0ZHV9      KLIETYRVI--I-ESPRVMERV-----------LEVI-G---------------------
D7WMM9      RLINTYNII--I-TSSAILSKV-----------INKL-D---------------------
A8U9F5      QMINTYKDI--I-KGPVVLNEV-----------RENL-G---------------------
F4BSE0      QMINTYKDI--I-KGPVILNEV-----------RENL-G---------------------
E7RDR2      QLINTYSVI--I-KSPAILDEV-----------ASQL-D---------------------
I0JRK5      DLINTYNVI--I-KSPRILDQV-----------VEEL-G---------------------
G2TR26      QLVNTYNVI--I-KSPSILDKV-----------IDEL-K---------------------
D5DBK2      QLISTYNDI--I-KSPAILDKV-----------IDKL-K---------------------
D5DY80      QLINTYNDI--I-TSPVILDKV-----------IKEL-K---------------------
A7Z9K1      QLINTYNVI--I-KSPVILDEV-----------IKQL-H---------------------
I2CB17      QLINTYNVI--I-KSPVILDEV-----------IKQL-H---------------------
I2HW54      QLINTYNVI--I-KSPVILDEV-----------IKQL-H---------------------
G4P1M8      QLINTYNVI--I-KSPAILDEV-----------IKEM-G---------------------
E0TTZ7      QLINTYNVI--I-KSPAILDEV-----------IKEM-G---------------------
G4EQF2      QLINTYNVI--I-KSPAILDEV-----------IKEM-G---------------------
P96715      QLINTYNVI--I-KSPAILDEV-----------IKEM-G---------------------
I0F9R7      QLINTYNVI--I-KSPAILDEV-----------IKEM-G---------------------
G9QKR5      QLVNTYSVI--I-KSPAVLEKV-----------IKEL-K---------------------
B5UQ74      QLTNTYKVI--I-KSPVILEQV-----------KEKL-G---------------------
B7HFH2      QLTNTYKVI--I-KSPVILEQV-----------KQKL-N---------------------
Q72XH7      QLTNTYKVI--I-KSPVILEQV-----------KEMQ-G---------------------
C2V4M3      QLTNTYKVI--I-KSPVILDQV-----------KEKL-G---------------------
C2YZB3      QLTNTYKVI--I-KSPVILDQV-----------KEKL-G---------------------
C2P8H2      QLTNTYKVI--I-KSPVILDQV-----------KEKL-G---------------------
C2Y451      QLTNTYKVI--I-KSPVILDQV-----------KEKL-G---------------------
C3EBC1      QLTNTYKVI--I-KSPVILDQV-----------KENL-G---------------------
C3H980      QLTNTYKVI--I-KSPVILDQV-----------KEKL-G---------------------
C2PN23      QLTNTYKVI--I-KSPVILDQV-----------NEKL-N---------------------
B9IRQ7      QLTNTYKVI--I-KSPVILDQV-----------KSKL-G---------------------
A0RL71      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
C2XJI0      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
Q3EV65      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
C2T8T7      QLTNTYKVI--I-KSPVILDRV-----------NEKL-N---------------------
C2RG50      QLTNTYKVI--I-KSPVILDRV-----------NEKL-N---------------------
Q814Y9      QLTNTYKVI--I-KSPVILDRV-----------NEKL-N---------------------
B3ZRD5      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
Q6HB08      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
C2NQN7      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
C3GRR1      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
C2ULR7      QLTNTYKVI--I-KSPVILDQV-----------NEKL-N---------------------
C3GBJ9      QLTNTYKVI--I-KSPVILDQV-----------NEKL-N---------------------
C2WVG7      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
B7IQS9      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
A9VRC4      QLTNTYKVI--I-KSPVVLDQV-----------NEKL-N---------------------
C2MTG4      QLTNTYKVI--I-KSPVILDQV-----------NEKL-K---------------------
B7HXB5      QLTNTYKVI--I-KSPVILDQV-----------NEKL-N---------------------
C2SBU5      QLTNTYKVI--I-KSPVILDQV-----------NEKL-N---------------------
C2SSX9      QLTNTYKVI--I-KSPVVLDQV-----------NEKL-N---------------------
G9QCG2      QLTNTYKVI--I-KSPVILEQV-----------NEKL-N---------------------
Q2BFS6      QLINTYNVI--I-KSPAILDLV-----------KEEL-D---------------------
I3EBB4      QLINTYNVI--I-KSPAILDLV-----------IKEL-H---------------------
A4ITF4      QLINTYSVI--I-KSPTILEKV-----------KGEL-Q---------------------
C5D962      QLINTYSVI--I-KSPTILEKV-----------KEEL-N---------------------
G8MZ94      QLINTYSVI--I-KSPTILEKV-----------KDEL-H---------------------
Q5KUM4      QLINTYSVI--I-KSPTILEKV-----------KDEL-H---------------------
G5SDT9      PASDAEIQL--I-RSRLVLGKT-----------VDDLD----------------------
G5LQM7      PASDAEIQL--I-RSRLVLGKT-----------VDDLD----------------------
G5Q4J1      PASDAEIQL--I-RSRLVLGKT-----------VDDLD----------------------
B1V0N8      KMIGAYVEI--F-NNEDVVSKL-----------LKKAN----------------------
B1BNK2      KMIGAYVEI--F-NNEDVVSKL-----------LKKAN----------------------
B1R3X7      KMIGAYVEI--F-NNEDVVSKL-----------LKKAN----------------------
Q8XN77      KMIGAYVEI--F-NNEDVVSKL-----------LKKAN----------------------
B1HR40      RLINTYNVI--I-KSPVILTKV-----------IDVLA----------------------
G2Z8Q4      QFVNTYSVI--L-TSSRILDQV-----------KDNLN----------------------
F8FCE3      KLIKTYSEI--L-RTSAVLEKV-----------AAAYP----------------------
I0BSG5      KLIKTYSEI--L-RTSAVLEKV-----------AAAYP----------------------
A8YPQ6      QLVNTYKEI--V-KSPRILDEV-----------SKDLN----------------------
P95695      QLVNTYKEI--V-KSPRILDEV-----------SKDLN----------------------
Q2G1K8      QLVNTYKEI--V-KSPRILDEV-----------SKDLN----------------------
C5QNG5      QLVNTYAEI--I-KSPRILDDV-----------AKE-N----------------------
Q4L9H8      QLVNTYSQI--L-KSPRILDEV-----------AKK-D----------------------
Q2FUV1      QSVNTYTEI--I-KSPRILDKV-----------SREFD----------------------
P39850      QLVNTYSEI--V-KSPRILDKV-----------SKELD----------------------
D7UYE3      QLVNTYAEI--I-KSPRILESV-----------SKNLD----------------------
Q4A121      QLVNTYSEI--I-KSPRILDKV-----------SKNLK----------------------
E3HB17      KLVSSYTEV--A-RSKSIMKNV-----------IKRLG----------------------
C9AAE4      QLVSTYSTI--I-MSPRILNEV-----------SEALE----------------------
H7F6C7      QLVNTYSTI--I-SSPRILNEV-----------QQDLG----------------------
F0SX23      SLIKTYMTI--I-QSDTVLEKV-----------ITTLG----------------------
Q38VG4      QMINTYKDL--I-TKPVIMDSV-----------TKKIND---------------------
F2I4B6      QLINTYSDV--I-RNEVVLSPV-----------IDQLN----------------------
Q8RBS6      MLAATYSEI--V-KSRRVLQPV-----------VTKLN----------------------
D9SR42      KIVKTYSQI--A-KSRKVADDV-----------KEKLS----------------------
D9SVC8      KAVKTYGKI--A-TSRTVASDV-----------IDKLS----------------------
E7RG09      QLVSTYSEI--L-KSPIILDQV-----------ISQLD----------------------
D4G2E2      QLINTYNVI--I-KSPAILDEV-----------IKEMG----------------------
Q8EME7      EIINTYNVI--I-KSPAILDTV-----------ATELQ----------------------
D6Y035      RYIETYSVI--L-KSPYILDQV-----------VDELE----------------------
Q5WBB3      ELIDTYSEI--I-KSPRILNEV-----------IEAEG----------------------
Q9K6Q9      DLINTYSVI--I-KSPAILDKV-----------IDNLQ----------------------
Q97EP7      NLTKTYAQI--A-ESRSVASKT-----------VSKLS----------------------
Q97ER4      NLTKTYAQI--A-QSKQVADKT-----------VSKLA----------------------
E4S7Y7      QLVKDYREI--A-VSRTVLERV-----------IKELN----------------------
E4Q5T6      QLVKDYREI--A-VSRTVLERV-----------IKELN----------------------
E4SDX3      QLVKDYREI--A-VSRTVLERV-----------IKELN----------------------
G2FWX3      QLTKTYAAI--A-KSRTVEQNV-----------INGLE----------------------
G7WJV2      QLAKTYALI--A-QSRTVEEKV-----------IKELN----------------------
G7W774      QLAKTYAAI--A-QSRTVEQSV-----------IDDLD----------------------
G2FM60      QLAKTYATI--A-QSRTVEQNV-----------LKDLN----------------------
H5XZD5      QLAKTYALI--A-QSRTVEEKV-----------IEELD----------------------
I4DBG9      QLAKTYATI--A-QSRTVEEQV-----------IKDLD----------------------
G2FWT7      QLAKTYATI--A-QSRTVEQSV-----------LNDLN----------------------
H5XZG8      QLAKTYAAI--A-QSRTVEQNV-----------INNLD----------------------
G0V448      KLVKTYASI--A-KSRTVVEKT-----------IQKLS----------------------
A0PZ01      RLVKTYATI--A-KTNDVLEQV-----------IEKLN----------------------
B1B737      RLVKTYATI--A-KTNDVLEKV-----------IEKLK----------------------
D9ST43      NLITTYAEI--G-RSASVAENA-----------SKMLK----------------------
H7F5T7      QMINTYKAL--I-KSPKVLNQV-----------SADLK----------------------
G9WIR0      QIIYTYRDL--A-TRPVILDQV-----------ARNLR----------------------
D3LB11      QLIYTYKDL--V-TRPVILNKV-----------AKELK----------------------
A0NKF7      QLIYTYKDL--I-TRPVILNKV-----------AKELK----------------------
Q04DV7      GLIYTYKDL--I-TRPVILNKV-----------AKELK----------------------
F6BI63      LLAATYAEI--A-TSRSVLQEA-----------INKLN----------------------
G2MWC1      MLAATYSEI--V-KSRRVLQPV-----------IERLR----------------------
B0K4N2      MLAATYSEF--V-KSRRVLQPV-----------IERLR----------------------
C7ISF8      MLAATYSEF--V-KSRRVLQPV-----------IERLR----------------------
B0KAR6      MLAATYSEF--V-KSRRVLQPV-----------IERLR----------------------
E8UV30      MLAATYSEF--V-KSRRVLQPV-----------IERLR----------------------
C0GGR6      QLVKTYEEI--A-RSGVVASAV-----------IQDLN----------------------
A4J8V1      QLVKTYSQI--A-KSRTVVEKV-----------MQSEK----------------------
C8VYQ7      QLVKTYSQI--A-KSRTVAEKI-----------IEQEK----------------------
C8W5K3      ELAKTYSKI--A-VSRTVAEKV-----------LQVEK----------------------
B1BNH4      QLMKTYAEL--A-KTSDLVTKA-----------VKSAD----------------------
B1V1Z3      QLMKTYAEL--A-KTSDLVTKA-----------VKSAD----------------------
B1R3V2      QLMKTYAEL--A-KTSDLVTKA-----------VKSAD----------------------
Q0SVR9      KLMKTYAEL--A-KTSDLVTKA-----------VKNAK----------------------
Q8XN47      KLMKTYAEL--V-KTSDLVTKA-----------VKSAN----------------------
G7M0Q2      KLLKTYAEI--I-KTNDLIEKA-----------VDVEN----------------------
G7M565      KLLKTYVEI--I-KTNDLIDRA-----------INFSN----------------------
A6M2M0      KLIKTYAEI--I-KTNDLVQRA-----------IDSSD----------------------
G7M1R8      QLLKTYAEV--V-KTNDLVEKA-----------IEKTG----------------------
A5V0I4      --MSSFREM--A-LARPQLQKI-----------SDELK----------------------
A7NQ70      --MSSFREM--A-LARPQLQKI-----------SDDLQ----------------------
Q4JZ56      ALTKDYKEI--I-LSDEVLEET-----------ISDLK----------------------
Q7X554      YLVNDYYEI--I-TSDDVLSEV-----------IKDEK----------------------
Q7X550      FLVKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q7X562      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q7X556      YLVNDYNEI--I-TSNDVLSEV-----------IKDEK----------------------
Q7X552      YLANDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q7X558      YLANDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
C5NWJ9      LLVKDYKEI--I-LSNKVMEDA-----------AEKSG----------------------
F3A498      LLVKDYKEI--I-LSNKVMEDS-----------AEKSG----------------------
Q9AHD3      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q4K2E2      YLVKDYREI--I-LSQDVLEKV-----------VTDLQ----------------------
Q4K2F8      YLVKDYREI--I-LSQDVLEKV-----------VTDLQ----------------------
Q4K046      YLVKDYREI--I-LSQDVLEKV-----------AANLK----------------------
Q4K0R8      YLVKDYREI--I-LSHDVLEKV-----------ATNLK----------------------
Q4JYY0      YLVKDYREI--T-LSHDVLEKV-----------ATNLK----------------------
Q4JZW8      YLVKDYREI--T-LSQDVLEKV-----------ATNLK----------------------
I0J9C8      YLVKDYREI--I-LSQDVLEKV-----------VTNLK----------------------
Q4K0M4      YLVKDYREI--I-LSQNVLEKV-----------ATNLK----------------------
Q4JZS4      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q4JZK2      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q9AHA5      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q9X9A0      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q4JYK9      YLVKDYREI--I-LSQDSLEKV-----------ATNLK----------------------
Q4K006      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q4JZG8      YLVKDYREI--V-LSQDVLEKV-----------VTNLK----------------------
A6YIA7      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
E5F5C4      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q9AHB8      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q4JZL8      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q4K1B8      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q8VU32      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
D2ERX9      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
G6C7Z0      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q4K2A9      YLVKDYREI--I-LSQDVLEKV-----------AINLK----------------------
D6ZQI7      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q9ZFT9      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q4K255      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
F9HJP7      YLVKDYKEI--I-LSQDVLSTV-----------ISELK----------------------
E8JWI4      YLVKDYKEI--I-LSQDVLASV-----------ISELK----------------------
A8AZR4      YLVKDYKEI--I-LSQDVLSTV-----------ISELK----------------------
D0RXH3      YLVKDYKEI--I-LSQDVLSTV-----------ISELK----------------------
Q83YR6      YLVKDYKEI--I-LSQDVLSTV-----------ISELK----------------------
F1Z125      LLVNDYKEI--I-TSRDVMKDV-----------IANDG----------------------
Q3K0S9      FLANDYKEI--I-TSTDVLEKV-----------ISSEK----------------------
P0C0T8      FLANDYKEI--I-TSTDVLEKV-----------ISSEK----------------------
Q67AY5      FLANDYKEI--I-TSTDVLEKV-----------ISSEK----------------------
Q04662      FLANDYKEI--I-TSTDVLEKV-----------ISSEK----------------------
Q8GP93      FLTKDYKEI--I-TLNDVLSEV-----------IKDEK----------------------
Q8GPF7      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
E3CP61      FLTKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
E8KUY7      FLTKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
C2LSE5      FLTKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
E9DM16      FLTKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
I0QIK5      FLTKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q7X560      YLANDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q8GMA6      YLANDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q55204      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q8GPC4      YLANDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q8GPA9      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
G6ERT2      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
O87930      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q8GP55      YLANDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
F8HDC4      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
F8LJ76      YLVNDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
F8LXJ5      FLVKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
Q1WCR2      FLVKDYKEI--I-TSNDVLSEV-----------IKDEK----------------------
G3G7C0      YLAKDYKEI--I-LSQDVLTQI-----------ATELN----------------------
G3G7J8      YLVKDYKEI--I-LSQDVLTQI-----------ATELN----------------------
G8DU30      YLVKDYREI--I-LSQDVLTQV-----------ATELN----------------------
A4VTU2      YLAKDYREI--I-LSQDVLTQV-----------ATELN----------------------
D5AGQ4      YLAKDYREI--I-LSQDVLTQV-----------ATELN----------------------
Q9X4U6      YLAKDYREI--I-LSQDVLTQV-----------ATELN----------------------
G3G7G5      YLVKDYKEI--I-LSQDVLTQV-----------ATELN----------------------
G7SG35      YLVKDYKEI--I-LSQDVLTQV-----------ATELN----------------------
G8DU06      YLVKDYKEI--I-LSQDVLTQV-----------ATELN----------------------
G8DUA9      YLVKDYKEI--I-LSQDVLTQV-----------ATELN----------------------
G8DTY9      YLVKDYKEI--I-LSQDVLTQV-----------ATELN----------------------
G3G7I7      YLVKDYREI--I-LSQDVLTQV-----------ATELN----------------------
G3G7J3      YLVKDYKEI--I-LSQDVLSRV-----------KTELG----------------------
E0PD82      YLVNDYKEV--I-TSSEVLSSV-----------IDQQK----------------------
F5X651      YLVNDYKEV--I-TSSEVLSSV-----------IDQQK----------------------
G5JTD6      DLVNDYKEI--I-QSQDVLDDV-----------VKKEK----------------------
Q2KM75      YLVNDYKEI--I-TSRDVMHDV-----------IAKEN----------------------
G5KAJ3      YLVNDYKEI--I-TSRDVMQDV-----------IASDG----------------------
B9DUJ5      FLVNDYKEI--I-TSRDVMKDV-----------IATNS----------------------
G5KD12      YLVNDYKEI--I-TSRDVMKDV-----------IANNN----------------------
E8JMT8      YLVNDYKEV--I-TSNEVLSSV-----------IDQEN----------------------
F5X0J8      YLVNDYKEV--I-TSNEVLSSV-----------ISQEN----------------------
H2A601      YLVNDYKEV--I-TSNEVLSSV-----------ISQEN----------------------
E7S8W2      YLVKDYREI--I-LSQNVLNQA-----------IEELK----------------------
F8DFF5      YLVKDYREI--I-LSQNVLSQA-----------IEELK----------------------
I1ZPH8      YLVKDYREI--I-LSQNVLSQA-----------IEELK----------------------
E3CBR9      YLVKDYREI--I-LSQNVLSQA-----------IEELK----------------------
E8K787      YLVKDYREI--I-LSQNVLSQA-----------IEELK----------------------
F9M365      YLVKDYREI--I-LSQNVLSQA-----------IEELK----------------------
A3CQY3      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
E8KLZ0      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F0FHA9      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F0FQQ4      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F0I4H6      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F0IAY2      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F0IJI1      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F0IS52      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F2C9N1      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F2CH54      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F3UDW8      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F3UNJ5      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F3SM33      YLVKDFKEI--I-LSQAVLSQA-----------ISELK----------------------
F9HC66      YLVKDYKEI--I-LSQDVLEKV-----------ISNLK----------------------
E1LQJ6      YLVKDYKEI--I-LSQDVLEKV-----------ISNLK----------------------
Q4JYU0      YLVKDYKEI--I-LSQDVLEKV-----------ISNLK----------------------
