BYKdb

Dataset for cluster tadcd of phylum metagenomes

[Download (right click)] [Edit] [Sequences] [Repertoires]

43 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A644ZI62      ---------------------------------------MELTLLDYL-SLLRKYWRSIA
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ---------------MFTGCGQGTAESRIDLLMPASVADQTNGIRDAIAVARRRKWL-IL
A0A6J6U1T4      --------------------------------MPTAIAESTNGIRDALAVARRRKWL-IL
A0A6J7LYN9      -----------------------------------------MTLRDYWQVVVRRRWL-VL
A0A1J5RCY3      -----------------------------------MQGQALVELHDYL-TIVRKRWVSIL
A0A1J5RUE5      ---------------------------------------MPVELDEYV-LALRKRWLIIA
A0A3B1C250      --------------MPGYNKDENSGGYVEPYQNSSDADGDEINLSEYWYTIKRNKWG-IL
A0A0F9JKD8      ------------------------------------MQQQEIHLRDYFRILRKRRHV-VL
A0A0F9XPI6      -------------------------MTETPFNLDYDQKQDRFDLGEILKKYIKYWPW-FA
A0A3B1AK25      ---------------------------MQENKAQQPLEEDEIDLREYWRVIMRHKSS-IF
A0A2H9TBF4      -----------MQQSTDVSAQGT----------AASQDEDIIDLRSLFTTLFHYRWA-IL
A0A0F9KY21      --MVKLMNSKPIAPTND----------------QNKSSAQEIDLLALLGTLLDRKYF-IV
A0A0F9VQU4      --MTESVAIEPMSDLSQ----------------KSLPE-ETIDLSRLFGALFRKKWL-II
A0A0F9W5Q6      ---------MQTTSAPT----------------ANETS-DEIDLLALLGALIDHKLT-II
A0A2H9T6C5      -------MPNEMTQSRP----------------TVADD-DVISLSEILDILIKGKWW-IA
A0A1J5SM24      --MESPEKQQTPSKSSNYGGYAGYGAPYGYGYGPSEGGAGQRTFQDYVLILRERAWY-IV
A0A3B1C7A9      ------------------MDNEF----------DNNIQEETHSIKDYFNLIRINIIP-IL
A0A1J5SPZ5      --MSDVPQQTPPPKPPPPPAAAR----------EEDEIVERRTLRDYYIILRERFWI-AF
A0A1W1DYN8      -------------MDTLINTSSN----------LSTDSNEEIDLQELFGTLVEKKWL-IA
A0A1W1E4Z5      -------------MDTLINTSSN----------LSTDSNEEIDLQELFGTLVEKKWL-IA
A0A0F9UWR4      ---------MNSSIRPDRQWQPM----------PSDDDTDYIDLKKIWYAIWSRKWS-II
A0A0F9U8M8      --------MNTSSNTFLET-------------------NNTLDLKRYLHACMEYKWR-LI
A0A381Y0U7      -----------MDKIPSTEQSLP----------STEQSSDKLHILDYWRIIRVRFVV-IL
A0A381Z3K5      -----------MDKT-------P----------STDQSSDRLHIMDYWRIIRVRFVV-IL
A0A0F9LFA5      --------MNQTNENLSNN-------------------EEIIDLGSYLNVIKRAKWR-IL
A0A160TC29      --------MNNAAA------------------------VEVIDLTHYWHVIRRQMRK-IM
A0A1J5R1Y0      --------MDTPTANPAHTTIQG----------AAQLSEEKLELLTYWRTFVKHKLT-IF
S0DG33          -----MDDYPMNSLYPAASTERG----------QLSASGMLTLMRD-------HIWE-IV
A0A380TGM5      ---MQMDRPNLTPAYPSVWAAER-----------------SYDIRELTRIVRRRKSI-VI
A0A380TDI0      ------MDQRLTTATQSEPAEPR----------RRPLAALDSELRETIRSFWRHKWA-IL
A0A380TDN3      ------MDQRLTTATQSEPAEPR----------RRPLAALDSELRETIRSFWRHKWA-IL
A0A3B0VME9      MNNQTEPIDNAGEDRQTMVPAGDTHLPSTRVHEIMPPVEEEINLRDYLDVILRRRWV-II
A0A3B1DSR1      ----------------------MNTQNNLSEFDQTGLTESSGFEIDLLSLASRHWKL-LL
A0A0F9I1G8      --------DLPIAPAPVRRDNEEMLPSTEFRQAAPDWEGEEVHLRDYLEVIARRKWL-IF
J9FGR8          --------------------------MTDQKKLAQNAANEFAWVTDLWGMFAPRWIW-FL
A0A0W8FS74      ----------------------MTPNVSIPPSQPLLRSGENAHIYDYLSVILRRRKL-FT
A0A3B0V744      ---------HDYPLNFGVKIMVQFNQNIGNNPPALEEENHDIDWIKLRLILRKGIPW-FI
A0A644WNK5      ---------------------MSQQEELQNTLAPYDSGEEGISIAELLHIFRKRFRW-FV
A0A1W1D4H7      ---------------------MNTMDNKYN-----DEFDDEIDLRELYKTLLKHKIS-IF
A0A3B1CUQ0      ---------------------MSQLEHT-D-----DVEEREIHLNDYIEVLLRKKWI-VI
A0A1W1BK27      --------------------------MQNI-----QIEEDEIDLSQLFSTLKKNFFT-IV
A0A1W1CD04      ----------------------------MN-----EIEEDEIDLRELIDKLKNSLTT-IV
                                                                            

A0A644ZI62      AITLVAISLAATYCLLVQPTYTSKASLFFS-VNS--ANSASDLNAGSSYAESQVQSFAKV
T0ZG59          --------IALILTLLATPIFRADTTLQIN--RD--TVNVVQVQGFQPVESLNDQTFYQT
A0A6J6XYC8      SCVVTVVLTAVVATSLQTPRYKAESDLLIR---Q--GSSSALLNPEVAQSAQNARPLMEN
A0A6J6U1T4      VCTVTVVLTAVVATSLQTPRYKAESDLLIR---Q--GSSSALLNPEAVQSAQNARPLMEN
A0A6J7LYN9      AGVVATLAAALIMVAAQTPVYEAEAQLLVR-SLP--GDS---VFQAQSASAANAARLIET
A0A1J5RCY3      VATALSLVVAIGVTLLATPTYQASAQVFVS-VNS--AGTTADLLQGSNYSQQQVASYTDL
A0A1J5RUE5      ALALVGAVTGWLYAHSMTPNYRATANVFVS-VNG--GGTAGELVQGSTFVQNSVESFAKL
A0A3B1C250      GLAFVATLIGVLTAFSMKPIYRASVTILIE------PEQPKFVSVIPMESGSNINYFYAT
A0A0F9JKD8      TFFFITLALVILFTFTASPLYKADTRLLIEKSEQ--------YTITEYGFTVYDPEFYST
A0A0F9XPI6      ASFLLTLAFAVFYLLSTAKIYESVAKIKIV----DNSTDIGLQSNAMSLFTNGSTINLDN
A0A3B1AK25      GLAFLAAILSALVVFAMKPIYSSTVTLLIE-PGS--ANVVSIEDVY---GDSDTSTYYKT
A0A2H9TBF4      GFTLIVTLLTVLVVFSITPKYQATAVLLIE-QEQ--AKVVSIEEV--YGIDGGGDSYLNT
A0A0F9KY21      LFTAVFAVIGVAVAIFSTPIYKATALIQVE-ESS--PSVPGLDDMA---GMFESSSEAVT
A0A0F9VQU4      GVTLLFAFIGIVHGMLSTPVYRADALVQVE-RRNTVSPFGNVDNVTGSG---SGELNTSA
A0A0F9W5Q6      ACTLVFAVCGIAYALLSTPIYQANAVIQIE-EKS--QGIGSLLGDAAGGEMFSSASAATT
A0A2H9T6C5      GATLFFAVCSLAYLWVATPVFQSDALVQVE-SQK--SPVGALVDMS---DMLGSESPSEA
A0A1J5SM24      AVFLVVFSTALIITLSKTKIYESSASVQIF-RRD--PVIMQTQAV--MDNEVRSAEDLNT