Q4JZY2      YLVKDYKEI--I-ISQDVLEEV-----------ISNLK----------------------
F9Q346      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
Q6L5R1      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
E9FEC6      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
E0Q2S9      YLVKDYREI--I-LSQGVLEKV-----------ATDLK----------------------
F5VSH0      YLVKDYREI--I-LSQGVLEKV-----------ATDLK----------------------
A5YTV6      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
Q6L5T1      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
E0PPH8      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
A5YTT8      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
E6KKR9      YLVKDYREI--I-LSQDVLEKV-----------TTDLK----------------------
A1ILY0      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
F2QF91      YLVKDYREI--I-LSQDVLEKV-----------ATDLK----------------------
Q4K0I3      YLVKDYHEI--I-LSQDVLEKV-----------ATNLK----------------------
Q8KWQ1      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
Q4K238      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
B1I966      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
G6J8A3      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
F9LZC3      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
F9P1W9      YLVKDYREI--I-LSQDVLEKV-----------ATNLK----------------------
A5LJR9      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q9ZII7      YLVKDYREI--I-LSQDALEKV-----------ATNLK----------------------
Q4K1K7      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
E1LPE6      YLVKDYREI--I-LSQDVLEKV-----------VSDLK----------------------
F9MJW6      YLVKDYREI--I-LSQDVLEKV-----------VSDLK----------------------
Q4K0V3      SLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q54519      SLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
C1CBD0      YLTKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q7WVX1      YLTKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q4K0E2      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q9AH96      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
A5M4L2      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
B2ILP4      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
C1CCB8      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
P72511      YLVKDYREI--I-LSQYVLEEV-----------VSDLK----------------------
Q4K1S8      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
P96474      YLVKDYREI--V-LSQDVLEEV-----------ISDLK----------------------
Q4K196      YLVKDYREI--I-LSQDVLEEV-----------VSGLK----------------------
Q4K0Z7      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4JZ85      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4JYH6      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4JZ19      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4K0A1      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4K1M5      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4K2Q8      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q4K1G0      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q4K0T6      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
Q4K0K3      YLVKDYREI--I-LSQDVLEEV-----------VSDLK----------------------
Q4K0X6      YLVKDYREI--I-LSQDVLEEV-----------ISDLK----------------------
E8KDN1      YLVKDYREI--I-LSQDVLEKV-----------VTEQN----------------------
F9PEU3      YLVKDYREI--I-LSQDVLEKV-----------VADQS----------------------
E8K321      YLVKDYREI--I-LSQDVLEKV-----------VADQS----------------------
F9PZP6      YLVKDYREI--I-LSQDVLEKV-----------VADQK----------------------
D6R2T7      YLVKDFKEI--I-LSQAVLSQA-----------ISDLQ----------------------
F3UUQ1      YLVKDFKEI--I-LSQAVLSQA-----------ISDLQ----------------------
E6IZC3      YLVKDYKEI--I-LSQDVLAKV-----------ISDLK----------------------
G6A746      YLVKDYKEI--I-LSQDVLAKV-----------ISDLK----------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
E9TE87      ------------------------LDIAV----------SKNTFPIFGAGWDRLMGRQNE
E6PYQ4      ------------------------LSQNPIFNPSLQQDLDNPA-----------------
C0QCJ1      ------------------------LFEEE---------GAKDM-----------------
I5B297      ------------------------LYEN-----------SSGM-----------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------LKSKE----------TGEL-----------------
C7LPS4      ------------------------KDVEF----------ASDM-----------------
Q314L4      ------------------------MDLGL----------SGP------------------
G0VNK5      ---------------------------ER----------NDDG-----------------
D2RIR1      ---------------------------E-----------EKDG-----------------
I0GRR3      ---------------------------EP----------NKDG-----------------
Q39U16      ------------------------ADTKV----------KNDK-----------------
F0JCB9      ------------------------LDVDL----------KNEI-----------------
G7QCG0      ------------------------KDITL----------KTAY-----------------
I2Q342      ------------------------RDITL----------KTAY-----------------
Q74BQ7      ------------------------LDVTT----------KSNA-----------------
B5EA80      ------------------------LNLGK----------SDS------------------
C6DZX6      ------------------------LDLGK----------NDS------------------
A1ARV9      ------------------------MNVTR----------KGGA-----------------
E8WSZ4      ------------------------MNLGK----------DGN------------------
A5G425      ------------------------LNVNK----------QNDA-----------------
B9M2X7      ------------------------LNLGK----------NGDT-----------------
C2MBF7      ------------------------LDVQYHY--------NAGL-----------------
H8YYB8      ------------------------LVSAVEQ--------MRED-----------------
B7B948      ------------------------LYTQSP-------------------VQLSFPDAEEA
G8AU95      ------------------------LLNDPE------------------------------
G5IFS2      ------------------------L-----------------------------------
F0G6H6      ------------------------LYIEARPRYVPLIGWRLVNGADGLSSPLPGGYVYGT
A3W0H6      ------------------------LFANAR------------------------------
A3K8W6      ------------------------LFAEDP------------------------------
Q0FMP1      ------------------------LFDGDT------------------------------
S9QRP2      ------------------------LFTDAP------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------LD----------------------------------
E3H7M4      ------------------------LK----------------------------------
F8KGP2      DGT-----RKLIKE---AQPAVVE-RGGK-------------------------------
B3XL22      DGT-----RRLIKE---AQPAVVE-RGGK-------------------------------
F8DRU3      DGT-----RKLIKE---AQPAVVE-RGGK-------------------------------
C2EWM2      NGR-----RVLVRS---AKPAVVERTNGK-------------------------------
D0DSJ3      ------------------------SGSQR-------------------------------
B2GF32      ------------------------SGSQR-------------------------------
C0WW25      ------------------------SGSQR-------------------------------
F0K0J8      ------------KKAVKAKPAVYK-RESK-------------------------------
G6F8H0      DGT-----RTLVKKAVKAKPAVYK-RESK-------------------------------
F0HVF2      DGT-----RTLVKKAVNAKPAVYK-RESK-------------------------------
Q1G8E3      ------------KKAVKAKPAVYK-RESK-------------------------------
D6S4X3      DGT-----KKLVKK---AQPAVLE-RSGK-------------------------------
Q5FIC6      NGR-----RRLVRK---AQPAVIE-RSGK-------------------------------
E4SMV6      NGR-----RRLVRK---ARPAVIE-RSGK-------------------------------
F0TGY3      NGR-----RRLVRK---ARPAVIE-RSGK-------------------------------
F2M2M7      NGR-----RRLVRK---ARPAVIE-RSGK-------------------------------
A4ZGZ7      DGR-----KVLVRK---AQPAVIE-RDGK-------------------------------
C2EPK4      NGR-----RRLVRR---AQPAVIE-RSGK-------------------------------
C7XKF2      EGR-----RVLVRK---AQPEVVE-RSGK-------------------------------
E3R265      EGR-----RVLVRK---AQPEVVE-RSGK-------------------------------
D0DJG9      EGR-----RVLVRK---AQPEVVE-RSGK-------------------------------
D5GZJ9      EGR-----RVLVRK---AQPEVVE-RSGK-------------------------------
A8YX90      DGR-----RVLVRK---AQPAVIE-RDGK-------------------------------
F0NWJ8      DGR-----RVLVRK---AQPAVIE-RDGK-------------------------------
C2JZS0      NSITGVQEKYLVKK---EQPAKYKLEPAK-------------------------------
C1J9I2      NAATGTRERYVTEE---AQPAKYKLKPAK-------------------------------
Q58Z11      NAATGVRERYVVKE---EQPAKYKLKPAK-------------------------------
B1MZT2      DGT-----RRLVSP---EQKEITKTSSQQ-------------------------------
C2KHF2      DGT-----RRLVTP---AQKEITKPSNKK-------------------------------
Q03W94      DGT-----QRLVTP---AKKRITKPSTKT-------------------------------
C6CW36      ------------------------LS----------------------------------
A8SQS9      ------------------------LN----------------------------------
D5HFS3      ------------------------LD----------------------------------
B9Y883      ------------------------ED----------------------------------
A5Z5P8      --------------------DLGY------------------------------------
G2KUP2      --------------------EPGMTKK---------------------------------
G8PE07      --------------------QAGYPGE---------------------------------
E0NHP5      --------------------LPGYKSG---------------------------------
Q03GL9      --------------------QPGYEKG---------------------------------
C6CSC7      --------------------QLGL------------------------------------
C6CS79      --------------------ELGL------------------------------------
F5LM70      --------------------EYGV------------------------------------
G0LYN8      --------------------RYGIER----------------------------------
F6ITB3      --------------------RFGIER----------------------------------
G0M1Y0      --------------------RFGIER----------------------------------
D7VC12      --------------------RYGIER----------------------------------
F9UMZ5      --------------------RYGIER----------------------------------
D4JI68      --------------------NLNLNE----------------------------------
D6E329      --------------------NLNLNE----------------------------------
Q1AUN7      --------------------KLGLSE----------------------------------
H4GK02      --------------------PETSHANGK-------------------------------
F6IR92      --------------------EHGLRR----------------------------------
G0M0G0      --------------------EHGLRR----------------------------------
D7VBW5      --------------------ETDIRR----------------------------------
F9UQ55      --------------------ETDIRR----------------------------------
D4YHG8      ------------------------AEG---------------------------------
F7V793      ------------------------LK----------------------------------
C3WFM8      ------------------------LK----------------------------------
H7F1R6      ------------------------DK----------------------------------
H7F570      ------------------------HK----------------------------------
C6LCS6      ------------------------LEN---------------------------------
A7VF43      ------------------------LS----------------------------------
A7Z922      ------------------------LS----------------------------------
I2CAF3      ------------------------LS----------------------------------
I2HVL3      ------------------------LS----------------------------------
E0U2Z4      ------------------------LS----------------------------------
D4G1R3      ------------------------LS----------------------------------
G4EQZ6      ------------------------LS----------------------------------
P71050      ------------------------LS----------------------------------
G4P115      ------------------------LS----------------------------------
A8FHM0      ------------------------LT----------------------------------
C0EBA5      ------------------------LD----------------------------------
B7BDT7      --LDVNYHTDGGFYKKVLYGRDCPYT----------------------------------
H6LKR9      ---------LNINDNESKNGITGKSS----------------------------------
F5LE49      ------------------------EG----------------------------------
F3AHH1      ------------------------LD----------------------------------
F3Y921      --------------------ATANIQ----------------------------------
G4L593      --------------------SDYGLD----------------------------------
E6LD65      --------------------TQYKIA----------------------------------
C9ALZ8      --------------------TEDNVK----------------------------------
C9BUG6      --------------------TEDNVK----------------------------------
Q3XYS7      --------------------TEDNVK----------------------------------
C9B453      --------------------TEDNVK----------------------------------
D4RJF5      --------------------TEDNVK----------------------------------
C8ZXT8      --------------------SESNVK----------------------------------
F0EKB8      --------------------SENNLD----------------------------------
C9A6V4      --------------------SENNLD----------------------------------
C9CHY7      --------------------SENNLD----------------------------------
E6UHY5      ------------------------KD----------------------------------
E9SAU2      ------------------------ED----------------------------------
F7K0U2      ------------------------LD----------------------------------
O06029      ------------------------LS----------------------------------
G8P3D6      ------------------------LS----------------------------------
A9QSJ3      ------------------------LS----------------------------------
F9VC43      ------------------------LS----------------------------------
G6FD41      ------------------------LS----------------------------------
G9M881      ------------------------LS----------------------------------
Q3ZK51      ------------------------LS----------------------------------
Q83VG0      ------------------------LS----------------------------------
C6LDI9      ------------------------LD----------------------------------
G5F9H3      ------------------------LD----------------------------------
C0CZV8      ------------------------LN----------------------------------
G5GFW1      ------------------------LK----------------------------------
H1LCW2      VSANGHRHLIKASRPAVVKSTGTPYD----------------------------------
I5AV00      ------------------------MKNTV-------------------------------
H6NE44      ------------------------FM----------------------------------
F4BS20      ------------------------NT----------------------------------
E0RZL4      ------------------------TD----------------------------------
C0CK72      ------------------------LD----------------------------------
D9S1J8      ------------------------LN----------------------------------
C2EFR7      ------------------------LR----------------------------------
Q1WTC7      ------------------------LR----------------------------------
B0P2G1      ------------------------LD----------------------------------
D4MW28      ------------------------LD----------------------------------
E5VMX9      ------------------------LD----------------------------------
F2I6Z8      ------------------------RD----------------------------------
E6U7N3      ------------------------LK----------------------------------
C4Z8M6      ------------------------LN----------------------------------
D4JMC3      ------------------------MD----------------------------------
D6E0V3      ------------------------MD----------------------------------
E3GPC7      ------------------------LD----------------------------------
A6BIG6      ------------------------LD----------------------------------
C2CI43      ------------------------LD----------------------------------
D4RX68      ------------------------LK----------------------------------
D4J4T5      ------------------------LT----------------------------------
I5ASF9      ------------------------LD----------------------------------
C0C0F9      ------------------------LD----------------------------------
B6W7H3      ------------------------LD----------------------------------
C7RGH5      ------------------------LD----------------------------------
F0GT82      ------------------------LN----------------------------------
F3AH93      ------------------------LK----------------------------------
B0GAL4      ------------------------LD----------------------------------
G1WUK1      ------------------------LD----------------------------------
D4M2S1      ------------------------LD----------------------------------
E7GL80      ------------------------LD----------------------------------
G5F9E3      ------------------------LD----------------------------------
D4CG07      ------------------------LE----------------------------------
D4MP31      ------------------------LE----------------------------------
G5HNC6      ------------------------LD----------------------------------
A8RK86      ------------------------LN----------------------------------
G5HTB1      ------------------------LN----------------------------------
A8RSL0      ------------------------LS----------------------------------
C5EN02      ------------------------LN----------------------------------
G5HG46      ------------------------LG----------------------------------
E7GL39      ------------------------LD----------------------------------
E7GL56      ------------------------LD----------------------------------
G5F9B0      ------------------------LD----------------------------------
D3AC81      ------------------------LN----------------------------------
D3AE79      ------------------------LN----------------------------------
D4YF14      ------------------------GK----------------------------------
B1YMM6      ------------------------AP----------------------------------
D4LG05      ------------------------LD----------------------------------
D4LTH3      ------------------------LD----------------------------------
F3ATF6      ------------------------LN----------------------------------
E0I7B6      ------------------------LG----------------------------------
C9LAS2      ------------------------LE----------------------------------
F7K8E8      ------------------------LD----------------------------------
F7K9V0      ------------------------LD----------------------------------
F7KL97      ------------------------LD----------------------------------
D3FZP5      ------------------------LN----------------------------------
C0ZHV9      ------------------------AG----------------------------------
D7WMM9      ------------------------LD----------------------------------
A8U9F5      ------------------------TN----------------------------------
F4BSE0      ------------------------TK----------------------------------
E7RDR2      ------------------------LD----------------------------------
I0JRK5      ------------------------LD----------------------------------
G2TR26      ------------------------LN----------------------------------
D5DBK2      ------------------------LD----------------------------------
D5DY80      ------------------------LD----------------------------------
A7Z9K1      ------------------------LS----------------------------------
I2CB17      ------------------------LS----------------------------------
I2HW54      ------------------------LS----------------------------------
G4P1M8      ------------------------LS----------------------------------
E0TTZ7      ------------------------LS----------------------------------
G4EQF2      ------------------------LS----------------------------------
P96715      ------------------------LS----------------------------------
I0F9R7      ------------------------LS----------------------------------
G9QKR5      ------------------------LD----------------------------------
B5UQ74      ------------------------LN----------------------------------
B7HFH2      ------------------------LN----------------------------------
Q72XH7      ------------------------LN----------------------------------
C2V4M3      ------------------------LN----------------------------------
C2YZB3      ------------------------LN----------------------------------
C2P8H2      ------------------------LN----------------------------------
C2Y451      ------------------------LN----------------------------------
C3EBC1      ------------------------LN----------------------------------
C3H980      ------------------------LN----------------------------------
C2PN23      ------------------------LK----------------------------------
B9IRQ7      ------------------------LN----------------------------------
A0RL71      ------------------------LN----------------------------------
C2XJI0      ------------------------LN----------------------------------
Q3EV65      ------------------------LN----------------------------------
C2T8T7      ------------------------LN----------------------------------
C2RG50      ------------------------LN----------------------------------
Q814Y9      ------------------------LN----------------------------------
B3ZRD5      ------------------------LN----------------------------------
Q6HB08      ------------------------LN----------------------------------
C2NQN7      ------------------------LN----------------------------------
C3GRR1      ------------------------LN----------------------------------
C2ULR7      ------------------------LN----------------------------------
C3GBJ9      ------------------------LN----------------------------------
C2WVG7      ------------------------LN----------------------------------
B7IQS9      ------------------------LN----------------------------------
A9VRC4      ------------------------LN----------------------------------
C2MTG4      ------------------------LN----------------------------------
B7HXB5      ------------------------LN----------------------------------
C2SBU5      ------------------------LN----------------------------------
C2SSX9      ------------------------LN----------------------------------
G9QCG2      ------------------------LN----------------------------------
Q2BFS6      ------------------------LD----------------------------------
I3EBB4      ------------------------LD----------------------------------
A4ITF4      ------------------------LD----------------------------------
C5D962      ------------------------LD----------------------------------
G8MZ94      ------------------------LD----------------------------------
Q5KUM4      ------------------------LD----------------------------------
G5SDT9      ------------------------LD----------------------------------
G5LQM7      ------------------------LD----------------------------------
G5Q4J1      ------------------------LD----------------------------------
B1V0N8      ------------------------ID----------------------------------
B1BNK2      ------------------------ID----------------------------------
B1R3X7      ------------------------ID----------------------------------
Q8XN77      ------------------------ID----------------------------------
B1HR40      ------------------------LE----------------------------------
G2Z8Q4      ------------------------LP----------------------------------
F8FCE3      -----------------------EFM----------------------------------
I0BSG5      -----------------------EFM----------------------------------
A8YPQ6      ------------------------DK----------------------------------
P95695      ------------------------DK----------------------------------
Q2G1K8      ------------------------DK----------------------------------
C5QNG5      ------------------------KD----------------------------------
Q4L9H8      ------------------------NK----------------------------------
Q2FUV1      ------------------------GQ----------------------------------
P39850      ------------------------DK----------------------------------
D7UYE3      ------------------------RE----------------------------------
Q4A121      ------------------------GK----------------------------------
E3HB17      ------------------------LE----------------------------------
C9AAE4      ------------------------GS----------------------------------
H7F6C7      ------------------------KQ----------------------------------
F0SX23      ---------------------LPPSN----------------------------------
Q38VG4      ---------------------GKTNK----------------------------------
F2I4B6      ------------------------LQ----------------------------------
Q8RBS6      ------------------------LP----------------------------------
D9SR42      ------------------------LN----------------------------------
D9SVC8      ------------------------LN----------------------------------
E7RG09      ------------------------LE----------------------------------
D4G2E2      ------------------------LS----------------------------------
Q8EME7      ------------------------LD----------------------------------
D6Y035      ------------------------LE----------------------------------
Q5WBB3      ------------------------LD----------------------------------
Q9K6Q9      ------------------------LE----------------------------------
Q97EP7      ------------------------NG----------------------------------
Q97ER4      ------------------------DG----------------------------------
E4S7Y7      ------------------------LK----------------------------------
E4Q5T6      ------------------------LK----------------------------------
E4SDX3      ------------------------LN----------------------------------
G2FWX3      ------------------------LP----------------------------------
G7WJV2      ------------------------LE----------------------------------
G7W774      ------------------------LS----------------------------------
G2FM60      ------------------------LP----------------------------------
H5XZD5      ------------------------LE----------------------------------
I4DBG9      ------------------------LP----------------------------------
G2FWT7      ------------------------LA----------------------------------
H5XZG8      ------------------------LP----------------------------------
G0V448      ------------------------KQ----------------------------------
A0PZ01      ------------------------LD----------------------------------
B1B737      ------------------------LD----------------------------------
D9ST43      -------------------------D----------------------------------
H7F5T7      ------------------------GE----------------------------------
G9WIR0      ------------------------GR----------------------------------
D3LB11      ------------------------ST----------------------------------
A0NKF7      ------------------------ST----------------------------------
Q04DV7      ------------------------ST----------------------------------
F6BI63      ------------------------LN----------------------------------
G2MWC1      ------------------------LP----------------------------------
B0K4N2      ------------------------LP----------------------------------
C7ISF8      ------------------------LP----------------------------------
B0KAR6      ------------------------LP----------------------------------
E8UV30      ------------------------LP----------------------------------
C0GGR6      ------------------------LD----------------------------------
A4J8V1      ------------------------IN----------------------------------
C8VYQ7      ------------------------LD----------------------------------
C8W5K3      ------------------------LD----------------------------------
B1BNH4      ------------------------LD----------------------------------
B1V1Z3      ------------------------LD----------------------------------
B1R3V2      ------------------------LD----------------------------------
Q0SVR9      ------------------------LD----------------------------------
Q8XN47      ------------------------LD----------------------------------
G7M0Q2      ------------------------LD----------------------------------
G7M565      ------------------------LN----------------------------------
A6M2M0      ------------------------IN----------------------------------
G7M1R8      ------------------------AD----------------------------------
A5V0I4      ------------------------LD----------------------------------
A7NQ70      ------------------------LD----------------------------------
Q4JZ56      ------------------------LE----------------------------------
Q7X554      ------------------------LN----------------------------------
Q7X550      ------------------------LN----------------------------------
Q7X562      ------------------------LN----------------------------------
Q7X556      ------------------------LN----------------------------------
Q7X552      ------------------------LN----------------------------------
Q7X558      ------------------------LN----------------------------------
C5NWJ9      ------------------------TE----------------------------------
F3A498      ------------------------LG----------------------------------
Q9AHD3      ------------------------LD----------------------------------
Q4K2E2      ------------------------LD----------------------------------
Q4K2F8      ------------------------LD----------------------------------
Q4K046      ------------------------LD----------------------------------
Q4K0R8      ------------------------LD----------------------------------
Q4JYY0      ------------------------LD----------------------------------
Q4JZW8      ------------------------LD----------------------------------
I0J9C8      ------------------------LD----------------------------------
Q4K0M4      ------------------------LD----------------------------------
Q4JZS4      ------------------------LD----------------------------------
Q4JZK2      ------------------------LD----------------------------------
Q9AHA5      ------------------------LD----------------------------------
Q9X9A0      ------------------------LD----------------------------------
Q4JYK9      ------------------------LD----------------------------------
Q4K006      ------------------------LD----------------------------------
Q4JZG8      ------------------------LD----------------------------------
A6YIA7      ------------------------LD----------------------------------
E5F5C4      ------------------------LD----------------------------------
Q9AHB8      ------------------------LD----------------------------------
Q4JZL8      ------------------------LD----------------------------------
Q4K1B8      ------------------------LD----------------------------------
Q8VU32      ------------------------LD----------------------------------
D2ERX9      ------------------------LD----------------------------------
G6C7Z0      ------------------------LD----------------------------------
Q4K2A9      ------------------------LD----------------------------------
D6ZQI7      ------------------------LD----------------------------------
Q9ZFT9      ------------------------LD----------------------------------
Q4K255      ------------------------LD----------------------------------
F9HJP7      ------------------------LS----------------------------------
E8JWI4      ------------------------LS----------------------------------
A8AZR4      ------------------------LP----------------------------------
D0RXH3      ------------------------LP----------------------------------
Q83YR6      ------------------------LP----------------------------------
F1Z125      ------------------------VS----------------------------------
Q3K0S9      ------------------------LN----------------------------------
P0C0T8      ------------------------LN----------------------------------
Q67AY5      ------------------------LN----------------------------------
Q04662      ------------------------LN----------------------------------
Q8GP93      ------------------------LN----------------------------------
Q8GPF7      ------------------------LN----------------------------------
E3CP61      ------------------------LK----------------------------------
E8KUY7      ------------------------LK----------------------------------
C2LSE5      ------------------------LN----------------------------------
E9DM16      ------------------------LN----------------------------------
I0QIK5      ------------------------LN----------------------------------
Q7X560      ------------------------LN----------------------------------
Q8GMA6      ------------------------LN----------------------------------
Q55204      ------------------------LN----------------------------------
Q8GPC4      ------------------------LN----------------------------------
Q8GPA9      ------------------------LN----------------------------------
G6ERT2      ------------------------LN----------------------------------
O87930      ------------------------LN----------------------------------
Q8GP55      ------------------------LN----------------------------------
F8HDC4      ------------------------LN----------------------------------
F8LJ76      ------------------------LN----------------------------------
F8LXJ5      ------------------------LN----------------------------------
Q1WCR2      ------------------------LN----------------------------------
G3G7C0      ------------------------LN----------------------------------
G3G7J8      ------------------------LN----------------------------------
G8DU30      ------------------------LK----------------------------------
A4VTU2      ------------------------LK----------------------------------
D5AGQ4      ------------------------LK----------------------------------
Q9X4U6      ------------------------LK----------------------------------
G3G7G5      ------------------------LK----------------------------------
G7SG35      ------------------------LN----------------------------------
G8DU06      ------------------------LN----------------------------------
G8DUA9      ------------------------LN----------------------------------
G8DTY9      ------------------------LN----------------------------------
G3G7I7      ------------------------LK----------------------------------
G3G7J3      ------------------------LT----------------------------------
E0PD82      ------------------------LA----------------------------------
F5X651      ------------------------LP----------------------------------
G5JTD6      ------------------------LD----------------------------------
Q2KM75      ------------------------VS----------------------------------
G5KAJ3      ------------------------LS----------------------------------
B9DUJ5      ------------------------LS----------------------------------
G5KD12      ------------------------VT----------------------------------
E8JMT8      ------------------------LS----------------------------------
F5X0J8      ------------------------LS----------------------------------
H2A601      ------------------------LS----------------------------------
E7S8W2      ------------------------LE----------------------------------
F8DFF5      ------------------------LN----------------------------------
I1ZPH8      ------------------------LD----------------------------------
E3CBR9      ------------------------LD----------------------------------
E8K787      ------------------------LD----------------------------------
F9M365      ------------------------LD----------------------------------
A3CQY3      ------------------------LQ----------------------------------