A0A3B1C7A9      LIGLTGLAVSVIYAFTARDIYTASTALKIQKPQA--GGILSSPLLP-EISDFGNDRFIAN
A0A1J5SPZ5      PLALLVSLGVGYYQSRQTPMYMSTATMQFE--KP--DRIVTTEGV--TNPAVQSEIDINT
A0A1W1DYN8      IITSIIFMASVFYVLIATPVYRADTVLQVE-DKS--NNMLNLSDL----TNFSASSPTST
A0A1W1E4Z5      IITSIIFMASVFYVLIATPVYRADTVLQVE-DKS--NNMLNLSDL----TNFSASSPTST
A0A0F9UWR4      SLVVVVSMLATLAVMQMTPVYRASTTMMIE-GKG--NQLVAFQQV--YDNTGQLNEYLQT
A0A0F9U8M8      FISSLISVIAAFVVMQIKPTYESTATLLIE-PEQ--KNVVSIDEM--YGFNTAKREFYST
A0A381Y0U7      LVFLITAVTTTVVTFLLPPTYMSLSRISVE-KET--SDIAPLLGMQ-SGPTAFDPYFIQT
A0A381Z3K5      LVFLITAVTTTVVTFLIPPTYMSLSRISIE-KDT--SDIAPLLGMQ-SGPMAFDPYFIQT
A0A0F9LFA5      GFATVVTLLAIMVALTLIPKYVATATLLIE-AEQ--TKAVSFDEI--YGLDSTKKEYYLT
A0A160TC29      ALSVIATIVAVLVALVMTPIYRATATLLIE-SEE--AKILSIEEV--YGLSGQSSEYFLT
A0A1J5R1Y0      SLALAVGILAAVVVYMMRPIYRATAMIQLE-DNN--AKVLSIEQV--YSSLAHGSEHVQT
S0DG33          VTTVVVLTLAVAYLLIATPIYSADVLIRVD-PPE--PNALGLALQD-QEALPPPAPAPVT
A0A380TGM5      GTVTLILALTVFFLSQLTPTYRAEALVIVE-SRK--ANIADLR-EI-LTDVSANQETTRN
A0A380TDI0      GVVVLLTGIAVLYVQTATPRYTAELQVVFE-NKT--GPLFDFQ-AA-VAGAPQDEASILT
A0A380TDN3      GVVVLLTGIAVLYVQTATPRYTAELQVVFE-NKT--GPLFDFQ-AA-VAGAPQDEASILT
A0A3B0VME9      LTLLVTFSLVAVFTFSSTPLFLAQGTLKAS-PRVASITSFKGIAQGMDESFMQSKEFIAT
A0A3B1DSR1      LGLIVGLVLGELYYRKAGPEYDATARILVE-KKVSVQLKDG---------DAKIYGDRAE
A0A0F9I1G8      GFLALVFISTLIFTLTATKIYKANAVIEAN-RDAPR----VTKFEEVTAALASAREFYQA
J9FGR8          ASVLLFMSGAVLYLMSTPAVYTRTASILIK-DDSKSGSSSNAMSEFSDLGIFKNNTNIQN
A0A0W8FS74      LAFCAVLFSVVLYTYFMKPIYEASSTLHIK-KEKGPGVLVDMNFD--------SSNSIDA
A0A3B0V744      TIFVLLILVAALYLRYTKPMYQSNSEIKLD-QEDQSNVLGLPQYE-----QSSNMGLLSS
A0A644WNK5      IGLVLVVGLAVGYLQIAVPQYESQVSVLVE-PIQRSSSFESLLD------VSASTTKIAT
A0A1W1D4H7      LITFLFFIGSLIFAYYKPNIYSSNMSLEIL-KENKGGMESSIALNQML--LGSDQVNLEN
A0A3B1CUQ0      SCFVVIVLATGIGTYLATPIYEATTSILID-DSKGGGQALFTELAGL-----PQTSEIPS
A0A1W1BK27      FITLFITSLVVVYSYFLPPIYSSDVKISFS-NEEKSSMSSLIPNALADF-TATTEKKLET
A0A1W1CD04      IITVLFMIGAGGYIYFSKPVYKSSVTISLD-SEKKSKLGDMLQDPFSQ--AGLGKERLKL
                                    :     :                                 

A0A644ZI62      ARTDIVLQPVIDKLGLATTPG---------------------------------------
T0ZG59          QYDLLKSHSLARRVVVAMDLQHDAAFQGLLRPSPLAR-----------------------
A0A6J6XYC8      ELGLARSLRVVEAATKELGFK---------------------------------------
A0A6J6U1T4      ELGLARSLRVIDAATKELGFK---------------------------------------
A0A6J7LYN9      EIRVLEGAPVEDRVRENLGVV---------------------------------------
A0A1J5RCY3      VTSPRVLIPVIEKLALGVRPE---------------------------------------
A0A1J5RUE5      ASMPVVLDPVIEDLQLDTTAK---------------------------------------
A0A3B1C250      QYKIIRSRSVAESVIDKLNLAEK-------------------------------------
A0A0F9JKD8      QYKIIKSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLL---------------
A0A0F9XPI6      QIEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKE---------------
A0A3B1AK25      QHEILESRLLITKVIAKLNLQEN-------------PEFLPDESE---------------
A0A2H9TBF4      QHEVLKSRALVEKVVKKLNLIDH-------------PEFNHALRE---------------
A0A0F9KY21      EIELLKSRSVIGEAVDSLKLDITAEPKLFPIIGGKFYIEFTAEKP--NDIAEPMLGASSY
A0A0F9VQU4      ELQILQSRMVLGQVVDRVSSDLIISPVQVPFIGGFVLRRGIPRPA--------FLQGYPH
A0A0F9W5Q6      EIELLKSRKVIGQAVDNLKLDIVAEPKLMPVIGSFFYRRFSPTSD--EPLANSFLGFDSY
A0A2H9T6C5      EIEVIRSRFVLGEVVDDLTLDIVAKPDYFPIIGQAVARRFSPDAEANEPLNSPWLWFSGY
A0A1J5SM24      QVKILESEAIIQKVADRLTGNDL-------------AMFKAPYEK-----DGA-------
A0A3B1C7A9      EIEILKSRRLRDIIASALIDSFNTVNNPDSFYVLLDHSFDLEDNG-----VK--------
A0A1J5SPZ5      NIEILKSDRLRERVIHSLTPEEV-------------------------------------
A0A1W1DYN8      EIEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNI-----TKD-NSRTGY
A0A1W1E4Z5      EIEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNI-----TKD-NSRTGY
A0A0F9UWR4      QIGLISSRGVAERVVRELNLVEH-------------PEFDPRQQD-----QPLIDIRGII
A0A0F9U8M8      QFEILQSKYIAEAVIEKLNLIKH-------------PEFNDEENN-----LFGLKA----
A0A381Y0U7      EFEKIQSQKVLDKVVTKCNL----------------------------------------
A0A381Z3K5      EFEKIQSQKVLDKVVAKCSL----------------------------------------
A0A0F9LFA5      QFEVIKSDSIAREVITKLNLKAH-------------TDFIAKPSV-----LGELKAT-VK
A0A160TC29      QFEILKSRELAKRVVLQLGLVDN-------------PEFNPYHEA-----NGK-------
A0A1J5R1Y0      QADILRSRTIAELVLTKLDLVHN-------------PEFSPGRDL-----T---------
S0DG33          EMAVMKSRSVLEPVIDKFRFDVSVTPHKVPILGDIAEKFATPGEP-----SAPWLGLKSF
A0A380TGM5      EIEVIRSRTLARRVIEQLGLAER-------------DEFTSS--R-----SRSLLEIASK
A0A380TDI0      EIEVIRSRKLADRVIKALQLDQD-------------PEFNGKLRP-----PSAFATFFKD
A0A380TDN3      EIEVIRSRKLADRVIKALQLDQD-------------PEFNGKLRP-----PSTLATFFKD
A0A3B0VME9      QVKLLKNEGLLIKLIKKMDLQDNILFVGKKDNDTGHGILGGVKEA-----FASLKNMIRP
A0A3B1DSR1      HIKLIMSPLIVNIAIENQNLDKLPSLLGEENPAGEILDT---------------------
A0A0F9I1G8      QVSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEF-----VRSLIP----
J9FGR8          ELLTLKSPELIAEVVSRLQLNETYT-VRQQLKRVDLYKHTPCLLI-----GAAQTD----
A0A0W8FS74      ELEIIKSRTNLEHVAKRLHLDWQVT-----------KKSKDLDFK-----LLDFSS----
A0A3B0V744      EMEIIQSRLFFNKVVETVNLNPQYF-TYGNILDDEKYLNPPFKVS-----YKILNA----
A0A644WNK5      EVELITSRKNIEYALGTLDLSSYHN-----------------------------------
A0A1W1D4H7      EKVVLQSRFIVQKALEKLDLDTKYYVINRFFKKIELYKDAPFDVK-----IISLDD----
A0A3B1CUQ0      QIELIKSRTIAEEVVRKLKYDQRVFDIS-----------GDLDPR-----VTNLQ-----
A0A1W1BK27      VKLTLETRKFINSVIKELDINQRYF-IEHNYRKDELYAFDNLEVS-----LNIHDDNFKE
A0A1W1CD04      AKVTLMSKKFIGTIIDKVDIAKEFF-IQRNFRKVELKNFSNLKID-----IKYNNN----
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      -------------------EGFADLVSKKKTGFIEEYLPASWFPEKREATEEEKKRRLIA
A0A0F9JKD8      --------------------------------------PGGGPEDEGADPEAAKRKLIVE
A0A0F9XPI6      -------------TSEELKKAQSLSVNFMANDIEVTDSNGNNFTLFYKQSENALKTSPFR
A0A3B1AK25      ----PLISIDWRAWIKELLPDNTIPEEPGIDEYEAF------------------NAELIK
A0A2H9TBF4      --------------------EPWYVSMMNWRQWLGLALPQDTVSGETI------LNRTID
A0A0F9KY21      AWGGEFISVFRFVVPKALEGEEFELLVKQNSQYELLNPNGDVVLNGTVGKDE--KDGFYE
A0A0F9VQU4      IWGDESINVARFTTLDSSRGRSFIVERGAGDSYHIMQGDS-RLGTGTLGQPEVFLDGELE
A0A0F9W5Q6      AWGGEQLKIFQLEVPRAYEGEELVLRAEENNGYTLLNEDGETLVSGTVDQPL--DEQGFR
A0A2H9T6C5      AWGGEAVKIERFETPDSQIGKTYTLVTGENNRYELYDEDDEKILVGKVGLSAVSRDNQVR
A0A1J5SM24      --------------------------------------------------LS--HVPITT
A0A3B1C7A9      --------------------------------------------------LK--SKYDLM
A0A1J5SPZ5      -----------------KILQRPYLKDLPP--------------------GA--SPPSAA
A0A1W1DYN8      AWGGERIQIEQFTLSRSLQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELA--QANGVT
A0A1W1E4Z5      AWGGERIQIEQFTLSRSLQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELA--QANGVT
A0A0F9UWR4      KSLQGMVLGEDPSDGAEPMTEAQIMDNV----------------------TQ--Q-----
A0A0F9U8M8      ----LFSSFFGEGGTDDELDLEYKMAHL----------------------IN--D-----
A0A381Y0U7      -------------------TESLVLGKT----------------------LN--EREARK
A0A381Z3K5      -------------------TESLVLGEV----------------------LN--DRAARK
A0A0F9LFA5      EQLPFLNKKEVTVYAPEEQAEREMLG-L----------------------LA--V-----
A0A160TC29      ----SFSLREFILGAKEPPTADEVLAKT----------------------IE--N-----
A0A1J5R1Y0      ----WLAKAKIALGIAHPPTVSDQPGTV----------------------LG--E-----
S0DG33          AWGGERVQIGTLEVPIELEEEKLTLIALQDGAYELRGPADQLLVKGVVGTTA--QDNGVS
A0A380TGM5      AAA---LGGKDDTNPGSADRQALEARAARA--------------------AS--LDEVVD
A0A380TDI0      TLG---LNLFPARAPNETDPTQLTVEELRD--------------------KE--NNKIID
A0A380TDN3      TLG---LDLLLAKAPDETDPTQLTVEELRD--------------------KE--NNKIID
A0A3B0VME9      RLD---------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------ASFSCTLQPVSAEQCQLTEWSVNG------------------DETDETYTVAFG
A0A0W8FS74      ----TAKNPSYKIEMTGADTFTVKD-----------------------EDGKLIGEGISG
A0A3B0V744      ----SIYNIPIDVIVINQKTFQLNYTV---------------------REKEYSLNARFE
A0A644WNK5      -----------------------------------------------SDGIDYRSK----
A0A1W1D4H7      ----MMYGKTFELIPIDSVSFRLEIKPLSKYSIKGILATLNIISLDEKDKISYNQIHHYN
A0A3B1CUQ0      -------------IPQKFIDEEIKVEFTDSKG--------NFTVTKEGESLGRGIVGTPF
A0A1W1BK27      KYDGTLYDKLFTIKPIDKKHFLLSV-----------------------DAMEYNRTCSYN
A0A1W1CD04      ----SLYGKFFKIVPYGNQRFLLII-----------------------KGINYKKVHSYS
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          --------------------------------------LLGFLHGASARKPSQTDQLRAD
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      YFSSNL--------------------------------RVVG------------------
A0A0F9JKD8      TILENI--------------------------------SVNP------------------
A0A0F9XPI6      ILMIDT--------------------------------LQNLNLIGQEYEVVISPIKNTV
A0A3B1AK25      DFSARL--------------------------------SVAP------------------
A0A2H9TBF4      AFAENV--------------------------------RIEP------------------
A0A0F9KY21      LTVREL--------------------------------NARPDTIFTLVKNNRYRTVVKL
A0A0F9VQU4      LTVESF--------------------------------NAAEGAQYVLTRLQKTSAIRGI
A0A0F9W5Q6      IQIETL--------------------------------SAHPGTEFLVTKRNDLSTILDY
A0A2H9T6C5      LFVSEL--------------------------------IARPQTRFNVIRQPMVTAINHL
A0A1J5SM24      ILRLNR--------------------------------KVVP------------------
A0A3B1C7A9      EMLDKV--------------------------------KIEQ------------------
A0A1J5SPZ5      AAMPNV--------------------------------DVSA------------------
A0A1W1DYN8      IFISEL--------------------------------VARIGTEFSLSKDNRAEIVDDL
A0A1W1E4Z5      IFISEL--------------------------------VARIGTEFSLSKDNRAEIVDDL
A0A0F9UWR4      -FMQRV--------------------------------SVSV------------------
A0A0F9U8M8      -FRQRL--------------------------------SVKP------------------
A0A381Y0U7      ILEKSI--------------------------------DVRQ------------------
A0A381Z3K5      ILEKSI--------------------------------DVRQ------------------