E8KLZ0      ------------------------LQ----------------------------------
F0FHA9      ------------------------LQ----------------------------------
F0FQQ4      ------------------------LQ----------------------------------
F0I4H6      ------------------------LQ----------------------------------
F0IAY2      ------------------------LQ----------------------------------
F0IJI1      ------------------------LQ----------------------------------
F0IS52      ------------------------LQ----------------------------------
F2C9N1      ------------------------LQ----------------------------------
F2CH54      ------------------------LQ----------------------------------
F3UDW8      ------------------------LQ----------------------------------
F3UNJ5      ------------------------LQ----------------------------------
F3SM33      ------------------------LQ----------------------------------
F9HC66      ------------------------LE----------------------------------
E1LQJ6      ------------------------LE----------------------------------
Q4JYU0      ------------------------LE----------------------------------
Q4JZY2      ------------------------LE----------------------------------
F9Q346      ------------------------LD----------------------------------
Q6L5R1      ------------------------LD----------------------------------
E9FEC6      ------------------------LD----------------------------------
E0Q2S9      ------------------------LD----------------------------------
F5VSH0      ------------------------LD----------------------------------
A5YTV6      ------------------------LD----------------------------------
Q6L5T1      ------------------------LE----------------------------------
E0PPH8      ------------------------LE----------------------------------
A5YTT8      ------------------------LE----------------------------------
E6KKR9      ------------------------LE----------------------------------
A1ILY0      ------------------------LE----------------------------------
F2QF91      ------------------------LE----------------------------------
Q4K0I3      ------------------------LD----------------------------------
Q8KWQ1      ------------------------LD----------------------------------
Q4K238      ------------------------LD----------------------------------
B1I966      ------------------------LD----------------------------------
G6J8A3      ------------------------LD----------------------------------
F9LZC3      ------------------------LD----------------------------------
F9P1W9      ------------------------LD----------------------------------
A5LJR9      ------------------------LD----------------------------------
Q9ZII7      ------------------------LD----------------------------------
Q4K1K7      ------------------------LD----------------------------------
E1LPE6      ------------------------LD----------------------------------
F9MJW6      ------------------------LD----------------------------------
Q4K0V3      ------------------------LD----------------------------------
Q54519      ------------------------LD----------------------------------
C1CBD0      ------------------------LD----------------------------------
Q7WVX1      ------------------------LD----------------------------------
Q4K0E2      ------------------------LD----------------------------------
Q9AH96      ------------------------LD----------------------------------
A5M4L2      ------------------------LD----------------------------------
B2ILP4      ------------------------LD----------------------------------
C1CCB8      ------------------------LD----------------------------------
P72511      ------------------------LD----------------------------------
Q4K1S8      ------------------------LD----------------------------------
P96474      ------------------------LD----------------------------------
Q4K196      ------------------------LD----------------------------------
Q4K0Z7      ------------------------LD----------------------------------
Q4JZ85      ------------------------LD----------------------------------
Q4JYH6      ------------------------LD----------------------------------
Q4JZ19      ------------------------LD----------------------------------
Q4K0A1      ------------------------LD----------------------------------
Q4K1M5      ------------------------LD----------------------------------
Q4K2Q8      ------------------------LD----------------------------------
Q4K1G0      ------------------------LD----------------------------------
Q4K0T6      ------------------------LD----------------------------------
Q4K0K3      ------------------------LD----------------------------------
Q4K0X6      ------------------------LD----------------------------------
E8KDN1      ------------------------LK----------------------------------
F9PEU3      ------------------------LA----------------------------------
E8K321      ------------------------LT----------------------------------
F9PZP6      ------------------------LT----------------------------------
D6R2T7      ------------------------LK----------------------------------
F3UUQ1      ------------------------LK----------------------------------
E6IZC3      ------------------------LN----------------------------------
G6A746      ------------------------LN----------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
E9TE87      TVKVTTFNRPKEMADQVFTLNVLDNKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHA
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      Q-----------------------------------------------------------
G8AU95      F-----------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      E-----------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      --------------------------------------------------------QT--
G9RSY8      --------------------------------------------------------ED--
F3CAY8      --------------------------------------------------------KI--
I0UTA4      --------------KLTDKL---------------------MNSTKVVPTSQT---AV--
E9TE87      RPGSEFTVTKYSTLGMINQL---------------------QNSLTVTENGKDA--GV--
E6PYQ4      -----------SRDRLVNVF---------------------LGSLKIARVPQT---EL--
C0QCJ1      -----------YLEDKIEAM---------------------RKRIKVTLSSARSGADA--
I5B297      -----------YQEEKIEAL---------------------RKRIKVKIEHSRGGSEA--
B8D0N1      -----------ENKVSVKYL---------------------ITNLNIEIIPDT---RL--
D9QTC7      -----------ISPQALRN----------------------KISISGGQEGSG---NL--
C7LPS4      -----------DREAYIKDL---------------------RERISIRLDEKR---GI--
Q314L4      -----------ALEERITSV---------------------RRKVSVGLDEKR---GL--
G0VNK5      -----------ELPDYESYV---------------------KKHIVTKPYKDT---EI--
D2RIR1      -----------KYPRYEDYV---------------------KSHIVTKPYKDT---EI--
I0GRR3      -----------KLPSYEGYI---------------------KSHVTTKPFKDT---EI--
Q39U16      -----------EMEGLVEDF---------------------QKRTQISIKGN----DL--
F0JCB9      -----------SLDSTIKSL---------------------RGRIKIGLDEKR---GV--
G7QCG0      -----------DQEVYIKDL---------------------QRRIMVNLNERQ---GL--
I2Q342      -----------DQEVYIKDL---------------------QRRIMVNLNERQ---GL--
Q74BQ7      -----------EIEARVRAI---------------------QQNITIKLKGD----NI--
B5EA80      -----------ETEELIKQL---------------------QLSTKVKVKDK----NL--
C6DZX6      -----------ETEELIKQL---------------------QLNTKVKVKDK----NL--
A1ARV9      -----------DMEALYLTL---------------------QKNTVVKVKDK----NL--
E8WSZ4      -------------EELIRDL---------------------QKNLTVKVKEKN---NL--
A5G425      -----------QLEELVAKF---------------------QKNTVIKLKNDE---NF--
B9M2X7      -------------DTLISQF---------------------QKDTKVELRDKE---NL--
C2MBF7      -----------REKDLYKQS---------------------PVSIRFVNADPDE---K--
H8YYB8      -----------IELEMISAD---------------------VIDPR--SGRPSEATIA--
B7B948      -----------AFSLQAVPV---------------------SGKEVMLSGFTLGDQEV--
G8AU95      -----------NPSLKAPDG---------------------TDDHWLKRVTKAGVGALPP
G5IFS2      ----------------NLDH---------------------EQLLRKLTVANPQDTRI--
F0G6H6      -----------RIDVAAFDV---------------------PKRLYDKSFA----LTVGR
A3W0H6      ----------------DMPM---------------------AEKVHQLRIS----ARI--
A3K8W6      ----------------ALND---------------------GERIYMMRQA----ARI--
Q0FMP1      ----------------GMSV---------------------GQRLFRMREA----VSI--
S9QRP2      ----------------EMTM---------------------NERVYQMRMA----ARI--
F4SM98      ------------------------------------------------------------
C4Z673      --------------ETYESL---------------------VKRVSASNATDT---RI--
E3H7M4      --------------NSPESL---------------------ARKVEVAPVGMT---EL--
F8KGP2      -----------SYNLSTAEL---------------------KKAISVKTQQNS---QV--
B3XL22      -----------SYSLSTDEL---------------------KKAISVSTQQNS---QV--
F8DRU3      -----------SYNLSTAEL---------------------KEAISVQTQQNS---QV--
C2EWM2      -----------SYHVTTAQL---------------------KKAISVQTQQNS---QV--
D0DSJ3      -----------AYALSVAKL---------------------KGSLKVSTQTNS---QV--
B2GF32      -----------AYTLSVAKL---------------------KGLLTVSTQNNS---QV--
C0WW25      -----------AYALSVAKL---------------------KGLLTVSTQNNS---QV--
F0K0J8      -----------SYSVSASEL---------------------ASAVSVTTTDSS---QV--
G6F8H0      -----------SYSVSANEL---------------------ASAVSVTTTTSS---QV--
F0HVF2      -----------SYSISPSEL---------------------ASAVSVTTTTSS---QV--
Q1G8E3      -----------SYSVSASEL---------------------ASAVSVTTTDSS---QV--
D6S4X3      -----------SYTISATEL---------------------SKAISVSTQQQS---QV--
Q5FIC6      -----------SYSVSASEL---------------------AKSISVGTQQQS---QV--
E4SMV6      -----------SYSVSAKEL---------------------AKSISVGTQQQS---QV--
F0TGY3      -----------SYSVSAKEL---------------------AKSISVGTQQQS---QV--
F2M2M7      -----------SYSVSAKEL---------------------AKSISVDTQQQS---QV--
A4ZGZ7      -----------SYSVSASQL---------------------AKNISVNTQQQS---QV--
C2EPK4      -----------SYVVSAKQL---------------------AKNISVNTQQQS---QV--
C7XKF2      -----------SYSVSTSEL---------------------AKSVSVNTQQQS---QV--
E3R265      -----------SYSVSTSEL---------------------AKSVSVNTQQQS---QV--
D0DJG9      -----------SYSVSTSEL---------------------AKSVSVNTQQQS---QV--
D5GZJ9      -----------SYSVSTSEL---------------------AKSVSVNTQQQS---QV--
A8YX90      -----------SYSVSASQL---------------------AKDISVNTQQQS---QI--
F0NWJ8      -----------SYSVSASQL---------------------AKNISVNTQQQS---QV--
C2JZS0      -----------YDNLTESDI---------------------ASKVTVSSSQNS---QV--
C1J9I2      -----------YSNISEEDL---------------------TKMVSVSTQQNS---QV--
Q58Z11      -----------YANISEDDL---------------------DKMISVSNAQNS---QV--
B1MZT2      -----------TYDFTVDQL---------------------KKMVSISNQQNS---QV--
C2KHF2      -----------KYYLSVDEL---------------------KSMVTISSQQNS---QV--
Q03W94      -----------KYNLSVEEL---------------------KSMISISNQTNS---QV--
C6CW36      --------------DSSYEM---------------------SKILQVYSYENS---QV--
A8SQS9      --------------MDSEQL---------------------AKMISLVNPTDT---RV--
D5HFS3      --------------MDSEGL---------------------AKMITLENPSDT---RV--
B9Y883      --------------LDTEGY---------------------QKIVKISSVKDT---EV--
A5Z5P8      ---------------TYEQL---------------------NGMIDISTVEDT---RI--
G2KUP2      ------------------------------------------TNISVFSQQNS---QV--
G8PE07      -----------------NGM---------------------KKAISISSQQNS---QV--
E0NHP5      ----------------VDNL---------------------KSSISISSQQNS---QV--
Q03GL9      ---------------DVDSL---------------------KGSLSVNSQQNS---QV--
C6CSC7      ---------------SAKEL---------------------TKKISVSSVNGT---QV--
C6CS79      ---------------TTQQL---------------------MHNIRFSSVNGT---QV--
F5LM70      ---------------TSDDL---------------------MRRIQFSSVSDT---QI--
G0LYN8      ---------------SLSTL---------------------KSEVSVTSTANS---QV--
F6ITB3      ---------------SLNTL---------------------KSEVSVTSTTNS---QV--
G0M1Y0      ---------------SLNTL---------------------KSEVSVTSTTNS---QV--
D7VC12      ---------------SLNSL---------------------KSEVSVTSTTNS---QV--
F9UMZ5      ---------------SLNTL---------------------KSEVSVTSTTNS---QV--
D4JI68      ---------------SYKTL---------------------GGRVTLDNPSNS---RV--
D6E329      ---------------SYKTL---------------------GGRVTLDNPSNS---RV--
Q1AUN7      -------------EYAQKTL---------------------LGNLRVEQRPGT---MF--
H4GK02      -----------AYDLSVAEL---------------------KDALSVSTQTNS---QV--
F6IR92      ---------------SVNTL---------------------KQAVSVTSTANS---QV--
G0M0G0      ---------------SVNTL---------------------KQAVSVTSTANS---QV--
D7VBW5      ---------------SLESL---------------------KQTVSVTSTANS---QV--
F9UQ55      ---------------SLESL---------------------KQTVSVTSTANS---QV--
D4YHG8      --------------MTAAEL---------------------AENVTVSMDSDS---LL--
F7V793      --------------YDYKQL---------------------QGMIDITNVSDT---RV--
C3WFM8      --------------ETTEQL---------------------AKLVTITPVDST---EL--
H7F1R6      --------------YSIKEL---------------------SNMINVSNASDS---QV--
H7F570      --------------YSVKEL---------------------SEMVDVSSTSDS---QV--
C6LCS6      --------------ISYEEL---------------------ADKISVSTATDG---RI--
A7VF43      --------------YDYEQL---------------------ADMITLENPTDT---RV--
A7Z922      --------------ETASAL---------------------KAKITTSSETDS---EI--
I2CAF3      --------------ETASAL---------------------KAKITTSSETDS---EI--
I2HVL3      --------------ETASAL---------------------KAKITTSSETDS---EI--
E0U2Z4      --------------ESASSL---------------------KGKVITSSENES---EM--
D4G1R3      --------------ESASSL---------------------KGKVVTSSENES---EI--
G4EQZ6      --------------ESASSL---------------------KGKVVTSSENES---EI--
P71050      --------------ESASSL---------------------KGKVVTSSENES---EI--
G4P115      --------------ESASSL---------------------KGKVITSSENES---EI--
A8FHM0      --------------ESAEGL---------------------KHKIATSTENES---EV--
C0EBA5      --------------MTVGQV---------------------RSMLSFSAVGET---EI--
B7BDT7      --------------VDFNDLQDNE-----------------SVAFTINPSQNG---QV--
H6LKR9      --------------MTYTDF---------------------QKNTEIEAINNS---RL--
F5LE49      --------------LTSDML---------------------AGMTKVTSIADT---QV--
F3AHH1      --------------LKPEQL---------------------ASKVEIGNTTDT---RI--
F3Y921      --------------LSTEEL---------------------RNSIEITQSQDS---QM--
G4L593      --------------MTIREI---------------------KDSMEVEQSEES---QM--
E6LD65      --------------MEPKEI---------------------KKLISVEQSQNS---QM--
C9ALZ8      --------------MTAGQI---------------------KDAISVNQSQNS---QM--
C9BUG6      --------------MTAEQI---------------------KDAISVNQAENS---QM--
Q3XYS7      --------------MTAGQI---------------------KDAISVNQSENS---QM--
C9B453      --------------MTAGQI---------------------KDAISVNQSENS---QM--
D4RJF5      --------------MTAEQI---------------------KDAISVNQSQNS---QM--
C8ZXT8      --------------MTAGEI---------------------KDAISVNQSQNS---QM--
F0EKB8      --------------LTVGQL---------------------KESISINQSQNS---QM--
C9A6V4      --------------LTVGQL---------------------KESISINQSQNS---QM--
C9CHY7      --------------LTVGQL---------------------KESISINQSQNS---QM--
E6UHY5      --------------YDVDDLKNYFTISVDEKGNEYIPYGQIKRLINISAVNNT---EV--
E9SAU2      --------------YKIEDLRNYFTVATDEKGKEYIPTGQIKRLITIAAVNNT---EV--
F7K0U2      --------------MSVDKL---------------------SGEITVSNTADT---RI--
O06029      --------------DD--SF---------------------QKQVTAANQTNS---QV--
G8P3D6      --------------DD--SF---------------------QKQVTAANQTNS---QV--
A9QSJ3      --------------DD--SF---------------------QKQVTAANQTNS---QV--
F9VC43      --------------DD--AF---------------------QKQVTAANQTNS---QV--
G6FD41      --------------DD--SF---------------------QKQVTAGNQTNS---QV--
G9M881      --------------DD--SF---------------------QKQVTAANQTNS---QV--
Q3ZK51      --------------DD--SF---------------------QKQVTAANQTNS---QV--
Q83VG0      --------------DD--SF---------------------QKQVTAANQTNS---QV--
C6LDI9      --------------MTYENL---------------------EKAIEVTNTTDT---HI--
G5F9H3      --------------MTYREL---------------------EKKLTIDNPNNT---RI--
C0CZV8      --------------TTYKDL---------------------KKKITIDNPADT---RI--
G5GFW1      --------------IDYKEL---------------------KKKLTVDNPNDT---RI--
H1LCW2      --------------VSVKQL---------------------QGAISVTNQQNS---QV--
I5AV00      -----------GGYISPSAI---------------------RGMIRVSVADNT---RV--
H6NE44      --------------LTPEQM---------------------AEMLEVKQSSDS---QV--
F4BS20      --------------MSEVEL---------------------QQKVEVITQDDS---QI--
E0RZL4      --------------MEYKDL---------------------YDVLKVDTPSDT---RI--
C0CK72      --------------MDYKEL---------------------QARIELSNPTDT---RI--
D9S1J8      --------------TTYEKL---------------------KSRIKVNLVKNT---EI--
C2EFR7      --------------YSYGEL---------------------SKKVNAENKDET---QI--
Q1WTC7      --------------YSYGEL---------------------SKKVNAENKDET---QI--
B0P2G1      --------------MDYKEL---------------------EKKITVENPSDT---RI--
D4MW28      --------------MDYKEL---------------------EKKITVENPSDT---RI--
E5VMX9      --------------MDYKEL---------------------ENKITVENPSDT---RI--
F2I6Z8      --------------V--ETL---------------------SENIHLEADQQS---AV--
E6U7N3      --------------TDASAL---------------------AKNISVEGVNQT---QV--
C4Z8M6      --------------ESYKTL---------------------GGRVTLDNPSNS---RV--
D4JMC3      --------------ETYEQL---------------------SKRVSIENPTDT---RV--
D6E0V3      --------------ETYEQL---------------------SKRVSIENPTDT---RV--
E3GPC7      --------------LSDGQL---------------------SKMIDVTTVNDT---EL--
A6BIG6      --------------MEPEDL---------------------EEMITTETPTET---RI--
C2CI43      --------------MDYEEF---------------------SSKVSIEPVKDT---QI--