A0A0F9LFA5      -FKSRL--------------------------------SVSP------------------
A0A160TC29      -FWQAI--------------------------------SIEP------------------
A0A1J5R1Y0      -LRAHL--------------------------------TIAP------------------
S0DG33          ILVKEL--------------------------------DARPGTKFEVIRWNALDAVKRF
A0A380TGM5      EFLKHL--------------------------------DVRP------------------
A0A380TDI0      AVLEDV--------------------------------QAKQ------------------
A0A380TDN3      AVLEDV--------------------------------QAKQ------------------
A0A3B0VME9      --------------------------------------SDPANKMNRKVQENITLDNNLG
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      --------------------------------------QKKEETAKRPVIPKETLKQQGL
J9FGR8          DSVATSFGTFILTKTPAFTE------------------QWVGRSIRFAKTNPQACADV--
A0A0W8FS74      RLMQAKGFSLLLNDLK----------------------GEKGDSFRLKLLPLQNIAVS--
A0A3B0V744      DSVKTELINLKIELNESWA-------------------IEDGSRFYFRINSREVLINY--
A0A644WNK5      ----------------------------------------------------EVLGNV--
A0A1W1D4H7      ELIKTPYFTIMVDKLKHIDGLKYNFS------------FIKQDKLY------DFYKD---
A0A3B1CUQ0      KSDSGLYF-----DLKEVNPYKGASF------------KIKRSRFY------EAVEDL--
A0A1W1BK27      KLVSNAYFSIKVIKKS----------------------YLEDTNYYISQSNPQLLADH--
A0A1W1CD04      EEIKTKFFTLRVIKVDGENPYKTIAMNENPIESFIASLGLEEESYYFRSFDRDTQENM--
                                                                            

A0A644ZI62      --QLAEQVTVTVPTKTATLDLAVVTNSPDSAAQLADAISEQLVTTTIDQL----------
T0ZG59          ADALLHMVSVQPVLNSKLVDVSVDTPDPRLSAQIANVYADQFIRSNLDRRMAASGYAKQY
A0A6J6XYC8      -----PEVTVSANAESDIMTITATSTNAVASAAIANAYAAAFIDVRRASLVDEYVGAAET
A0A6J6U1T4      -----PEVTVSANTESDIMTITATSTNAKASAAIANAYAAAFIDVRRAALVDEYVGAAAT
A0A6J7LYN9      --GDLPDASGSAIKDTDVVRIRVRSGNAETAARLADAYMQAYIDVKREQNVNSLLDASAE
A0A1J5RCY3      --TLANSVTASSPPNSVLIDITVTDTVARRASDIANA-----------------------
A0A1J5RUE5      --ALGRSISANNPLNTVILQISTTDSQPQRAADISNA-----------------------
A0A3B1C250      ------------YKNSQIAIINYEAYNPQLAADIANAVAAAYIETGMESRLMMAKQATSW
A0A0F9JKD8      ------------EVDTRLVTVSYLSGNPDLARLVVNTLANAYIEALFELRMDSSQRALQW
A0A0F9XPI6      LGLINKMEIQTTTKDSDVLAISLSGNYPTKSELILNTLIKKFNQDGINDRQQVSKRTLDF
A0A3B1AK25      ------------VRKSQLVKISFEANNRKLAAQVANTLANTYIESDMEARLEMTSTASNW
A0A2H9TBF4      ------------VRKTQVARIHVMSEDPQLAATAANAMGEAYIESWLEAKLSLTTNATRW
A0A0F9KY21      QQEISASE---KGKDSGIITLAYEHKNASHAEKVLDKVSDIYVRRNVERNSAEAKKSLDF
A0A0F9VQU4      AGRLQVAEVGGAGTTTGMIRLMMFGEDPSEITRSLDAVAQTFLTQNIERQSEQAQQSLEF
A0A0F9W5Q6      QRRVGASE---KGKDSGIISMSLASPHPAKATATLDEISRLYVRQNVERKSAEAQQSLDF
A0A2H9T6C5      SKRLSVSE---KGKKTGVLSLSLSGPSSVHNSHILEAIIQRYVRQNVERVSAEAQNSLKF
A0A1J5SM24      ------------QRLSLVIDVQYDHPDPVVAAKVANLFVDEYIAYNARMRIDESMKAVED
A0A3B1C7A9      ------------KRGLDIVEISVESPVPYEAQMIANCYAQSYEKLNLKYTRQQLSKVVAF
A0A1J5SPZ5      ------------VRNSLLIRITTTDRDPEAAKIIADKYVDQFMQYLLENVGGKNEYAVDW
A0A1W1DYN8      KKIIKVTE---RGKKTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVF
A0A1W1E4Z5      KKIIKVTE---KGKKTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVF
A0A0F9UWR4      ------------EGKSQLVRISVEMADRLTAAQAANSVANSYIEGQLEAQMEMSMAATTW
A0A0F9U8M8      ------------IQGTQLVHITYQASDRKLAAKIANAIGEVYIETHLEAKLGVTRRASAW
A0A381Y0U7      ------------YRNTSIIELRAYDRKPTKAQEIAQALASEYQDHRSSLHKVAVQKGIDS
A0A381Z3K5      ------------YRNTSIIELRAYDRKQKKAQEIANALAEEYQSHRTDLHKERVTKGINA
A0A0F9LFA5      ------------IRKTQLVQVSFESSDPKLAALVANTVGEVYIESQMRAKMGITQQASSW
A0A160TC29      ------------VRKTQLVKISVESQSPELAYTAANAVAEGYIESQMEARVGLTQQAAVW
A0A1J5R1Y0      ------------VPRSNLIQVSYDSPDPRMAALIANTFAEQYIRNDMENKFRMTQEANSW
S0DG33          GDLVKVGD---KVKDSGLLQVEYADANPDKATAVANALGEQYLASAIASRQLNDTNTLAF
A0A380TGM5      ------------TKASRVISVRFQSRDAQLAADVANAVADTYTNRFIETKIAIAEKATGW
A0A380TDI0      ------------IPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSW
A0A380TDN3      ------------IPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSW
A0A3B0VME9      KIKNSLTITPVRG--TQLIKISFQSPHSGLAADIVNNLMKEFIQVNAEQKLAAFHSSGVF
A0A3B1DSR1      --LVVKRTAGRDRSFSNVLDLSYRNRYKEDAKTILSAIIEAYQEYLTRNQNKNQKKSLEL
A0A0F9I1G8      IGFVNGNLTPILQRNSNLISISFTSPDRHLSQDVVNTLIEEFVRWKMDQKLEASQLAREF
J9FGR8          --YAESLVAALSNKEASVITLTINNPSIAKAEDFLNTLIEVYNEKWVQDRNQIAISTSKF
A0A0W8FS74      --LKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQVYLGQNIELKTEEASRTVSF
A0A3B0V744      --VESNLSVEPLNFQANTFQISFTDHNLNKAHALVSAIDTLYYNYSLQEKTKANRNKIDY
A0A644WNK5      --KERIVVSTVKD--TNIVRIAVTDANPAFARDFANALAASYDSLLTGIAKNSKTAQREF
A0A1W1D4H7      ---NLSVKNMLKS--SSVLELTYQDTVSLRAKEILDAISTTYIATTVKQKTEANGLTLNF
A0A3B1CUQ0      --QKKVTVSPVRN--TNIVYIKVQDSDPRMAAAIANSIVKRYIQHDISKRSKEATYMIKF
A0A1W1BK27      --ILENMKTTILS--DNVLQITYTDTVAKRAKEIVQEIANQFREFTLVKKTSELKKRLIF
A0A1W1CD04      --IIKNMSVSDLS--ENILKIEYSDNIPQQTKEIAEEIARSFIEYNLENKTAELEQTLEF
                                    :              .                        

A0A644ZI62      ------------------------------------------------------------
T0ZG59          LQDRLQQLKLRLEDSDKELVAFAQKHQIVNISDRQSLVGQQLEQLNVALAQAEQDRYKAE
A0A6J6XYC8      IQAQAEQLDEKISSLQAER-----------------------------------------
A0A6J6U1T4      IQGQADQIDQKIGSLQAER-----------------------------------------
A0A6J7LYN9      VQKKVSELQEQIDAIDDQI-----------------------------------------
A0A1J5RCY3      -------IAGSLGTQVSEL-----------------------------------------
A0A1J5RUE5      -------VARQLAVTVQNL-----------------------------------------
A0A3B1C250      LTEKLSLLRTKLEESEKTLQRYQAREGV-VDTKSQKSIINRK---LV--------SITEE
A0A0F9JKD8      MSRKVEEERNKLDDSESGLQAYMKANDI-VTLEDRIAIVPQK---LL--------ELSTQ
A0A0F9XPI6      IDERFVYLSTELDSIEGGKQAFKTRNNL-SYIEADAGVSLER---KS--------ETEND
A0A3B1AK25      LTERLVTLKSNLQQSENELQAYREKEEL-LEAGGVSTLSTRQ---LQ--------DLNEK
A0A2H9TBF4      MQDRLQDLSEKLKTAESQLHKFRVSEDL-VDIEGVLTISTDE---LK--------ALTES
A0A0F9KY21      LEVQLPEVKKQLEGSEQRFNDYQKQRKS-VNITLETQAILEQ------------------
A0A0F9VQU4      LQRQAPELREQLDLAEQNLNDYRANLDS-VDLSSEAQAAIQR------------------
A0A0F9W5Q6      LKEQLPEVRRQLEAAENALNEYQASAGS-VDITLETQAVLDQ------------------
A0A2H9T6C5      LEHQLPDMKKDVELAESKLHRFQQENQT-VDLTMETQAVLDQ------------------
A0A1J5SM24      LKVRAEQQRSKVNELALALQAYREKNNL-VSLDQRKDIVTEK---LK--------ALNLL
A0A3B1C7A9      LQKQRTKKYQELLVVEEKMKKFQVEGRI-IALDDQAKALIDI---LS--------TFEAQ
A0A1J5SPZ5      LTSRAEQLRRESEAAALKLQNFMQAQGM-VSLDDSTNLITAR---LQ--------AVSNA
A0A1W1DYN8      LQKQTPLIKDEMEAAEVELNNYKGYKNS-VNLTLETQSLLNR------------------
A0A1W1E4Z5      LQKQTPLIKDEMEAAEVELNNYKGYKNS-VNLTLETQSLLNR------------------
A0A0F9UWR4      MNSRLSELRTSLKEAENRLQAYREQEGL-VDVDGVGTVSANE---LA--------LTGDR
A0A0F9U8M8      MSEKMAGLTKQLERSETAFESFRQKNNI-VDIDSAVLRIDSE---LE--------KTQAT
A0A381Y0U7      LKSRMGEMNTEISDMQSNVDKFRTDLGI-SDAAGEESYSIIEPEIVR--------RYEVE
A0A381Z3K5      LNKRMEEINEDITGMQSKVDRLRTDLGI-SDAAGDESYSLIEPEIVR--------RYQAE
A0A0F9LFA5      LNTRLSQLRIQLDNSEVRLQEYRELQKL-VDIEGIA-GLVTQE--LE--------QISQQ
A0A160TC29      LSDRLGGLKDKLSESERKLQTYREQNDL-VDIEGVN-TLVAKE--TD--------QITER
A0A1J5R1Y0      LNEHLAGLKAKLEASEQRLQTYRNQQNI-IDVNGSALSGTGNQ--LE--------GLVTN
S0DG33          INGELPRLLADLRKSEDALKHFRS------------------------------------
A0A380TGM5      LKGQVKALREAVARSEKAVEAFRTQSGL---LRGSQVTLISEE--IS--------EINRR
A0A380TDI0      LAGRIQVLREKVEASEREIEAYRKRHGL---FEGRATSLVTEH--VS--------DLSSK
A0A380TDN3      LAGRIQVLREKVEASEREIEAYRKRHGL---FEGRATSLVTEH--VS--------DLSSK
A0A3B0VME9      LDKQVNASKIKLEKSEQELNGYARRTGI-ISLNSKLNLVMGQ---LE--------AVNDA
A0A3B1DSR1      ITQANDELEVKLNKKKEEYQKFRDNAPLYWNAAPGVKGVGSS---VTNVHRDRFLKLEEK
A0A0F9I1G8      LTKQIYQSKINLEKVEEELNRFARMSGI-VSLDTKLNSVYSQ---LG--------ELNTA
J9FGR8          ISDRLGVIERELGHVDENISNYKSEHLM-PDVQAASNLYMSQ---TV--------EYKKQ
A0A0W8FS74      IENQLKGLRGELEGAEQDLETYKSSSGM-FKLDSEAQEVVKN---LS--------ETEKL
A0A3B0V744      LDKQLEETEKKLDNFETYFEDFTIDNKT-VDLNEDVRRTVDA---IN--------GLDSQ
A0A644WNK5      IESQIPINDRELSKAGDALGDFRENSDI-IQLTDKSSLLVEQ---IS--------YYTLR
A0A1W1D4H7      IDTQLKVISANLKNSEKNLENYKIHHSV-VDLKTKLEVKTQK---IA--------EYEGE
A0A3B1CUQ0      VKKQIEPTQKKLENALESLAAHKRNSRV-VYLKEGTKKLIEN---IG--------ALEQE
A0A1W1BK27      INGQIGIIENQLQGEGKNLKEYQKKHKTFFTIETNNKMILEK---LA--------EKKEM
A0A1W1CD04      LDKQLIEVKSDLKNKGEKLKKHQEKSGS--AVMSSGEALLES---ID--------EKKDL
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          AKWRQLQGAPADQIAQVLGDPVIEKLQQAYAEDQAKYQDQLRIYKPAFPAMLQLHAKLDE
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      LIKAQTRRAEAEIRYMEIKNVKNERGYE--------------------------------
A0A0F9JKD8      LTRSETRRKELETLRNKIRSLKAAGKDL--------------------------------
A0A0F9XPI6      VIKLETQISLSALLKNSVVGQAAFELLP--------------------------------
A0A3B1AK25      LVLATQQRATAEISLKQIKSLAGESPDK-----------------------LGA-IPAVL
A0A2H9TBF4      LVETRRKLTLSENIYRQIQDGKNLQADQ-----------------------YQS-LPAVL
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      LTQSASTLADAQVKWQQVQDCRRQGRSL-----------------------ID--LPFIL
A0A3B1C7A9      RDATSLELSQAEENIKQYKEEMNKQNSS-----------------------ISKYIENYA
A0A1J5SPZ5      LTQNQLQLLQLQAQYSQIQQY-IQSGQN-----------------------LLE-IQAIA
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      MVDARSQRAEAESQYRQVQAMSEQGWER-----------------------MAS-VPAVL
A0A0F9U8M8      LAIAESDKSKVDSILELINRFGKSDFEN-----------------------LKS-LPEII
A0A381Y0U7      LIAAKGVHTTQSSLLDGLKA--QSAEEL-----------------------RAS-ILTAH
A0A381Z3K5      LITAKGVYTTQATLLAGLKD--QSVDEL-----------------------RAS-IMTAH