D4RX68      --------------YSVGEL---------------------KGMVSASIVNNT---RM--
D4J4T5      --------------IDYQQL---------------------LEKVEVTNPTSS---RI--
I5ASF9      --------------MDYKEL---------------------KKYLTITNENDT---RI--
C0C0F9      --------------MEAEEL---------------------EETITAETPVDT---RI--
B6W7H3      --------------MDYGDF---------------------SQKVSIEPVKDT---QI--
C7RGH5      --------------MDYEEF---------------------SSKVSIEPVKDT---QI--
F0GT82      --------------MGYEEF---------------------SKKVSIEPVKDT---QI--
F3AH93      --------------ISPNAL---------------------KGMVSITNPANT---RI--
B0GAL4      --------------MDYKQL---------------------KNMITVTNQDDT---RI--
G1WUK1      --------------MDYKQL---------------------KDMITVANQDDT---RI--
D4M2S1      --------------MTYKEL---------------------KERITVENPSDT---RI--
E7GL80      --------------ITYRQL---------------------AEKLKLENPKDT---RI--
G5F9E3      --------------ITYRQL---------------------AEKLKLENPKDT---RI--
D4CG07      --------------YGYKAL---------------------REKLTIDNPKDT---RI--
D4MP31      --------------YGYKAL---------------------REKLTIDNPKDT---RI--
G5HNC6      --------------LTYDQL---------------------KEKITITNPTDT---RI--
A8RK86      --------------MTYGQL---------------------KARIRISNPADT---RI--
G5HTB1      --------------LSYTQL---------------------KNMIRISNPADT---RI--
A8RSL0      --------------LTYKEL---------------------VEKVTIDNPQDT---RI--
C5EN02      --------------LTYKEL---------------------LEKVTIDNPQDT---RI--
G5HG46      --------------LTYKDL---------------------KEKVTIDNPQDT---RI--
E7GL39      --------------MTYREL---------------------EKKLTIDNPNNT---RI--
E7GL56      --------------YSYKEL---------------------AGKLTVENPQNT---RI--
G5F9B0      --------------YSYKEL---------------------AGKLTVENPQNT---RI--
D3AC81      --------------LSHEQL---------------------VRKIKVDNPTDT---RI--
D3AE79      --------------LGYQQL---------------------NGKITVNNPTDT---RI--
D4YF14      --------------FTVPQL---------------------RNALRVEQSTDS---QA--
B1YMM6      --------------DSISAL---------------------NNMITVESEQNS---QV--
D4LG05      --------------MDYEDL---------------------AKLYTLNNPSDT---RV--
D4LTH3      --------------MDYNQL---------------------KQLYTLNNPTDT---RV--
F3ATF6      --------------MNHHQL---------------------RGSITITNPEGT---HI--
E0I7B6      --------------LSSDQL---------------------ISGVSVSSSNES---QI--
C9LAS2      --------------LPYEEL---------------------KEKISVENPEGT---RI--
F7K8E8      --------------LSYEEM---------------------KKKVSVTTPTDT---RI--
F7K9V0      --------------LSYEEM---------------------KKKVSVTTPTDT---RI--
F7KL97      --------------LSYDEM---------------------KKKVSVTTPTDT---RI--
D3FZP5      --------------RTHGQL---------------------NGQLNVSQEGQS---QV--
C0ZHV9      --------------STMEEL---------------------LLQTKVEPVKDS---QV--
D7WMM9      --------------VTPEVL---------------------MDQITVSSANNS---QV--
A8U9F5      --------------LTTTEL---------------------SEKIEITTQENS---QV--
F4BSE0      --------------LTTIEL---------------------SEKIEITTQENS---QV--
E7RDR2      --------------MSVEQL---------------------NSKITVATAQNS---QV--
I0JRK5      --------------MTSATL---------------------SDKIQVSNAEQS---QV--
G2TR26      --------------MTTDEL---------------------NSKIEVSTEQNS---QV--
D5DBK2      --------------SSAKSL---------------------SGQIQVTSSENS---QV--
D5DY80      --------------GSGQSL---------------------SGKIQVINAKDS---QV--
A7Z9K1      --------------MTSKEL---------------------ESKITVSSEQDS---QV--
I2CB17      --------------MTSKEL---------------------ESKITVSSEQDS---QV--
I2HW54      --------------MTSKEL---------------------ESKITVSSEQDS---QV--
G4P1M8      --------------MTSQEL---------------------NDKITVSSEQDS---QV--
E0TTZ7      --------------MTSQEL---------------------NDKITVSSEQDS---QV--
G4EQF2      --------------MTSQEL---------------------NDKITVSSEQDS---QV--
P96715      --------------MTSQEL---------------------NDKITVSSEQDS---QV--
I0F9R7      --------------MTSQEL---------------------NDKITVSSEQDS---QV--
G9QKR5      --------------MTTDTL---------------------NQKITVDSEQNS---QV--
B5UQ74      --------------IPVQEL---------------------NKRIEVTNEKDS---QV--
B7HFH2      --------------TTVQAL---------------------TGKINVMNEKDS---QV--
Q72XH7      --------------ITIQEL---------------------NKKIEVVNEKDS---QV--
C2V4M3      --------------IATQEL---------------------NKQIEVTNEKDS---QV--
C2YZB3      --------------ITTQEL---------------------NQKIEVANEKDS---QV--
C2P8H2      --------------ITVQEL---------------------NNKIEVANEKDS---QV--
C2Y451      --------------ITVQEL---------------------NNKIEVANEKDS---QV--
C3EBC1      --------------ITVQEL---------------------NKKIEVANEKDS---QV--
C3H980      --------------MTVQEL---------------------NNKIEVANEKDS---QV--
C2PN23      --------------MTAQDL---------------------TGKINVANEKDS---QV--
B9IRQ7      --------------ITIQDL---------------------NKKIEVANEKDS---QV--
A0RL71      --------------MTAQAL---------------------TKKINVANEKDS---QV--
C2XJI0      --------------MTAQEL---------------------TKKVNVANEKDS---QV--
Q3EV65      --------------MTAQEL---------------------TKKVNVANEKDS---QV--
C2T8T7      --------------MTAQAL---------------------TKKINIANEKDS---QV--
C2RG50      --------------MTAQAL---------------------TKKINIANEKDS---QV--
Q814Y9      --------------MTAQAL---------------------TKKINIANEKDS---QV--
B3ZRD5      --------------MTAQAL---------------------TKKINVANEKDS---QV--
Q6HB08      --------------MTAQAL---------------------TKKINVANEKDS---QV--
C2NQN7      --------------MTAQAL---------------------TKKINVANEKDS---QV--
C3GRR1      --------------MTAQAL---------------------TKKVNVANEKDS---QV--
C2ULR7      --------------MTAQAL---------------------TGKINVANEKDS---QV--
C3GBJ9      --------------MTMQEL---------------------TKKINVANEKDS---QV--
C2WVG7      --------------MTAQAL---------------------MGKINVANEKDS---QV--
B7IQS9      --------------MTSQAL---------------------TGKINVANEKDS---QV--
A9VRC4      --------------MTAQAL---------------------TGKINVANEKDS---QV--
C2MTG4      --------------MTAQAL---------------------TGKINVANEKDS---QV--
B7HXB5      --------------MTAQAL---------------------TGKINVANEKDS---QV--
C2SBU5      --------------MTAQAL---------------------TGKINVANEKDS---QV--
C2SSX9      --------------MTAQAL---------------------TGKINVANEKDS---QV--
G9QCG2      --------------MTAQAL---------------------TGKINVANEKDS---QV--
Q2BFS6      --------------ITTSQL---------------------DSKITVGSQKDS---QV--
I3EBB4      --------------MTTEEL---------------------NEKINVQSEKDS---QV--
A4ITF4      --------------QTLDEL---------------------NEQIQVSSEKDS---QV--
C5D962      --------------LTVDEL---------------------NEQIQVSSEKDS---QV--
G8MZ94      --------------RTLDEL---------------------NEQIQVSSEKDS---QV--
Q5KUM4      --------------RTLDEL---------------------NEQIQVSSEKDS---QV--
G5SDT9      --------------IAVT-----------------------KNTFPLFGAGWE---RL--
G5LQM7      --------------IAVT-----------------------KNTFPLFGAGWE---RL--
G5Q4J1      --------------IAVT-----------------------KNTFPLFGAGWE---RL--
B1V0N8      --------------LPTNYVR--------------------SGLSFIPGSGSI---PT--
B1BNK2      --------------LPTNYVR--------------------SGLSFIPGNGSI---PT--
B1R3X7      --------------LPTNYVR--------------------SGLSFIPGNGSI---PT--
Q8XN77      --------------LPTNYVR--------------------SGLSFIPGNGSI---PT--
B1HR40      --------------TSPETL---------------------MKQIEVSSANNS---QV--
G2Z8Q4      --------------QSVKQL---------------------KQQITIENVANS---QV--
F8FCE3      --------------LTPEQM---------------------AEMLEVKQSSDS---QV--
I0BSG5      --------------LTPEQM---------------------AEMLEVKQSSDS---QV--
A8YPQ6      --------------YSPSKL---------------------SSMLTITNQENT---QL--
P95695      --------------YSPSKL---------------------SSMLTITNQENT---QL--
Q2G1K8      --------------YSPSKL---------------------SSMLTITNQENT---QL--
C5QNG5      --------------YSADKL---------------------SKMIDVNTEADS---QI--
Q4L9H8      --------------YSSDEI---------------------NNMLSIDAESDS---QI--
Q2FUV1      --------------YSTAEL---------------------NSFLKVTNQTNS---QI--
P39850      --------------YSRSEI---------------------SSMLTVTNQAES---QV--
D7UYE3      --------------FSSSEI---------------------LSMLTVNNQSQS---QI--
Q4A121      --------------YSSEEI---------------------AGMLTVSNQAES---QI--
E3HB17      --------------AEPEEI---------------------AKLVKVTPVDET---EF--
C9AAE4      --------------YDVAEL---------------------SEILSVTNATNS---QI--
H7F6C7      --------------YDTAEL---------------------AEMIQVKNATNS---QV--
F0SX23      --------------EQTKKI---------------------REMVSTNTIYDT---EV--
Q38VG4      --------------LSNDEI---------------------ADMLSITNNQNS---QV--
F2I4B6      --------------ENPDQL---------------------REKISVESKNNS---QV--
Q8RBS6      --------------MSVEDL---------------------KGKIDVTSKDNT---EI--
D9SR42      --------------MSSGAL---------------------LGSMSVSSSTDT---EF--
D9SVC8      --------------YSPSAL---------------------LGSVAVVTPSET---EF--
E7RG09      --------------MSYQEM---------------------VEKVNVEVTENS---QL--
D4G2E2      --------------MTSQEL---------------------NDKITVSSEQDS---QV--
Q8EME7      --------------LTSSQL---------------------SEKISVASEENS---QV--
D6Y035      --------------ESHRSL---------------------NTALNVQQEGGS---QV--
Q5WBB3      --------------MTYGDL---------------------EAAVSVGSQSNS---QV--
Q9K6Q9      --------------DTYSQL---------------------NERLQINSENNS---QV--
Q97EP7      --------------TTIDQV---------------------SKVVSVTPETGT---QI--
Q97ER4      --------------TTADQV---------------------LGLVSVTPQTGT---QI--
E4S7Y7      --------------ISIDQL---------------------KSMVSVQLKNDT---RI--
E4Q5T6      --------------MTTEEL---------------------SNMVSVQLKNDT---RI--
E4SDX3      --------------MTPEEL---------------------GSMVSVQLKNDT---RI--
G2FWX3      --------------LTVEGL---------------------DKLISVNPVKDT---EI--
G7WJV2      --------------LTVEGL---------------------DPMISINPVKAT---EI--
G7W774      --------------LTVSEL---------------------DKLITINPVKTT---EI--
G2FM60      --------------LTVDEL---------------------NSLIAINPVKTT---EI--
H5XZD5      --------------LTVEGL---------------------DRLISINQVKTT---EI--
I4DBG9      --------------LTVEAL---------------------DKLITVDQVKTT---EI--
G2FWT7      --------------LTVGEL---------------------DKLISINPVKTT---EI--
H5XZG8      --------------LTVAEF---------------------DKMITINPVKTT---EI--
G0V448      --------------VTYDEF---------------------ISSITVTPQPDT---QI--
A0PZ01      --------------VTTKEL---------------------DKMIEVTPQQDT---QI--
B1B737      --------------VTTKEL---------------------DKMIEVTPQQDT---QI--
D9ST43      --------------VSTKDI---------------------LDSIIVIPKEDT---QL--
H7F5T7      --------------YTASQL---------------------SEMIQPSTEENS---QV--
G9WIR0      --------------YPDISSSSL------------------ASMVTVSSVQNS---QI--
D3LB11      --------------YPSLTSTAL------------------SKMITVSSTTNS---QI--
A0NKF7      --------------YPTLTSTAL------------------AKMITVSSTTNS---QI--
Q04DV7      --------------YPTLTSTAL------------------AKMITVSSTTNS---QI--
F6BI63      --------------MTTDQL---------------------KKNIDVAEEGDT---EV--
G2MWC1      --------------LTVDQL---------------------KNSVDVAAKDNT---EI--
B0K4N2      --------------LTVDQL---------------------KNSVDVAAKGNT---EI--
C7ISF8      --------------LTVDQL---------------------KNSVDVAAKGNT---EI--
B0KAR6      --------------LTVDQL---------------------KNSVDVAAKGNT---EI--
E8UV30      --------------LTVDQL---------------------KNSVDVAAKGNT---EI--
C0GGR6      --------------MSVNQL---------------------RGMINVRQVSDT---EI--
A4J8V1      --------------TTYEQL---------------------SQSIDVKPVKDT---QL--
C8VYQ7      --------------ITPEAF---------------------SAKINVEPVRDT---QL--
C8W5K3      --------------ITPDQF---------------------IGKVSVQPVKES---QL--
B1BNH4      --------------YNQEDIKAI------------------LKNLNATPSAET---QI--
B1V1Z3      --------------YNQEDIKAI------------------LKNLNATPSAET---QI--
B1R3V2      --------------YNQKDIKAI------------------LKNLNATPSAET---QI--
Q0SVR9      --------------YNQNEIKGV------------------LNNLNVTPSADT---QI--
Q8XN47      --------------YNQKEIKGI------------------LNNLNVTPSADT---QI--
G7M0Q2      --------------VKPNDV---------------------LKNLTVTPTVDT---QI--
G7M565      --------------LSSDKI---------------------LSTLSVTPRSDT---QI--
A6M2M0      --------------LNSENV---------------------LDNLSVTPRTDT---QI--
G7M1R8      --------------INSQDV---------------------LDNLTVTPTANT---QI--
A5V0I4      --------------RTPEWL---------------------LKRVAIQPRPDE---RK--
A7NQ70      --------------RTPEWL---------------------LKRVAIQPRPDE---RK--
Q4JZ56      --------------STLESL---------------------ASKIKISIPAET---RI--
Q7X554      --------------LSEAQL---------------------AKMISVNIPTDT---RL--
Q7X550      --------------MTEAEL---------------------AKMISVDIPTDT---RL--
Q7X562      --------------MTEAEL---------------------DKMISVDIPTDT---RL--
Q7X556      --------------LSEAKL---------------------SKMVSVNIPTDT---RL--
Q7X552      --------------LSEAEL---------------------SKMVSVNIPTDT---RL--
Q7X558      --------------LSEAEL---------------------SKMVSVNIPTDT---RL--
C5NWJ9      --------------ITARQL---------------------AGKVSVDAPKDT---RI--
F3A498      --------------LTAKQL---------------------AGKVSVDAPKDT---RI--
Q9AHD3      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K2E2      --------------MPTKNL---------------------ASKIQVTVPVDT---RI--
Q4K2F8      --------------MPTKNL---------------------ASKIQVTVPVDT---RI--
Q4K046      --------------MPAKTL---------------------TSKVQVTVPADT---RV--
Q4K0R8      --------------MPARAL---------------------ASKVQVTVPADT---RI--
Q4JYY0      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
Q4JZW8      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
I0J9C8      --------------MPTKTL---------------------ASKVKVTVPTDT---RI--
Q4K0M4      --------------MPTKTL---------------------ASKVKVTVPTDT---RI--
Q4JZS4      --------------MPAKTL---------------------TRKVQVTVPVDT---RI--
Q4JZK2      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
Q9AHA5      --------------MPAKTL---------------------ASKVQVTVPTDT---RI--
Q9X9A0      --------------MPAKTL---------------------ASKVQVTVPTDT---RI--
Q4JYK9      --------------MPAKTL---------------------ASKVQVAVPADT---RI--
Q4K006      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
Q4JZG8      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
A6YIA7      --------------MPAKTL---------------------ASKVQVAVPADT---RI--
E5F5C4      --------------MPAKTL---------------------ASKVQVAVPADT---RI--
Q9AHB8      --------------MPAKTL---------------------ASKVQVAVPADT---RI--
Q4JZL8      --------------IPAKTL---------------------ASKVQVTVPADT---RI--
Q4K1B8      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
Q8VU32      --------------MPAKAL---------------------TSKVQVTVPTDT---RI--
D2ERX9      --------------MPAKTL---------------------ASKVQVTVPTDT---RI--
G6C7Z0      --------------MPVKTL---------------------ASKVQVTVPADT---RI--
Q4K2A9      --------------MPAKAL---------------------TSKVQVIVPADT---RI--
D6ZQI7      --------------IPAKTL---------------------TSKVQVTVPADT---RI--
Q9ZFT9      --------------MPAKTL---------------------TSKVQVTVPADT---RI--
Q4K255      --------------MPAKTL---------------------TSKVQVTVPADT---RI--
F9HJP7      --------------STTADL---------------------AGKVAVSVPTDT---RI--
E8JWI4      --------------GSPSDL---------------------ASKVTVTVPTDT---RI--
A8AZR4      --------------GTTAEI---------------------SKSVSVSVPTDT---RI--
D0RXH3      --------------GTTAEL---------------------SKSVSVSVPTDT---RI--
Q83YR6      --------------GTTAEL---------------------SKSVSVSVPTDT---RI--
F1Z125      --------------MTPEEL---------------------SKMIAVTIPADT---RV--
Q3K0S9      --------------YPSSQL---------------------LQKITVSILKDT---RV--
P0C0T8      --------------YPSSQL---------------------LQKITVSILKDT---RV--
Q67AY5      --------------YPSSQL---------------------LQKITVSILKDT---RV--
Q04662      --------------YPSSQL---------------------LQKITVSILKDT---RV--
Q8GP93      --------------MTEAEL---------------------AKMISVDIPTDT---RL--
Q8GPF7      --------------LSETEL---------------------SKMVSVNIPTDT---RL--
E3CP61      --------------MTEAEL---------------------AKKISVNIPTDT---RL--
E8KUY7      --------------MTEAEL---------------------AKKISVNIPTDT---RL--
C2LSE5      --------------MTEAEL---------------------AKMISVNIPTDT---RL--
E9DM16      --------------MTEADL---------------------AKMISVNIPTDT---RL--
I0QIK5      --------------MTEADL---------------------AKMISVNIPTDT---RL--
Q7X560      --------------MTEAEL---------------------AKMISVNIPTDT---RL--
Q8GMA6      --------------LSEAEL---------------------SKMVSVNIPTDT---RL--
Q55204      --------------MTEAEL---------------------AKMISVNIPTDT---RL--
Q8GPC4      --------------MTEAEL---------------------AKMISVNIPTDT---RL--
Q8GPA9      --------------MTEAEL---------------------DKMISVDIPTDT---RL--
G6ERT2      --------------LSEAEL---------------------AKMISVNIPTDT---RL--
O87930      --------------LSEAEL---------------------AKMISVNIPTDT---RL--
Q8GP55      --------------LSETEL---------------------SKMVSVNIPTDT---RL--
F8HDC4      --------------LSEAEL---------------------SKMVSVNIPTDT---RL--
F8LJ76      --------------LSEAEL---------------------SKMVSVNIPTDT---RL--
F8LXJ5      --------------MTEAEL---------------------AKMISVDIPTDT---RL--
Q1WCR2      --------------MTEAEL---------------------AKMISVDIPTDT---RL--
G3G7C0      -----------------ENL---------------------KEKVSVSIPVDT---RI--
G3G7J8      -----------------ENL---------------------KEKVSVSIPVDT---RI--
G8DU30      -----------------ESL---------------------KEKISVSIPVDT---RI--
A4VTU2      -----------------ESL---------------------KEKISVSIPVDT---RI--
D5AGQ4      -----------------ESL---------------------KEKISVSIPVDT---RI--
Q9X4U6      -----------------ESL---------------------KEKISVSIPVDT---RI--
G3G7G5      -----------------ESL---------------------KEKISVSIPVDT---RI--
G7SG35      -----------------ENL---------------------KEKVSVSIPVDT---RI--
G8DU06      -----------------ENL---------------------KEKVSVSIPVDT---RI--
G8DUA9      -----------------ENL---------------------KEKVSVSIPVDT---RI--
G8DTY9      -----------------ENL---------------------KEKVSVSIPVDT---RI--
G3G7I7      -----------------ESL---------------------KEKISVSIPVDT---RI--
G3G7J3      -----------------EDI---------------------SNKISVSIPVDT---RI--
E0PD82      --------------LSTSEL---------------------SDMITVDIPTDT---RV--
F5X651      --------------LSTSEL---------------------SDMITVDIPTDT---RV--
G5JTD6      --------------ISSDEL---------------------AKKVSVQVPTDT---RL--
Q2KM75      --------------MSPEEL---------------------SQMITVTVPADT---RV--
G5KAJ3      --------------LTPEQL---------------------SKMIAVTVPADT---RV--
B9DUJ5      --------------LSPDTL---------------------SKMISVTIPADT---RV--
G5KD12      --------------LTPEQL---------------------SKMITVTIPADT---RV--
E8JMT8      --------------LSTSEL---------------------SDMISVDIPTDT---RV--
F5X0J8      --------------LSTSEL---------------------SNMISVNIPTDT---RV--
H2A601      --------------LSTSEL---------------------SNMISVNIPTDT---RV--
E7S8W2      --------------MTPAEL---------------------AKKVSVAVPTDT---RI--
F8DFF5      --------------MTPAEL---------------------SKKINVSVPTDT---RI--
I1ZPH8      --------------MTPAEL---------------------SKKINVSVPTDT---RI--
E3CBR9      --------------LTPAEL---------------------SKKISVSVPTDT---RI--
E8K787      --------------MTPAEL---------------------SKKISVSVPTDT---RI--
F9M365      --------------LTPAEL---------------------SKKISVSVPTDT---RI--
A3CQY3      --------------TSPREL---------------------TRHITVSVPADT---RI--
E8KLZ0      --------------TSPREL---------------------TRHITVSVPADT---RI--
F0FHA9      --------------TSPREL---------------------TRHITVSVPADT---RI--
F0FQQ4      --------------TSPREL---------------------TRHITVSVPADT---RI--
F0I4H6      --------------TSPREL---------------------TRHITVSVPADT---RI--
F0IAY2      --------------TSPREL---------------------TRHITVSVPADT---RI--
F0IJI1      --------------TSPREL---------------------TRHITVSVPADT---RI--
F0IS52      --------------TSPREL---------------------TRHITVSVPADT---RI--
F2C9N1      --------------TSPREL---------------------TRHITVSVPADT---RI--
F2CH54      --------------TSPREL---------------------TRHITVSVPADT---RI--
F3UDW8      --------------TSPREL---------------------TRHITVSVPADT---RI--
F3UNJ5      --------------TSPREL---------------------TRHITVSVPADT---RI--
F3SM33      --------------TSPRKL---------------------TRHITVSVPADT---RI--
F9HC66      --------------KTVKEL---------------------TKKIQVTVPVDT---RI--
E1LQJ6      --------------KTVREL---------------------SKKIQVTVPVDT---RI--
Q4JYU0      --------------KTVKEL---------------------SKKIQVTVPVDT---RI--
Q4JZY2      --------------KTVKEL---------------------SKKIQVTVPVDT---RI--
F9Q346      --------------LPSKGL---------------------ASKIKVTVPADT---RI--
Q6L5R1      --------------LPSKGL---------------------ASKIKVTVPADT---RI--
E9FEC6      --------------LPPKGL---------------------ASKIKVTVPVDT---RI--
E0Q2S9      --------------LPPKDL---------------------AGKIKVTVPADT---RI--
F5VSH0      --------------LPPKDL---------------------AGKIKVTVPADT---RI--
A5YTV6      --------------LPPKGL---------------------AGKIKVTVPVDT---RI--
Q6L5T1      --------------LPPKGL---------------------ASKIKVTVPVDT---RI--
E0PPH8      --------------LPPKDL---------------------AIKIKVTVPVDT---RI--
A5YTT8      --------------LPPKGL---------------------ASKIKVTVPVDT---RI--
E6KKR9      --------------LPPKGL---------------------ASKIKVTVPVDT---RI--
A1ILY0      --------------LPPKGL---------------------ASKIKVTVPVDT---RI--
F2QF91      --------------LPPKGL---------------------ASKIKVTVPVDT---RI--
Q4K0I3      --------------IPVKTL---------------------TSKVQVTVPADT---RI--
Q8KWQ1      --------------MPAKTL---------------------ASKVQVTVPDDT---RI--
Q4K238      --------------IPAKTL---------------------TSKVQVTVPADT---RI--
B1I966      --------------IPAKTL---------------------TSKVQVTVPADT---RI--
G6J8A3      --------------IPAKTL---------------------TSKVQVTVPADT---RI--
F9LZC3      --------------MPAKTL---------------------ASKVQVTVPADT---RI--
F9P1W9      --------------MAAKTL---------------------ASKVQVTVPADT---RI--
A5LJR9      --------------MPAKTL---------------------ASKVQVAVPADT---RI--
Q9ZII7      --------------MPAKTL---------------------ASKVQVTVPTDT---RI--
Q4K1K7      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
E1LPE6      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
F9MJW6      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K0V3      --------------LTPKDL---------------------ANKIKVTVPVDT---RI--
Q54519      --------------LTPKDL---------------------ANKIKVTVPVDT---RI--
C1CBD0      --------------LTPKGL---------------------ANKIKVAVPVDT---RI--
Q7WVX1      --------------LTPKGL---------------------ANKIKVAVPVDT---RI--
Q4K0E2      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q9AH96      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
A5M4L2      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
B2ILP4      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
C1CCB8      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
P72511      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K1S8      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
P96474      --------------LMPKGL---------------------ANKIKVTVPVDT---RI--
Q4K196      --------------LTPKGL---------------------ANKIEVTVPVDT---RI--
Q4K0Z7      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4JZ85      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4JYH6      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4JZ19      --------------LTPKGL---------------------ANKIKVIVPIDT---RI--
Q4K0A1      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K1M5      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K2Q8      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K1G0      --------------LTPKGL---------------------ASKIKVTVPADT---RI--
Q4K0T6      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K0K3      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
Q4K0X6      --------------LTPKGL---------------------ANKIKVTVPVDT---RI--
E8KDN1      --------------FDAKAL---------------------AKKIQVTVPADT---RI--
F9PEU3      --------------MDAKTL---------------------GRKVSVTVPADT---RI--
E8K321      --------------IDAKTL---------------------GKKVSVTVPADT---RI--
F9PZP6      --------------MDAKTL---------------------GRKVSVTVPADT---RI--
D6R2T7      --------------ISPAEL---------------------AKNISVSVPVDT---RI--
F3UUQ1      --------------ISPAEL---------------------AKNISVSVPVDT---RI--
E6IZC3      --------------MQPSAL---------------------AKKITVTVPTDT---RI--
G6A746      --------------MQPSAL---------------------AKKITVTVPTDT---RI--
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
B7B948      ---------------SDGKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPL
G8AU95      EGNDVL---------RQIVQQATALFRADDGPVARDPNQARLLTIDTLLRRI--EARNDD
G5IFS2      ------------------------------------------------------------
F0G6H6      GGAYTLQRTGLFGRKGPVWQGRIGEPLHAETPDGNIDLLVRGIDGEPGARFD--LTRHGE
A3W0H6      ---------------TPITVGVPGMGPAT-TPSG--------------------------
A3K8W6      ---------------TPITRPGPTFSAAAQAPSG--------------------------
Q0FMP1      ---------------QEIRTNSNSFAAQQEMPSG--------------------------
S9QRP2      ---------------EEIRSNSGSFQASQEVPSG--------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ----------------------KAVSFEEVYGLDSNKKEYYLTQ----------------
G9RSY8      ----------------------QAAA----------------------------------
F3CAY8      ----------------------GIEG----------------------------------
I0UTA4      ----------------------LDIEVSDSNAKRSAQYANAIAKAYLEVRQNNLKETITD
E9TE87      ----------------------LSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASK
E6PYQ4      ----------------------ISVTFRSRNPVLSAIVVNTLVDEYFEESFEQRYKSTQD
C0QCJ1      ----------------------FTISYKGSDPDKVMRITNTLTSFFMDENLKLREAQAIG
I5B297      ----------------------FSISFTGSEPQRVMRIANTLASYFMDENLKVREAQAIG
B8D0N1      ----------------------IKISIKHTDPVIARQIISYLIEEFIINNRNLKKSATVN
D9QTC7      ----------------------ITITVNYSDPVVAKRIANTLVDKFQQMNQAMNQSDLQG
C7LPS4      ----------------------FFISFQDSDPRYARDFVNTITQVYIESNTASKRDESLE
Q314L4      ----------------------FFISYESSNPVLARDFVNTLTRHYIEQSTSDKREESFE
G0VNK5      ----------------------LEVDVTGKSPEQAQQANNLIVQGFMNRLTELSHDEQKR
D2RIR1      ----------------------LEVDVTGKSPEQAQEANQLLVQGFLDRLAQLSHAESSA
I0GRR3      ----------------------LQVDVTGKSPEQAQEANQLIVDGFLSRLAELSHAEQGA
Q39U16      ----------------------FIVSIRDKDPKLATDYVNTLVRKYVEENVSSKRQDSFG
F0JCB9      ----------------------FDIRFADTDPVLARDVVNTLTRVYIEDSVSNKRKESYE
G7QCG0      ----------------------IVLNFSDKDPRFARDFINTMARVYIERNTSTKREESTE
I2Q342      ----------------------IVLNFSDKDPRFARDFINTMARVYIERNTSTKREESTE
Q74BQ7      ----------------------FTISYVDKDPRVARDFVNTLVRRYVEENISSKREESYG
B5EA80      ----------------------FTISFTHTNPRIARDYVNTLVRLYIEGNISSKRGESYD
C6DZX6      ----------------------FTISFTHTNPSIARDYVNTLVRLYIEGNISSKRGESYD
A1ARV9      ----------------------FTISYTDKNPQMARDFVNTLVRLYIEENTSSKRGESYD
E8WSZ4      ----------------------FTISFVHTDPRIARDLVNTLVRLYVEQSTSSKRGESYD
A5G425      ----------------------FIISFTNENPRLARDYVNTLVRRYIEENVSSKREESYG
B9M2X7      ----------------------FTISYTGENPKRARDYVNTLVRRYIEENSSSIRAESYG
C2MBF7      ----------------------ITLRVKPDKGSDSQVILYDIKSSLVGKVQEPITAPLGD
H8YYB8      ----------------------FSLSFESESPTVAQRVANDITSLFLSENLKDRQESAKE
B7B948      QNVALLFQSGLQATLASKTATIINLTLQDVSIPRAEDVINTLISAYNTDAINDKNQIVMN
G8AU95      RSFT------------------IIIEASSVDPAKAAAIANAFGQAYLDYRTEMNRDMTER
G5IFS2      ----------------------LTISVEDNDPYMAKAIADEMASVAASRMAEIMDTAPPN
F0G6H6      AETTAWLQKNVLISERGKQSNIIGATLDGSDAAHISSILNAVGDAYLAQNTQRKSEAADK
A3W0H6      ----------------------LSVTVNLNDPVKAAEVANDFVETVIAENRERRMALVRE
A3K8W6      ----------------------LMISVMLPDPEKAAVVANDLMTKVIAESRDRSAEQASE
Q0FMP1      ----------------------LRISVVLPDPQKAADVANEMMYQVINQSRDRSLSSARD
S9QRP2      ----------------------LTITVRLGDPQKAADVANELMTTVIEQSRSRSASSARD
F4SM98      ----------------------------DSQPQSAPEIALLQSR----------------
C4Z673      ----------------------IAITVTDPEPEQAQKIANSVRD----------------
E3H7M4      ----------------------IKISYEDENPQKAALIVNHVSE----------------
F8KGP2      ----------------------FSLQVKTDDPQESAVVANTVAN----------------
B3XL22      ----------------------FSLQVKTDDPQESAVVANTVAN----------------
F8DRU3      ----------------------FSLQVKTDDPQESAVVANTVAN----------------
C2EWM2      ----------------------FTLNAKTNNAEESAAIANTVAS----------------
D0DSJ3      ----------------------FSLSAEAGNPTEAKVIANTVAK----------------
B2GF32      ----------------------FSLSAEAGNPTEAKVIANTVAK----------------
C0WW25      ----------------------FSLSAEAGNPTEAKVIANTVAK----------------
F0K0J8      ----------------------FTLSATAETPAKAQAIANAVAK----------------
G6F8H0      ----------------------FTLSATAETPAKAQAIANAVAK----------------
F0HVF2      ----------------------FTLSATAETPAKAQAIANAVAK----------------
Q1G8E3      ----------------------FTLSATAETPAKAQAIANAVAK----------------
D6S4X3      ----------------------FSIKATSDTPEKAQAEANAVAQ----------------
Q5FIC6      ----------------------FSISAEADTPAKAKAEVNAVAE----------------
E4SMV6      ----------------------FSISAKADTPAKAKAEVNAVAE----------------
F0TGY3      ----------------------FSISAKADTPAKAKAEVNAVAE----------------
F2M2M7      ----------------------FSISAKADTPAKAKAEVNAVAE----------------
A4ZGZ7      ----------------------FSVSATADTPEKAKAEANAVAR----------------
C2EPK4      ----------------------FSISAESNTPAKARAEVNAVAE----------------
C7XKF2      ----------------------FSISATADTPEKAKVEANAVAR----------------
E3R265      ----------------------FSISATADTPEKAKVEANAVAR----------------
D0DJG9      ----------------------FSISATADTPEKAKVEANAVAR----------------
D5GZJ9      ----------------------FSISATADTPEKAKVEANAVAR----------------
A8YX90      ----------------------FSVSATADTPEKAKAEANAVAR----------------
F0NWJ8      ----------------------FSVSAEADTPEKAKAEANAVAR----------------
C2JZS0      ----------------------FTISVTDTSPTRARDIANEIAR----------------
C1J9I2      ----------------------FTVNVKDTSPVRARDIANEIAK----------------
Q58Z11      ----------------------FTVNVRDTDPVRAKDVANEIAK----------------
B1MZT2      ----------------------FAINVTSKDPKQAALVANTVAD----------------
C2KHF2      ----------------------FSINVKSKDPKLAADVANEVAD----------------
Q03W94      ----------------------FSINVKAKDSKLAADVANEVAD----------------
C6CW36      ----------------------LNLTYQATSYESAAETVNAISL----------------
A8SQS9      ----------------------LQIVVTSTDKQQACDIANTLAN----------------
D5HFS3      ----------------------LKITVTSTDKQQACDIANTLAN----------------
B9Y883      ----------------------ITIAVTSKDPKEAAVIANEIVD----------------
A5Z5P8      ----------------------LKISATSIKPEEAKTIANALAE----------------
G2KUP2      ----------------------FSVSATANNPYTASDIANETAK----------------
G8PE07      ----------------------FSITAKSTNPEMAAKIANKTAS----------------
E0NHP5      ----------------------FSINAKSTNPNTAAKMANETAK----------------
Q03GL9      ----------------------FSITAKSTNPNTAAKMANETAT----------------
C6CSC7      ----------------------MTLAVQDVSYQQAAKIVNAISL----------------
C6CS79      ----------------------VTISYLDTDYKRAAQVVNTVSY----------------
F5LM70      ----------------------FTLSLEDASYSKAAQMINTVAQ----------------
G0LYN8      ----------------------FSISVTDTNAKASATIANQIAR----------------
F6ITB3      ----------------------FSIAVTDADAKASATIANQIAR----------------
G0M1Y0      ----------------------FSIAVTDADAKASATIANQIAR----------------
D7VC12      ----------------------FSIAVTDANAKASATIANQIAR----------------
F9UMZ5      ----------------------FSIAVTDADAKASATIANQIAR----------------
D4JI68      ----------------------LNITVTDPDPQMAKTIADEIAK----------------
D6E329      ----------------------LNITVTDPDPQMAKTIADEIAK----------------
Q1AUN7      ----------------------VEVRYRDPDPQRAQRVANAVGE----------------
H4GK02      ----------------------FTLNAEASNPTEAKAMANTVAS----------------
F6IR92      ----------------------FSIVVRDHNASASAVIANQIAT----------------
G0M0G0      ----------------------FSIVVRDHNASASAVIANQIAT----------------
D7VBW5      ----------------------FSIVVRDKNAKASAMIANQIAA----------------
F9UQ55      ----------------------FSIGVRDKNAKASAMIANQIAA----------------
D4YHG8      ----------------------FTISVENESPYVAANLANAIAV----------------
F7V793      ----------------------LKITVRSENPEEAKEIANTLAY----------------
C3WFM8      ----------------------ISLTYKNSDPQLAAMVTNEIAN----------------
H7F1R6      ----------------------IRIQVESKNPKDAVKIANETVR----------------
H7F570      ----------------------ITISVEGENAKDIVKIANDVVQ----------------
C6LCS6      ----------------------ISIRATDENPQEAKAIADEVRN----------------
A7VF43      ----------------------LKITVTSTDPEEAMNIANTLAE----------------
A7Z922      ----------------------ITIAVQDENPKQAAAIANTLMK----------------
I2CAF3      ----------------------ITVAVQDENPKQAAAIANTLMK----------------
I2HVL3      ----------------------ITVAVQDENPKQAAAIANTLMK----------------
E0U2Z4      ----------------------ITVAVQDHDPAKAADIANTLVN----------------
D4G1R3      ----------------------INVAVQDHDPAKAAEIANTLVN----------------
G4EQZ6      ----------------------INVAVQDHDPAKAAEIANTLVN----------------
P71050      ----------------------INVAVQDHDPAKAAEIANTLVN----------------
G4P115      ----------------------ITVAVQDHDPAKAAEIANTLVN----------------
A8FHM0      ----------------------INISVQDEDRAKAVAIANTATE----------------
C0EBA5      ----------------------MRITATSEDPELAANLANAVTE----------------
B7BDT7      ----------------------LLTDFSRNGEDVAGNITATLND----------------
H6LKR9      ----------------------FTVGFKDPDPEIAKKVSDELAK----------------
F5LE49      ----------------------MTITATADNYATAAKLANAVSD----------------
F3AHH1      ----------------------VTIKVTDADPYQARDIANTLRD----------------
F3Y921      ----------------------FTIIATAKQATTAEKIANLTAN----------------
G4L593      ----------------------FSIVATGESAADAEHIANTAAE----------------
E6LD65      ----------------------FSIIVTTTKSVEAAHIANTVAK----------------
C9ALZ8      ----------------------FSIQATSTNAVTAQQIANTTSQ----------------
C9BUG6      ----------------------FSIQAISTNAVAAQQIANTTSQ----------------
Q3XYS7      ----------------------FSIQAISTNAVTAQQIANTTSQ----------------
C9B453      ----------------------FSIQAISTNAVTAQQIANTTSQ----------------
D4RJF5      ----------------------FSIQAISTNAVTAQQIANTTSQ----------------
C8ZXT8      ----------------------FSIQATNPNAVTAQKIANTTAL----------------
F0EKB8      ----------------------FSIQATSTNAVSAQNIANTTAL----------------
C9A6V4      ----------------------FSIQATSTNAVSAQNIANTTAL----------------
C9CHY7      ----------------------FSIQATSTNAVSAQNIANTTAL----------------
E6UHY5      ----------------------LQVTVTSQVPKFSADICSYISE----------------
E9SAU2      ----------------------LQVTVTSEVPNFSADICSYISE----------------
F7K0U2      ----------------------LSISVENESPKLAKEIADAVRE----------------
O06029      ----------------------IMLTVKYSNPYIAKKIADETAK----------------
G8P3D6      ----------------------ITLTVKYSNPYIAQKIADETAK----------------