A0A0F9LFA5      LIVARNEKNNLESINRVISEYGNNNLEL-----------------------LGS-MPEIT
A0A160TC29      LIEARSRRLELEGTYRQLQSLAEQTYES-----------------------LSS-LPSIL
A0A1J5R1Y0      LVTARMKMAEAASAYQQIRN-AQASGTS-----------------------LDS-LPLVV
S0DG33          -----------------------------------------------------T-SQSMQ
A0A380TGM5      LAAASADRAQATATLNEVQA--LQKASN-----------------------IEA-AQAIM
A0A380TDI0      LTDATIERRAAEARLAQVRN--LKNAEN-----------------------VDT-AVQVL
A0A380TDN3      LTDATIERRAAEARLAQVRN--LKNAEN-----------------------VDT-AVQVL
A0A3B0VME9      LAQAVTARISKESLYLQTKKNGGENMPQ--------------------------------
A0A3B1DSR1      RREVVTRQAETKARIISLEEAVAARQSP--------------KKLERMVRIFLSYQTGRG
A0A0F9I1G8      LARAEAEMIGKRAIYNQAIKDGPASLPR--------------------------------
J9FGR8          LQELNNQLSTAQYIRRELTGKQLSQLLPANSGIA--------------------------
A0A0W8FS74      RAEVIFQKKQVEFALDALNSALRKGNIY--------------------------------
A0A3B0V744      RIKIDNKLSELELLQAKLSKTPYENLTP--------------------------------
A0A644WNK5      LEPLKLQLKESEVFIDSYN------ASLKQAGIDGVLTLEQIK-----------------
A0A1W1D4H7      QLELQTEINILNNIKYYINKN-KDLTAL--------------------------------
A0A3B1CUQ0      KTNLDIKEQQVRYLYDEVQKNITDTSTL--------------------------------
A0A1W1BK27      IETLKLQLKELNDFQKSFKKGNLNTVSLLNNGINISSIEPLIERFHAIDIELEDMRIQAK
A0A1W1CD04      IEKIILQLQEVKNFRASLQNGIMSSVALTSVGIDTSSIQSLIDSYTKSEETIRELRLQQN
                                                                            

A0A644ZI62      -------------SPPSPDGTKSVTATI--------------------------------
T0ZG59          IHRQIAARTALVSGAAQSAYGAAKARETL-------------------------------
A0A6J6XYC8      -------------DNAIAALPRSFTQAEE-------------------------------
A0A6J6U1T4      -------------DNAIAALPRSFTQAEE-------------------------------
A0A6J7LYN9      -------------DAVPTGGGSDAVATLT-------------------------------
A0A1J5RCY3      -------------ETPSSGAASPVKVST--------------------------------
A0A1J5RUE5      -------------SPRTVAGQSSIELTV--------------------------------
A0A3B1C250      -SIRAVLRHPLIQKLKEEESRMARRVSEL---SKRYGKKHPKMIAAISDYKEARRTVRK-
A0A0F9JKD8      DSLPAIASDKTVASLRGQVLKGEQRITEF---SKKYGQKHPLMIESVGDLRVLREKKEQ-
A0A0F9XPI6      --VDVGLENSGLNSMVDRYNDQVLQRNKL---LQTVGIQHPSLIAISTQLEVAKVNIIK-
A0A3B1AK25      ND-------DLVGSLKHSESDMQREVSAL---AKRYGPMHPEMIQAKANLAKATQNVNR-
A0A2H9TBF4      AH-------PLVQQLKQREAELEQKVREL---GRRYGPKHPKMIAANTELESISNNIRL-
A0A0F9KY21      -----------IVELDTTLQELDLKRLEL---SRKFKREHPAYQGV--------------
A0A0F9VQU4      -----------YIELDTRLDELEFQEAEL---AQRFTPSHPNYQAL--------------
A0A0F9W5Q6      -----------VVELETAISELALKRSEM---ERRFTRQHPTYQAL--------------
A0A2H9T6C5      -----------AVDIDTQLAQLDMQIKQM---GQRYTKSHPVMEEL--------------
A0A1J5SM24      NSSNDNSGPSLVSQLNQQVAQQEIDIAKL---RERYRDKHPIMVAALNSLAQTKAQLKL-
A0A3B1C7A9      TE-------PRMRALQEEIARLEMERDVAMSDTTMSATRKELLVNKNRTIRDLRKQLNE-
A0A1J5SPZ5      TH-------GEIPSLVSQLMSLKQQQQVL---AERYLERYPKMIDIANQISVAQSQLDK-
A0A1W1DYN8      -----------IIMIETQLAELEVKHSDL---SKKYTDIHPIMITL--------------
A0A1W1E4Z5      -----------IIMIETQLAELEVKHSDL---SKKYTDIHPIMITL--------------
A0A0F9UWR4      GH-------PLIQQFKSEQARARARVEEL---SRRYGERYPAMQAAQSDLNAATASLRA-
A0A0F9U8M8      SH-------SSISEGRVLLETAELKFAEL---SKIYGPKHPKLIAASEELDMRVEQVNA-
A0A381Y0U7      PD-------AQLDALTREFHTGQQTLANQ---SIDLGDQHPRIKGLKKVVATLEEQIDN-
A0A381Z3K5      PD-------AQLDSLIREFLTGQQALANQ---SIDLGDQHPRIKGLKKVVAILEGQIDA-
A0A0F9LFA5      SH-------RVIQDVKREVILVERKLSDL---GEVYGPRHPKIISANAELATVKNNLNK-
A0A160TC29      NN-------PLVVKLRENETNAELKVSEL---SKRYGPLHPRMIAAQSDLDAVRDSVFT-
A0A1J5R1Y0      RD-------PVVAQLEQVVAQKQQKVSEL---SKRYGPKFITMIQAQAELQQARDNLKH-
S0DG33          PT-------SEAQAYLQGGLDLDKQIAGL-----------------QLQRTQLLERYRP-
A0A380TGM5      ES-------PVVQQLRIQEAAVLRELAEL---SIELGERHPRVINKKSELEKFRAKIEA-
A0A380TDI0      DS-------ALIQRLREQELELERKEAEL---GQNLGARHPAMIQLQAERQRFREKLQA-
A0A380TDN3      DS-------ALIQRLREQELELERKEAEL---GQNLGARHPAMIQLQAERQRFREKLQA-
A0A3B0VME9      -----VLNNPLLQNLKKQYSDLRSQYEVL---STVFKDQYPKVKKLKAQMKDLRNRYAQ-
A0A3B1DSR1      GQSAATQLNPDLVTLESRLVPLVLRERSL---LREFGKDHSDVIGIREQINALRDIYRQK
A0A0F9I1G8      -----VLSNLVIANLKADYARLVSQYQDL---TTTFLDDYPEVKNLKSRMLSIGERIHI-
J9FGR8          --------STTLAGQIEEYNKLVLDRNRL---VANSSEKNPLVVDMTETLRALKNTLIQ-
A0A0W8FS74      -SPAIMRDDPLVAGLAAKLSELEIQKRTL---LTDYTENHPAVRTIQGQIDEIQKKIRS-
A0A3B0V744      ---KVNVYPNYLNRAFDEFNLLKNDLQKL---GLSYKENTYTFKSRQKEVELMRADILA-
A0A644WNK5      NDSVIISKLADLSAWKTELTMYESLSNPA---RNTATLAPSTTLDSSSRTYVISSAISQ-
A0A1W1D4H7      SIGTVKFTDNRISLLVTSLEALMNRREQL---ASKYTQFHPDIVKIDKSIKIAKKAIKK-