A9QSJ3      ----------------------ITLTVKYSNPYIAQKIADETAK----------------
F9VC43      ----------------------ITLTVKYSNPYIAQKIADETAK----------------
G6FD41      ----------------------ITLTVKYSNPYVAQKIADETAK----------------
G9M881      ----------------------ITLTVKYSNPYIAQKIADETAK----------------
Q3ZK51      ----------------------ITLTVKYSNPYIAQKIADETAK----------------
Q83VG0      ----------------------ITLTVKYSNPYIAQKIADETAK----------------
C6LDI9      ----------------------LKITVSDSDAERAKRIVDELTV----------------
G5F9H3      ----------------------LTLTIKDPNPYLAKSIVDEVAN----------------
C0CZV8      ----------------------LSISVMDPDPQMAKAIADKVAA----------------
G5GFW1      ----------------------LSLSIVDEDPAMAKKIVDEVAN----------------
H1LCW2      ----------------------FALNVKSDDPQKSAAIANTVAK----------------
I5AV00      ----------------------ITIYITDFDPFRACDIANCVRE----------------
H6NE44      ----------------------MTLVIRDTDYRRAAETVNAISY----------------
F4BS20      ----------------------FGIKVTDTDPNRAAEMANLMAA----------------
E0RZL4      ----------------------VAITVRDKDPLMAMKIANCIRE----------------
C0CK72      ----------------------LKVEYKDKDPKMASKVVNTLVQ----------------
D9S1J8      ----------------------IEIRVSDHDPVMAATIANAVSE----------------
C2EFR7      ----------------------ISISVTDPNPVVAQRLANSIRD----------------
Q1WTC7      ----------------------ISISVTDPNPVVAQRLANSIRD----------------
B0P2G1      ----------------------MQITITDKDAALAQSITQDLAE----------------
D4MW28      ----------------------MQITITDKDAALAQSITQDLAE----------------
E5VMX9      ----------------------MQITITDKDAALAQSITQDLAE----------------
F2I6Z8      ----------------------FNVIVTDDNASQAQGLASDISK----------------
E6U7N3      ----------------------LKITVKDTNPQVAKNIANDIAR----------------
C4Z8M6      ----------------------LNITVTDPDPQMAKTIADEIAK----------------
D4JMC3      ----------------------LKIVVTDTDLEASKTVADEIAK----------------
D6E0V3      ----------------------LKIVVTDTDLEASKTVADEIAK----------------
E3GPC7      ----------------------IKITVTDEDPVEAASIANETAK----------------
A6BIG6      ----------------------MSIYVQSTSPKQAKQIADAVRN----------------
C2CI43      ----------------------ISVKVVDTIPERAMDIANETAN----------------
D4RX68      ----------------------ISIKVTDKDPILAKEITDDIAT----------------
D4J4T5      ----------------------LQVTVNDPNPQTAADIANEMAS----------------
I5ASF9      ----------------------LQLSVEQPNPKLAKKVVDTLAA----------------
C0C0F9      ----------------------LTIIVENQDPKLAKEIADALRE----------------
B6W7H3      ----------------------ISVKVVDTVAERAMDIANATSM----------------
C7RGH5      ----------------------ISVKVVDTIPERAMDIANETAN----------------
F0GT82      ----------------------ISVNVVDSVPTRAMDIANETAN----------------
F3AH93      ----------------------LNVSVTSTDPKQAKILVDELAV----------------
B0GAL4      ----------------------LQLSVEYSDAKQAKEIVDKLSE----------------
G1WUK1      ----------------------LQLSVEYSDAKQAKEIVDKLSE----------------
D4M2S1      ----------------------LSITATDKDPEMAKKIADTLAK----------------
E7GL80      ----------------------LYLTVTDPNPYMAKAIVDEIAN----------------
G5F9E3      ----------------------LYLTVTDPNPYMAKAIVDEIAN----------------
D4CG07      ----------------------LTLSVEDPDPILAADIVNTVAE----------------
D4MP31      ----------------------LTLSVEDPDPILAADIVNTVAE----------------
G5HNC6      ----------------------LNMTVSDEDPVRARAIVDEVAR----------------
A8RK86      ----------------------LNMTVSDTDPVRAKAIADEVAN----------------
G5HTB1      ----------------------LNMSVSDTDPVRAKAIVDAVAK----------------
A8RSL0      ----------------------LSISVEDPDPAMAKLIADKIAV----------------
C5EN02      ----------------------LSISVEDPAPDMAKLIADKIAT----------------
G5HG46      ----------------------LSISVEDPDPNMAKMIADKIAT----------------
E7GL39      ----------------------LTLTIKDPNPYLAKSIVDEVAN----------------
E7GL56      ----------------------LSLTVRDENPYMAKQIVDDIAN----------------
G5F9B0      ----------------------LSLTVRDENPYMAKQIVDDIAN----------------
D3AC81      ----------------------LTISVEDTDPYMAKSIADEFAS----------------
D3AE79      ----------------------LTISAKDTNPETARAIADEVAS----------------
D4YF14      ----------------------FNISATMDTPGDAQNIVNSVIT----------------
B1YMM6      ----------------------INVSVQNTDAALASNVANSVAK----------------
D4LG05      ----------------------LQITATTTDPQLSMDLAETMAE----------------
D4LTH3      ----------------------LQITATTTDPQLSMDLAETMAV----------------
F3ATF6      ----------------------MEVTARSSDPETAKKIADTMAV----------------
E0I7B6      ----------------------MDITFASTSYPQAAKAVNAIAK----------------
C9LAS2      ----------------------LNITVEDSEPKMAQKIVNEVAS----------------
F7K8E8      ----------------------LAITVTDTDPVMAMQLANAIRE----------------
F7K9V0      ----------------------LAITVEDTDPVMAMQLANSIRE----------------
F7KL97      ----------------------LAITVTDTDPVMAMQLANAIRE----------------
D3FZP5      ----------------------VTIRVEDANPAMAVNLANATAA----------------
C0ZHV9      ----------------------ISITVEDPDQGRAVLIANTIAK----------------
D7WMM9      ----------------------VNINVVDKQAELAVDIANTIAD----------------
A8U9F5      ----------------------FSLTVTDESPYEASEIANAVAE----------------
F4BSE0      ----------------------FSLTVTDESPYESAEIANSVAT----------------
E7RDR2      ----------------------VDITVQDENPAQAVDIANTTAK----------------
I0JRK5      ----------------------VNVVATDEDPQQAAAIANTTVQ----------------
G2TR26      ----------------------FTLTVKDTNPYMATKIANKIGE----------------
D5DBK2      ----------------------AQITVQDTNAKRATEIANTTAS----------------
D5DY80      ----------------------VQIVVQDTNAKRATDIANTTAS----------------
A7Z9K1      ----------------------VTIAVRDTDAKRAAVMANAVAA----------------
I2CB17      ----------------------VTIAVRDTDAKRAAVMANAVAA----------------
I2HW54      ----------------------VTIAVRDTDAKRAAVMANAVAA----------------
G4P1M8      ----------------------VNISVKDENAETAAHIANTIAS----------------
E0TTZ7      ----------------------VNISVKDESAETAAHIANTIAS----------------
G4EQF2      ----------------------VNISVRDENAETAAHIANTIAS----------------
P96715      ----------------------VNISVRDENAETAAHIANTIAS----------------
I0F9R7      ----------------------VNISVRDENAETAAHIANTIAS----------------
G9QKR5      ----------------------LNVSVQDPDPDKAVLIANKIAE----------------
B5UQ74      ----------------------VTVTAQDNDPKVARDIANTIAE----------------
B7HFH2      ----------------------ISVMAEDKDPKLARDIANATAE----------------
Q72XH7      ----------------------VTLMAQDQDPRLARDIANTTAE----------------
C2V4M3      ----------------------VSVTTQDKDPKLARDIANTTAE----------------
C2YZB3      ----------------------VAVTAKDKDPNLARDIANTTAD----------------
C2P8H2      ----------------------VAVTAQDKDPKLARDIANTTAE----------------
C2Y451      ----------------------VAVTAQDKDPKLARDIANMTAE----------------
C3EBC1      ----------------------VALTAQDKDPKLARDIANTTAE----------------
C3H980      ----------------------VAVTAQDKDPKLARDIANTTAE----------------
C2PN23      ----------------------ISITVEDKNPKLARDIANATAD----------------
B9IRQ7      ----------------------VTVTAQDKSPSLARDIANATAD----------------
A0RL71      ----------------------ISVTAEDKDPKVARDIANATAD----------------
C2XJI0      ----------------------IAVTAEDKDPKIARDIANATAD----------------
Q3EV65      ----------------------IAVTAEDKDPKIARDIANATAD----------------
C2T8T7      ----------------------ISVTAEDKDPKLARDIANATAD----------------
C2RG50      ----------------------ISVTAEDKDPKLARDIANATAD----------------
Q814Y9      ----------------------ISVTAEDKDPKLARDIANATAD----------------
B3ZRD5      ----------------------ISVTAEDKDPKVARDIANATAD----------------
Q6HB08      ----------------------ISVTADDKDPKVARDIANATAD----------------
C2NQN7      ----------------------ISVTAEDKDPKVARDVANATAD----------------
C3GRR1      ----------------------ISVTAEDKDPKVARDIANATAD----------------
C2ULR7      ----------------------ISVTAEDKDPKLARDIANATAD----------------
C3GBJ9      ----------------------ISVTAEDKDPKLARDIANATAD----------------
C2WVG7      ----------------------ISVTATDKDPKLARNIANATAD----------------
B7IQS9      ----------------------ISVTAEDKDPKLARDIANATAD----------------
A9VRC4      ----------------------ISVTAEDKDPKLARDIANATAD----------------
C2MTG4      ----------------------ISVTAEDKDPKLARDIANATAD----------------
B7HXB5      ----------------------ISVTAEDKDPKLARDIANATAD----------------
C2SBU5      ----------------------ISVTAEDKDPKLARDIANATAD----------------
C2SSX9      ----------------------ISVTAEDKDPKLARDIANATAD----------------
G9QCG2      ----------------------ISVTAEDKDPKLARDIANATAD----------------
Q2BFS6      ----------------------LAITVQDPDPNMAADIANTTAN----------------
I3EBB4      ----------------------VNISVQDPDPYQAAKIANKTAE----------------
A4ITF4      ----------------------FSVTVQDPDPAMAAKIANKTAE----------------
C5D962      ----------------------FSVTVQDPDPAMAAKIANKTAD----------------
G8MZ94      ----------------------FSVTVQDPDPAMAAKIANKTAE----------------
Q5KUM4      ----------------------FSVTVQDPDPAMAAKIANKTAE----------------
G5SDT9      ----------------------M-----GRHNEMVKVTTFTRPE----------------
G5LQM7      ----------------------M-----GRHNERVKVTTFTRPE----------------
G5Q4J1      ----------------------M-----GRHNERVKVTTFTRPE----------------
B1V0N8      ----------------------LEISYRSYNKEEVDQIIKVMTD----------------
B1BNK2      ----------------------LEISYRSYNKEEVDQIIKVMTD----------------
B1R3X7      ----------------------LEISYRSYNKEEVDQIIKVMTD----------------
Q8XN77      ----------------------LEISYRSYNKEEVDQIIKVMTD----------------
B1HR40      ----------------------VNIRVQDEDEARAVKIANTIAE----------------
G2Z8Q4      ----------------------ITIKVTDSSAEKATLIANKVTT----------------
F8FCE3      ----------------------MTLVIRDTDYRRAAETVNAISY----------------
I0BSG5      ----------------------MTLVIRDTDYRRAAETVNAISY----------------
A8YPQ6      ----------------------INIQVKSGHKQDSEKIANSFAK----------------
P95695      ----------------------INIQVKSGHKQDSEKIANSFAK----------------
Q2G1K8      ----------------------INIQVKSGHKQDSEKIANSFAK----------------
C5QNG5      ----------------------LNVGVRSKSEKESEKIANDVAK----------------
Q4L9H8      ----------------------LNVNVESKNKKDSEKIANEIAK----------------
Q2FUV1      ----------------------ITVSVTTGNKSESDKIVNKISK----------------
P39850      ----------------------LNIDVESKSGSNSEKIANKIAE----------------
D7UYE3      ----------------------LNISVRSNSRATSKKVANEVAK----------------
Q4A121      ----------------------LNIAVENESREAAGKVANEIAN----------------
E3HB17      ----------------------IKISYTDINARKATLMVNEVSK----------------
C9AAE4      ----------------------IEINAYHQSPKIAAEIANTTAS----------------
H7F6C7      ----------------------IDISVEHPDPKVAARIANATAR----------------
F0SX23      ----------------------FAVSVTAANPDEAAQIANTIAG----------------
Q38VG4      ----------------------FSVTAKADNAYTAADIANMTAT----------------
F2I4B6      ----------------------FSIIVNDPNPERAATIANTTAE----------------
Q8RBS6      ----------------------IEISVRDNNPERAAEIANAIAS----------------
D9SR42      ----------------------MTIRFSSKDPELAAKITNQWAA----------------
D9SVC8      ----------------------MTIRVTLRNPEEAALIANQWAL----------------
E7RG09      ----------------------LTIFVTDPDPAVAVGIANKVAE----------------
D4G2E2      ----------------------VNISVRDENAETAAHIANTIAS----------------
Q8EME7      ----------------------VTVTATDPDPLLATDIANTTVQ----------------
D6Y035      ----------------------VTISIEDTDPSMAVSKANATAE----------------
Q5WBB3      ----------------------VTITVESESPADATLLTNSIAT----------------
Q9K6Q9      ----------------------VNITVKHEKPAMAVAIANEIAL----------------
Q97EP7      ----------------------IDITANAKSPEEAADLANDFSD----------------
Q97ER4      ----------------------IDITANGKSPDKAADLANDFSD----------------
E4S7Y7      ----------------------LMINIESKDPKYAALIANKLAE----------------
E4Q5T6      ----------------------LMINIESKDPKFAATVANKLAE----------------
E4SDX3      ----------------------LMINIESKDPKFAATIANKLAE----------------
G2FWX3      ----------------------LEITVSNTTPELAASIANEVAQ----------------
G7WJV2      ----------------------LEIRVRNTSPEQAAAIANTMAQ----------------
G7W774      ----------------------LEIQVLNTDPQLATAIANTMAS----------------
G2FM60      ----------------------LEIQVTNTNSELAALIANTMAQ----------------
H5XZD5      ----------------------LEIQVSNTNSELAASIANTMAQ----------------
I4DBG9      ----------------------LEIKVSNNDPKLAASIANTMAK----------------
G2FWT7      ----------------------LEIQVSNTDPKLAASIANTMAQ----------------
H5XZG8      ----------------------LEIQVLNKDPELAADIANSMAN----------------
G0V448      ----------------------MDIKVQSKDPKDAMITANTLSQ----------------
A0PZ01      ----------------------MDIKVQSKDPEKARKIAETLTP----------------
B1B737      ----------------------MDIKVQNKDPERARKIAETLTP----------------
D9ST43      ----------------------IEFKVQNENPQEAYRILNAVCN----------------
H7F5T7      ----------------------INITATTDSPEEAAKIANITAK----------------
G9WIR0      ----------------------FSISARSNDPVESRDIANMTAD----------------
D3LB11      ----------------------FSIAVRSTNSQESKDIANETAS----------------
A0NKF7      ----------------------FSIAVRSTSSQEAKDIANETAS----------------
Q04DV7      ----------------------FSIAVRSTSSQEAKDIANETAS----------------
F6BI63      ----------------------INISVKDNDPKIAADIANAVAG----------------
G2MWC1      ----------------------IEISVENSDPSKAAEMANAIAD----------------
B0K4N2      ----------------------IEISVKNSDPRKAAEIANAIAD----------------
C7ISF8      ----------------------IEISVKNSDPRKAAEIANAIAD----------------
B0KAR6      ----------------------IEISVKNSDPRKAAEIANAIAD----------------
E8UV30      ----------------------IEISVKNSDPRKAAEIANAIAD----------------
C0GGR6      ----------------------ISISVSDNSPDRAAFLANSVAN----------------
A4J8V1      ----------------------IQITVEDIDPERAARLANFTAV----------------
C8VYQ7      ----------------------ISISIEDASPDKAARLANISGQ----------------
C8W5K3      ----------------------INITVVDPNPNTAAHLANITSR----------------
B1BNH4      ----------------------LDLSFKGGNPKEVLKLTEALTN----------------
B1V1Z3      ----------------------LDLSFKGGNPKEVLKLTEAITN----------------
B1R3V2      ----------------------LDLSFKGGNPKEVLKLTEALTN----------------
Q0SVR9      ----------------------LDLSFKGKNPKEVLKVTEAITD----------------
Q8XN47      ----------------------LDLSYKGGNPKDVLKVTEAITS----------------
G7M0Q2      ----------------------LEIKYVNQDKVIAKNILDSITN----------------
G7M565      ----------------------LEISYISPHKSEAGDVVKTVTD----------------
A6M2M0      ----------------------LEISYVSANQALAGDVVNSVTN----------------
G7M1R8      ----------------------LEIKYVSKNKNQSEEILQAISD----------------
A5V0I4      ----------------------MIVQVDYPDPATAQRLADAIGN----------------
A7NQ70      ----------------------MIVQVDYPDPATAQRLADAIGN----------------
Q4JZ56      ----------------------ISISVTNTNSDEAARIANGIRK----------------
Q7X554      ----------------------ISISANAKTGQDAQTLANKVRK----------------
Q7X550      ----------------------ISISVKAKTGQDAQVLANKVRE----------------
Q7X562      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q7X556      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q7X552      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q7X558      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
C5NWJ9      ----------------------ISITVRDKDPQVASDLANTVKE----------------
F3A498      ----------------------ISITVRDKDPQVASDLANTVKS----------------
Q9AHD3      ----------------------VSISVNDRVPEEASRIANSLRE----------------
Q4K2E2      ----------------------VSISVKDKQPEEASRIANSLRK----------------
Q4K2F8      ----------------------VSISVKDKQPEEASRIANSLRK----------------
Q4K046      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K0R8      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JYY0      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JZW8      ----------------------VSISVKDKQPEEASRIANSLRE----------------
I0J9C8      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K0M4      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JZS4      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JZK2      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q9AHA5      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q9X9A0      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JYK9      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K006      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JZG8      ----------------------VSISVKDKQPEEASRIANFLRE----------------
A6YIA7      ----------------------VSISVKDKQPEEASRIANSLRE----------------
E5F5C4      ----------------------VSISVKNKQPEEASRIANSLRE----------------
Q9AHB8      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4JZL8      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K1B8      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q8VU32      ----------------------VSISVKDKEPEEASRIANSLRE----------------
D2ERX9      ----------------------VSISVKNKQPEEASRIANSLRE----------------
G6C7Z0      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K2A9      ----------------------VSISVKDKQPEEASRIANSLRE----------------
D6ZQI7      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q9ZFT9      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K255      ----------------------VSISVKDKQPEEASRIANSLRE----------------
F9HJP7      ----------------------VSITVTNGDPNQASRIANTLRE----------------
E8JWI4      ----------------------VSITVTHADPAEASRIANTLRE----------------
A8AZR4      ----------------------VSITVKNSDPNQASRIANTLRE----------------
D0RXH3      ----------------------VSITVKNSDPNQASRIANTLRE----------------