A0A3B1CUQ0      NLSVLE--DTVVQSMISSLAMLENNRKSL---LSEYTARHPQVVALSAEINEIKKRINA-
A0A1W1BK27      NIEKSLTKRPQLEQLIQRLHKEKDTLEEL---NFNFTPTHPQVVKTNNTIIEIENDIRS-
A0A1W1CD04      NITKSVTSNLLIAALINELKEKETLLRSL---LTDFTEEHPQVIEQKKEVDNMRNKIHG-
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      -----------------------------EVKRVVDGI------------------RRDF
A0A0F9JKD8      -----------------------------EIGRVVKSV------------------ENEY
A0A0F9XPI6      -----------------------------TINIYQTQL------------------RTSL
A0A3B1AK25      -----------------------------RIRSVTNGV------------------EKEY
A0A2H9TBF4      -----------------------------QVQRIVLGV------------------ENEF
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      -----------------------------AIDAAAAAV------------------QANY
A0A3B1C7A9      -----------------------------QLKIYKESIYAASPAELKELSLKLLTEEVRY
A0A1J5SPZ5      -----------------------------AIKLAVDEI------------------KSQL
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      -----------------------------QVEQVVAGI------------------ERNY
A0A0F9U8M8      -----------------------------QIQSLISGI------------------EKES
A0A381Y0U7      -----------------------------RIKGILAGL------------------ELRV
A0A381Z3K5      -----------------------------RIQGVLAGL------------------ELRV
A0A0F9LFA5      -----------------------------QIKGLITGI------------------EKEL
A0A160TC29      -----------------------------QMKRIANGI------------------ENDF
A0A1J5R1Y0      -----------------------------QVAIVVSSI------------------EHAY
S0DG33          -----------------------------DSRWV--------------------------
A0A380TGM5      -----------------------------EMERVLKGY------------------ATAV
A0A380TDI0      -----------------------------EIGKIVQRA------------------ENEV
A0A380TDN3      -----------------------------EIGKIVQRA------------------ENEV
A0A3B0VME9      -----------------------------EQQLILDSI------------------RLAY
A0A3B1DSR1      GIDISESGITDEGIEEGAVKIDFVALYIQSLKQLLVEL------------------KQRK
A0A0F9I1G8      -----------------------------EEKKIFKAI------------------ENEY
J9FGR8          -----------------------------TVDNLIRSL------------------NTEM
A0A0W8FS74      -----------------------------TYETNLVNL------------------NKQQ
A0A3B0V744      -----------------------------EVNDYKQDL------------------QKQK
A0A644WNK5      -----------------------------VTKELLNRV------------------AALT
A0A1W1D4H7      -----------------------------AVQNSLDQL------------------NQRS
A0A3B1CUQ0      -----------------------------SILNTLDSL------------------RTKK
A0A1W1BK27      -----------------------------YIQTDLNRL------------------RKSK
A0A1W1CD04      -----------------------------NIVTNIQKL------------------KKNR
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          ------------------------LRQRVADLRQQVLNLEQRSIRYNILKREVDT---NR
A0A6J6XYC8      ------------------------ASRITEAYAPRLTALDLERTRLDQLTANLDL---SA
A0A6J6U1T4      ------------------------ASRITDSYAARLTALDLERTRLDQLTANLDL---SA
A0A6J7LYN9      ------------------------AQRQRLVDQQSVFKQRLDQIQVD-------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      EAAVANEKE---------------LRRLSNTTEKDARRIKGKEFEMAKLEREVSA---NR
A0A0F9JKD8      DLALSNEHN---------------IRRLLSETKLEAHGINEKFVKYNSLKREVDT---NR
A0A0F9XPI6      IQ----------------------SNQAQNKVNSVFSGLPEKEKMLRSIERQQSI---KE
A0A3B1AK25      QIAMAAESS---------------LKRSLQRAKGEMQNINRKGYKLGVLEREVES---NR
A0A2H9TBF4      EVARANEQS---------------LVAAMTTAKQAVQTINSKQFRLKALEREVRT---NK
A0A0F9KY21      ---IKQIES---------------IEAEKELLTSKVSNLPETQQELLRLTRDVEV---GN
A0A0F9VQU4      ---IRQRRQ---------------IQRDLQELNARVNELPAAQQEVLRRTRDVEV---TQ
A0A0F9W5Q6      ---MEQKRQ---------------LETRRDDLLKRVGGLPETQQELLRFARDVKV---ST
A0A2H9T6C5      ---QLQRQL---------------IVDRKNKFSDEARGLPKTQQEVMRLARDVQV---NT
A0A1J5SM24      QTAQSDYQH---------------AKAALAAQEQESLELDRYGVEYTNLERDYNI---NN
A0A3B1C7A9      KSLQATYQN---------------LNKIIDNYESKFNELPNRTIGFARYQRELNA---YE
A0A1J5SPZ5      AKTIDAEKR---------------LEAEKAIQEKAFLHLGDVRTEYESLKNQSDV---KR
A0A1W1DYN8      ---TNQEVK---------------LQEQLEKINAKAHGLPKTQQEILRLSRDVEV---AT
A0A1W1E4Z5      ---TNQEVK---------------LQEQLEKINAKAHGLPKTQQEILRLSRDVEV---AT
A0A0F9UWR4      QLAVANEQS---------------VRASFDANKEQIQDISRKEFRVRELTREVES---NR
A0A0F9U8M8      YTAAQRVKR---------------YRKELSDIRSKYSDITGLDTKYTALKIELDT---NR
A0A381Y0U7      NSSMAQVEQ---------------LKRDVEDAKKRESDMREKGREYFNAKRELAN---TT
A0A381Z3K5      KSSKAQVDQ---------------LQQDVSGAKTKESEMREKGREYFDAKRALAN---TT