Q83YR6      ----------------------VSITVKNSDPNQASRIANTLRE----------------
F1Z125      ----------------------ISIAVTNHDPQAAKDLANSVRD----------------
Q3K0S9      ----------------------ISISVEDANPKMSQKLANSVRE----------------
P0C0T8      ----------------------ISISVEDANPKMSQKLANSVRE----------------
Q67AY5      ----------------------ISISVEDANPKMSQKLANSVRE----------------
Q04662      ----------------------ISISVEDANPKMSQKLANSVRE----------------
Q8GP93      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q8GPF7      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
E3CP61      ----------------------ISISVSAKTGQDAQLLANKVRE----------------
E8KUY7      ----------------------ISISVSAKTGQDAQLLANKVRE----------------
C2LSE5      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
E9DM16      ----------------------ISISVNAKTGQDAQSLANKVRD----------------
I0QIK5      ----------------------ISISVNAKTGQDAQSLANKVRD----------------
Q7X560      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q8GMA6      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q55204      ----------------------ISISVNAKTGQDAQTPANKVRE----------------
Q8GPC4      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
Q8GPA9      ----------------------ISISVNAKTGQDAQTLANKVRE----------------
G6ERT2      ----------------------ISISVNAKTGQDAQTLANKVRK----------------
O87930      ----------------------ISISVNAKTGQDAQTLANKVRK----------------
Q8GP55      ----------------------ISISVKAKTGQDAQVLANKVRE----------------
F8HDC4      ----------------------ISISVKAKTGQDAQVLANKVRE----------------
F8LJ76      ----------------------ISISVKAKTGQDAQVLANKVRE----------------
F8LXJ5      ----------------------ISISVKAKTGQDAQVLANKVRE----------------
Q1WCR2      ----------------------ISISVKAKTGQDAQVLANKVRE----------------
G3G7C0      ----------------------VSISVRDADPNEAARIANSLRT----------------
G3G7J8      ----------------------VSISVRDADPNEAARIANSLRT----------------
G8DU30      ----------------------VSISVRDADPNEAARIANSLRT----------------
A4VTU2      ----------------------VSISVRDADPNEAARIANSLRT----------------
D5AGQ4      ----------------------VSISVRDADPNEAARIANSLRT----------------
Q9X4U6      ----------------------VSISVRDADPNEAARIANSLRT----------------
G3G7G5      ----------------------VSISVRDADPNEAARIANSLRT----------------
G7SG35      ----------------------VSISVRDADPNEAARIANSLRT----------------
G8DU06      ----------------------VSISVRDADPNEAARIANSLRT----------------
G8DUA9      ----------------------VSISVRDADPNEAARIANSLRT----------------
G8DTY9      ----------------------VSISVRDADPNEAARIANSLRT----------------
G3G7I7      ----------------------VSISVRDADPNEAARIANSLRT----------------
G3G7J3      ----------------------VSISVRDADPNEAARIANSLRT----------------
E0PD82      ----------------------ISISVEDTDAQEAADIANAVRE----------------
F5X651      ----------------------ISISVEDTDGQEAADIANAVRE----------------
G5JTD6      ----------------------ITIAVQDRSPQEASRLANAVRE----------------
Q2KM75      ----------------------ISISVNNHEPQKAKDLANAVRE----------------
G5KAJ3      ----------------------ISISVTNHHPQEAKDLANSIRE----------------
B9DUJ5      ----------------------ISITVTNHDPQQAKDLANSIRE----------------
G5KD12      ----------------------ISISVTNHDPQQAKTLANSVRE----------------
E8JMT8      ----------------------ISISVEDTDAQEAADIANTIRE----------------
F5X0J8      ----------------------ISISVEDTDAQEASDIANTIRE----------------
H2A601      ----------------------ISISVEDTDAKEASDIANTIRE----------------
E7S8W2      ----------------------LSITASDPDPQEAARIANGLKD----------------
F8DFF5      ----------------------LSITAKDGDPKEAARIANGLRN----------------
I1ZPH8      ----------------------LSITAKDGDPKEAARIANGLRN----------------
E3CBR9      ----------------------LSITAKDGDPKEAARIANGLRN----------------
E8K787      ----------------------LSITAKDGDPKEAARIANGLRN----------------
F9M365      ----------------------LSITAKDGDPKEAARIANGLRN----------------
A3CQY3      ----------------------VSITVKDDNPEEAARIANAFRN----------------
E8KLZ0      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F0FHA9      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F0FQQ4      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F0I4H6      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F0IAY2      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F0IJI1      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F0IS52      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F2C9N1      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F2CH54      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F3UDW8      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F3UNJ5      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F3SM33      ----------------------VSITVKDDNPEEAARIANAFRN----------------
F9HC66      ----------------------VSIVVKDDQPEEASRIANALRE----------------
E1LQJ6      ----------------------VSITVKNAQPEEASRIANALRE----------------
Q4JYU0      ----------------------VSITVKNAQPEEASRIANALRE----------------
Q4JZY2      ----------------------VSITVKNAQPEEASRIANALRE----------------
F9Q346      ----------------------VSISVTDRAPEEASRIANSLRE----------------
Q6L5R1      ----------------------VSISVTDRAPEEASRIANSLRE----------------
E9FEC6      ----------------------VSISVTDRLPEEASRIANSLRE----------------
E0Q2S9      ----------------------VSISVTDRLPEEASRIANSLRE----------------
F5VSH0      ----------------------VSISVTDRLPEEASRIANSLRE----------------
A5YTV6      ----------------------VSISVTDRVPEEASRIANSLRE----------------
Q6L5T1      ----------------------VSISVTDRAPEEASRIANSLRE----------------
E0PPH8      ----------------------VSISVTDRAPEEASRIANSLRE----------------
A5YTT8      ----------------------VSISVTDRAPEEASRIANSLRE----------------
E6KKR9      ----------------------VSISVTDRAPEEASRIANSLRE----------------
A1ILY0      ----------------------VSISVTDRAPEEASRIANSLRE----------------
F2QF91      ----------------------VSISVTDRAPEEASRIANSLRE----------------
Q4K0I3      ----------------------VSISVKDKQPEEASRIANSIRE----------------
Q8KWQ1      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K238      ----------------------VSISVKDKQPEEASRIANSLRE----------------
B1I966      ----------------------VSISVKDKQPEEASRIANSLRE----------------
G6J8A3      ----------------------VSISVKDKQPEEASRIANSLRE----------------
F9LZC3      ----------------------VSISVKDKQPEEASRIANSLRE----------------
F9P1W9      ----------------------VSISVKDKQPEEASRIANSLRE----------------
A5LJR9      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q9ZII7      ----------------------VSISVKDKQPEEASRIANSLRE----------------
Q4K1K7      ----------------------VSISVKDKQPEEASRIANSLRE----------------
E1LPE6      ----------------------VSISVNNRVPEEASRIANSLRE----------------
F9MJW6      ----------------------VSISVNDRVPEEASRIANSLRE----------------
Q4K0V3      ----------------------VSVSVSDRVPEEASRIANSLRE----------------
Q54519      ----------------------VSVSVSDRVPEEASRIANSLRE----------------
C1CBD0      ----------------------VSISVNDQVPEGASRIANSLRE----------------
Q7WVX1      ----------------------VSISVNDQVPEGASRIANSLRE----------------
Q4K0E2      ----------------------VSISVNDRVPEEASRIANSLRE----------------
Q9AH96      ----------------------VSISVNDRVPEEASRIANSLRK----------------
A5M4L2      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
B2ILP4      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
C1CCB8      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
P72511      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K1S8      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
P96474      ----------------------VSVSVSDRVPEEASRIANSLRE----------------
Q4K196      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K0Z7      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4JZ85      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4JYH6      ----------------------VSISVNDRVSEEASRIANSLRE----------------
Q4JZ19      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K0A1      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K1M5      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K2Q8      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K1G0      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K0T6      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K0K3      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
Q4K0X6      ----------------------VSVSVNDRVPEEASRIANSLRE----------------
E8KDN1      ----------------------VSISVKDGNPEEASRIANGLRE----------------
F9PEU3      ----------------------VSISVRDGKPEEASRIANALRE----------------
E8K321      ----------------------VSISVRDGKPEEASRIANALRE----------------
F9PZP6      ----------------------VSISVRDGNPEEASRIANALRE----------------
D6R2T7      ----------------------VSITVKNKSPEEAARIANSLRN----------------
F3UUQ1      ----------------------VSITVKNKSPEEAARIANSLRN----------------
E6IZC3      ----------------------VSIAVSDGDAKEAARIANSLRQ----------------
G6A746      ----------------------VSIAVSDGDAKEAARVANSLRQ----------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      SVKKLDAQIKQLEDEDKNNNGN--------------------------------------
E9TE87      SLAF----LAQQLPEVRSRLDVAENKLNAF------------RQDKDSVDLPLEAKAV-L
E6PYQ4      ISRY----LTTRLESLESKIQNEQNELMTSGLKLGIIDIGSGSSSTSGT-SSIGTSTL-V
C0QCJ1      TSEF----LDAELEKTRKKLVDREEQLSSY------------RAKNMGG-LPDELDSN-L
I5B297      TSEF----LDSELEKTKKRLEEKEQKLAAF------------RAKYLGG-LPDELESN-L
B8D0N1      ARNY----VARQLEKVSRDLKNIEAEVRHY------------KEENKSL-VLSNFTQK-I
D9QTC7      AAGF----VSKQLKEVKTRLANLEEKLLEY------------KKEHDVI-LPEKQGED-L
C7LPS4      ATRF----LSEQIESFKKRLDAVEDEINQY------------RAEHGLQ-LATDETTI-R
Q314L4      ATRF----LADQIEVFRKRIEAVQAEIDSF------------KASRGQI-LNMSEPAL-R
G0VNK5      TREF----LEQRLGASKDELSQAEDKLQQY------------QAANKMY-STDDQMKQ-L
D2RIR1      TREF----LEQRVKSSKKELDDAETKLKNY------------QVKHKIF-STDNQMKS-L
I0GRR3      TRAF----LEERVESSKKELSDAEDKLQKF------------QVENKLF-STQDQIKQ-I
Q39U16      ADRF----ISEQLKTFKDKLDESENKIVAF------------RQKRGVS-VGIDEALL-V
F0JCB9      ATRF----LADQIEVFKKRIDEAKKEIEDY------------KVASGKV-LTTNEYAV-R
G7QCG0      ATKF----LAEQIETFKKRVDAADEAINAF------------RSERGML-LSSDGAFI-R
I2Q342      ATKF----LADQIETFKKRVDTADEAINAF------------RSERGMI-LSSDGAFI-R
Q74BQ7      AIKF----LSEQIDTFRGKLEEAEGELNRY------------KTEKGGV-IAIDEAKL-F
B5EA80      ATKF----LSEQIDTFNAKLQKVESEVNAY------------KRDKGGV-IAIDEGKL-F
C6DZX6      ATKF----LSEQIDTFNEKLQKAENEVNAY------------KRDKGGI-IAIDEGKL-F
A1ARV9      ATKF----LGEQIDTFREKLEKAEKELNDY------------KRDKGGV-IAVDEAKL-F
E8WSZ4      ATKF----LSEQIQAFNRKLQSAEAEVNAY------------KRSKGGV-ISIDEGKL-F
A5G425      ATKF----LSEQIEVYKEKMDKAEAEVNNF------------KIGKMGV-IATDPATL-Q
B9M2X7      ASKF----LSEQITVLKEKMDKAEAEVSRF------------RMEKGSV-ATADPAAL-E
C2MBF7      TIATPIGQVVVEATPYYSNFPSYEVLKVQK------------ENFHSIVDSYMRSLQVSL
H8YYB8      TTAF----LQKELAKLTDKLSLLEARLAQF------------KEEHGQSLPELKSLNMQL
B7B948      TSNF----INDRLIVIEKELGDVDSDIESY------------KREH--------------
G8AU95      VNQW----LGGRLIEAREAVRGAEEAIRSF------------RKEN--------------
G5IFS2      IVEE----GYVPTRQTSPSLVKNTAIGGMA------------GLFLAAV-IVLAVFVM--
F0G6H6      LIRF----MDAQLPQLKAQLEAAEGRFNAY------------RASH-------GSVNT--
A3W0H6      TFDF----FSAEETRVSARIAEVEGVIADF------------KRANAES-LPTSITPV--
A3K8W6      TLAF----YQTEEARVDAEIVALEDRIADY------------KKANSAQ-LPAGVAAL--
Q0FMP1      TLAF----FESEEARVETEIEAMEAKIATF------------KRENAEA-LPSGTGAL--
S9QRP2      TLEF----FEKEEARIGAEISEQESRLADF------------KRANAEA-LPGGITSL--
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
E9TE87      DSM-----VNIDAQLNELTFK---------------------------------------
E6PYQ4      VET-SGLLDQRVKAQADLYLAEAEYQNLLVHPDAVPPIDVPGSLEMSS-----LVTSLST
C0QCJ1      RTL-DRLQLQLTDKQAMLRDAKNAINTLSAQIAQASKMGSQGMDDQ----FDFSDFGEEV
I5B297      RTL-DRMQKQVTDKAMLLREVNNSISQLDSQISSMAATGGSGSGGDDFLSFDFDDSQE--
B8D0N1      MQSMLDLEENLAEVEINIKTHRAALNHLYNKLQSSRELILSSKTLSKNPAYTELKNRLTE
D9QTC7      LEKLTKLETAKSKAEVELKQAEAGLKEVRANYNDQDKDIISARTIAQNPMVQKYKEQLSN
C7LPS4      FEI-----ADAERKLEAIRARKLELETKLQLMPS------GGG----------RSAHLAD
Q314L4      REI-----QMAQEELQALRIRKTDLLAQRGVMLR------N-----TP-----LRNRLET
G0VNK5      TDKLNIVDKAKAENQLNLETAQAGLNSVNEQLSS------AGVSIADSPAIQQYKTQLAQ
D2RIR1      AERITDLDKAKAQNKLDMETAQAALGSINDQLAG------AGAALADSPSIQQAKNKLVD
I0GRR3      TDKLSIIDKEKAANKLNLEQAQAALGTINGQLDN------SGRGIADSAALQQYKVQLAQ
Q39U16      NDI-----RQYQGELDSMRIKRNELTATRDALRR------QL----KS-----IKPTTVA
F0JCB9      REI-----EKGEDQIKDIDIRISTLESSRTMLLS------N-----SP-----SRSRLRQ
G7QCG0      SEI-----KAAEQKLEELSLRRAQLEAQRKMLAS------GK----GP-----AKASRAS
I2Q342      SEI-----KAAEQKLEELSLRRAQLEAQRKMLVS------GKGPARGP-----AKAGRAS
Q74BQ7      EEI-----NVAQQKLYDIQLRRRHLEGLRPVTRK------AG----DP-----LQVKLVA
B5EA80      QEI-----NVAQQKLYDLELRRHQLEGMRQITRR------TG----DP-----LQSRLAG
C6DZX6      EEI-----NIAQQKLYDLELRRRQLEGMRQITKR------TG----DP-----LQNRLAG
A1ARV9      EEI-----NVSQQKLYDLELRRRQLEGMRRVTRK------SG----DP-----LQARLSA
E8WSZ4      EEI-----NTAQQKLYDLELRRRQLEGMRLVTRK------AN----DP-----LQAKLAS
A5G425      KEI-----NDAQQKIDDMRLKRAQLESLRIQIKK-------N----NP-----LQQKMLS
B9M2X7      REI-----SGAQQRIDEIAFRKAQLEASRNQLKK-------H----NP-----AQMRLQT
C2MBF7      QQKDASVIKLTMQSSNPQLAEDFLSTLILV----YTELEREDKVKVAESTQRFVDDRLAI
H8YYB8      IQRSEDQLRDTEQSIRTLVERKIYLEGQLAQIDPYSELFSADGRRVLGPA-----DRLKA
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
E9TE87      -------------EAEISKLYTKVHPAYRTLL------EKRQALEEEKAKLNGR------
E6PYQ4      A------------NGQLASIEQRYGSNYPGLG------QVQAQVKSYEHDIADLHAKLLQ
C0QCJ1      GMGGEDEATLAEAEKRLDAMLLRYTRQHPDVR------RLEAVIEKLRAKIEAAQAQEAA
I5B297      ----GDDSALQAAQEKYDALLLRYTEKHPDVK------KLKRIIEKLKQNLEAAKEE---
B8D0N1      L------------EIELDSLTTVYTDKHPEII------KLKAEKKSILNEISNTLGEVIT
D9QTC7      L------------EVELTGLKESYTDNHPKVI------ATNRKIDEVTKRLNETVEEIVR
C7LPS4      M------------ERQLATLLTAYTDQHPKVV------RLQGQIRAVKSSPSGGMTGNSG
Q314L4      L------------EAQLAAMLVSYTEKHPAVI------RTKQEIEGLRREVARKGEEERK
G0VNK5      L------------EATKASYVGKYTDEHPKMQ------EINNQINSTRDSLNQEISKIVS
D2RIR1      L------------ETQKAGYTGKYTSENPKMK------EINRQIGAARYSLRKEIQAIIA
I0GRR3      L------------AAEKAGYTGIYTEDHEKMQ------AVNQKIANVQASMEKEIGSIVA
Q39U16      LSSRENSSEVEMLERRLKQLSANYTDNYPEVI------RIKSIIASLKKKQEPGHQADTG
F0JCB9      Q------------EQLLDDMLARYTENHPRVR------QLENAIAETKRQIAHNSEEELS
G7QCG0      SGGNPR-------EAELRRLLAVYTEKNPKVI------KARAAAKAWRPS---GGGGGES
I2Q342      SGGNPR-------EAELRRLLALYTEKNPKVI------KARAALRAWRPSGGGGGGGGES
Q74BQ7      L------------QKQLEELRVSYTDSYPEVL------RVRGEIETLKEQMKNRSPQ-QE
B5EA80      L------------QKRLDELLVEYTDSFPEVV------KVKGDIETVKAQISERRGQ-PS
C6DZX6      L------------QKRLDELLVEYTENFPEVV------KVKGDIETVKAQLSARRGQ-QS
A1ARV9      L------------QRRLDELRVQYTDSYPEVL------QIKGDMETIRAQLKTR-GT-TF
E8WSZ4      L------------QKRLDDLRVQYTDSYPEVL------TVKGDIETVKEQMKLRKGA-AS
A5G425      L------------QKKLDEMLVEYTESYPEVI------RVKTELQAVKEQLRNRNTGFDM
B9M2X7      L------------EKKLEEMRVEYTDRYPEVM------RLKSEIESVREQALASSGQARL
C2MBF7      I------------SSELGQVDAEI-----EGF------KQSQQIADIQAEAQEYIKGRSE
H8YYB8      L------------EAEYATVAARYSSQHPERM------RIEREIATLRQQVGQSANARAE
B7B948      -----------------------------------------------QLTD---------
G8AU95      ---------------SLLELPPDGRNMVQQQM-----------------NE---------
G5IFS2      -------------NDTIKTPEDVEKYLQLNVLGTIPVFEVDDGKKGRKGKK---------
F0G6H6      -------------SDEALALRQQSVDIETRIL------TLQ----QQRQEL---------
A3W0H6      -------------REELRTLNETLLALDQQII------TLETEASRQRQEV---------
A3K8W6      -------------RTELTTLRETELDLSQEII------TIQGDTARKRPED---------
Q0FMP1      -------------RSQLTTLEDSQLALARDIV------EMEGNSTRQREEV---------
S9QRP2      -------------RSQLVTLEENELELDREIV------ALRTNSARQREDV---------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ---------------------------------------------------------SAK
C0QCJ1      ---------------------------------------------------------ETL
I5B297      ---------------------------------------------------------EEL
B8D0N1      ---------------------------------------------------------STI
D9QTC7      ---------------------------------------------------------SKT
C7LPS4      ---------------------------------------------------------AAA
Q314L4      ---------------------------------------------------------IIY
G0VNK5      ---------------------------------------------------------QQA
D2RIR1      ---------------------------------------------------------QKA
I0GRR3      ---------------------------------------------------------RQA
Q39U16      ---------------------------------------------------------AKE
F0JCB9      ---------------------------------------------------------LIY
G7QCG0      ---------------------------------------------------------AGE
I2Q342      ---------------------------------------------------------AGE
Q74BQ7      ---------------------------------------------------------TVV
B5EA80      ---------------------------------------------------------QPL
C6DZX6      ---------------------------------------------------------QSL
A1ARV9      ---------------------------------------------------------QPL
E8WSZ4      ---------------------------------------------------------QPL
A5G425      ---------------------------------------------------------SPA
B9M2X7      ---------------------------------------------------------GGA
C2MBF7      IKTRLVELNNSISIAQFVRGHLKDKNQMEALIPANVGIASPAIEAAIAKYNELLLKRDQL
H8YYB8      LERSLKEQQEELA-------GLRERYSTE----------HPDVKAQTGAIAITQRQLAQA
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08