A0A0F9LFA5      NRVTRTVSA---------------LERDLVKIRAEYQDITRKETQYNQLKREVET---NR
A0A160TC29      LVAKSKENS---------------LQSALNSTKARIRDMNRTEFELNDYVREVRA---NR
A0A1J5R1Y0      NEARANVQA---------------LSGAVAEVRGSIRQANEKQFALADLQRDVQT---NQ
S0DG33          -------QS---------------VDTQLAQLKDAKAQFNGHFNGMPSSERESVDLLRAQ
A0A380TGM5      SVATAREDS---------------LERELNKLKSKQALANSREIELRELEREAEA---NR
A0A380TDI0      VVARGREAA---------------LQRDLASVKGDMVQSNQASIGLRALEREADA---NK
A0A380TDN3      VVARGREAA---------------LQRDLASVKGDMVQSNQASIGLRALEREADA---NK
A0A3B0VME9      EEALEKEKR---------------LTTKAEAQKKLAIELNSRATQYKILRREVAT---NR
A0A3B1DSR1      LT----------------------FDELIALESQESKKLSRYLMEDQTHSDEIER---LK
A0A0F9I1G8      QTALKKRTA---------------LQERVSLQKTLAIDLNERATQYKIIAREVET---NK
J9FGR8          AS----------------------IRRQSEAATSQLASNPGQAKYLLSVERQQKV---KE
A0A0W8FS74      SS----------------------VTHQLDIYESKLRKLPKAERDLARLTRVSNV---NA
A0A3B0V744      SN----------------------LVTTKQQLRRQLISLPSKNTEYNKSKRFYSV---YE
A0A644WNK5      RKYANEANTQAIVQALTTEVGIQVLQKRGAVFVEELSQLPVLERRLSELQRDVQI---YE
A0A1W1D4H7      ID----------------------LGNMVVQLNKSLESLPTEEKKLAQLLRPLKV---NQ
A0A3B1CUQ0      ES----------------------FSKEIGRLRAELKVLPEEEKTLAGLVLNKEV---LS
A0A1W1BK27      SSIKTKIIANINTTKKSIEHKLNIFKHDIQNENALMQTLPEKSLTVQELKRKFTL---SE
A0A1W1CD04      AIAKSTILNNMLMVQNNLTDKLRLLKSDIRQKKSLLRSMPKENLVNASLKRNFAL---NE
                                                                            

A0A644ZI62      ------------------------------ITSAELPV-IPTTPNTMRNLALGAMLGLLM
T0ZG59          QLYDAILQRYKEIGVAGGV----GINNISVVDRAEPPM-VRYRPRLKLNLTIGLLLGLFA
A0A6J6XYC8      ELLQG--------------------GGASIISKATVPS-APYSPKMLNNIAVAMLLGLLL
A0A6J6U1T4      ELLQG--------------------GGASIISKATVPT-APYAPKMLNNVAIALVLGLLL
A0A6J7LYN9      ASLQS--------------------GNAQPVRPAEVPT-GPVEPTPLRTGLLALVVGLLL
A0A1J5RCY3      ------------------------------VRTATVPL-APATPKKTLNLALGLLVGLAL
A0A1J5RUE5      ------------------------------VAPAVPPE-TPFEPNTRFLSVTGLALGLGA
A0A3B1C250      QLHDLFLTRFKETNMGENA----NVTNVRIIDRAEPPM-RPHKPKKSRIVGLALFIGIFL
A0A0F9JKD8      KLFESLLQKMHKERIEEEG----QTVNVMLVETAETPS-YPESPKKALNLIIGFMIGILG
A0A0F9XPI6      NLFLLLLQKREEAGISLAV----TTPLVKIVDYALTST-TPIAPKKTIILGVSGILGLLI
A0A3B1AK25      QLYKLFLNRFKETKETSGL----EQVRARIVDPAEPSI-KPIKPKKQLIVLIATLISGFL
A0A2H9TBF4      DLYDAFFKRIQETSATSDL----QSANARVVDRAFTPE-HPVKPKKKLIVGIAALLSLLI
A0A0F9KY21      EIYMLLLSKTQELDIVRAG----TVGNVRVVDAAAVDTTEPVKPKKALIAVVATLLGGFL
A0A0F9VQU4      AIYVNILNKVQELEVARAG----TIGNIRIIDSAVLSG--QVAPNTPRIFILYTILGLLL
A0A0F9W5Q6      EIYTAMLNKSQELDIVRAG----TVGNVRIIDDAVVDTSQPVKPKKALIVVLATLLGGML
A0A2H9T6C5      EVYTELLNKAQELKIVKAS----AVGNVRILDHA-LSAIEAVKPKKSLIFVLAVLLGAML
A0A1J5SM24      QLLQQILERMRETSMTSTI----ETQNARIVDRGQVAK-KPVSPNVPLNLGLGFVGGLGL
A0A3B1C7A9      KLYLLIEEKYQEALISEQS----TPGNVLIIDEAQRPV-KPSKPNRKLIVVIGLILGFGF
A0A1J5SPZ5      KNYMDILDRLNQTQTTSNI----DKIPLRPLDRAQIAG-APYTPNMGRIIKTCTGLGVLV
A0A1W1DYN8      TIYTQLLNKTQELKVVKAG----AVGNVRIIDTALTAQ-RPIKPKKLLIVLISTLLGLFL
A0A1W1E4Z5      TIYTQLLNKTQELKVVKAG----TVGNVRIIDTALTAQ-RPIKPKKLLIVLISTLLGLFL
A0A0F9UWR4      ELYETFMTRLRETTSTQDL----STTNARIVDQAIPPS-RPSAPNTKLLIIIATMLALIV
A0A0F9U8M8      NLYNTFLERSRETEATSDY----KASPAHFTGVAAASL-YPVKPNKKMIVAGAFFLSLMF
A0A381Y0U7      RIRDTILLRVMQEEVDLELG--SKESSVEIIDEADLPI-KAVRPNIPLNISLGVVVGLIL
A0A381Z3K5      RIRDTILLRVMQEEVDLEL---PKESTVEIIDEADLPI-KAVRPNIPLNISLGVVVGLVL
A0A0F9LFA5      NIFNTFLSRSKETEVTSDF----SSAAARFTDRAYAPN-NPVKPNKKLIVILAFVASFGF
A0A160TC29      GLYETFFNRISETSVTGDL----QTANARVIDPAVLPK-EPIKPNKKLIVALALVVSAMF
A0A1J5R1Y0      QVYDMFLQRFKETSAATDL----TKPIASVVDPATAPV-VPLRPHKARVIAAALLVGLLF
S0DG33          KVAETIYLGMVQKAEQLQVRRASTTGGAHIVDAAIRPH-RPVKPRPELVLGGGLILGLIS
A0A380TGM5      KLLETFLTRLKETTPQLDTE--MQVPGATVLSPAAVPL-R-SLPDKRIVLAVATIIALLL
A0A380TDI0      LLLEQFLASFMQASAQEDMR--AQLPDARVVSPAAMPD-KPSYPRKVFVVMIAFLGSILV
A0A380TDN3      LLLEQFLASFMQASAQEDMR--AQLPDARVVSPAAMPD-KPSYPRKVFVVMIAFLGSILV
A0A3B0VME9      EVYSSLLSRSKEIEASAGS----DNGNIMIVSMARPPL-YPYKPKVARNLLLGIVLGSFA
A0A3B1DSR1      TIWQIAVDQLNRTTLSKNH----SGYSMEKMAPVRAEL-S--FKRHLKFLGGGVVGGMLV
A0A0F9I1G8      GIYQSLLERAKEIESMVGV----SSSNIHIVDRALLPI-FPFKPNVRLNLLLAIVVGLMG
J9FGR8          ELYLYLLQKREENELSQAF----TAYNTRVINAPRGSM-APTAPQRSKILLIAFVLGLAL
A0A0W8FS74      GIYTFLLQKHEEARIAKAT----TVSNINIVDPAITPV-SPIKPDKPKNLLLGFLVACIL
A0A3B0V744      EMYLSLMQSKNEFEIAIAG----SITKIKILSPASLSN-TPIYPVPLFAYATAVILSIVL
A0A644WNK5      AIGLKLREMLEEVKLTEAA----VTGNVTVVDAANLPL-NPVSPNKLLIIAVAMLLGAAI
A0A1W1D4H7      KIYEFLLQKRAETAILKSA----TIANARILDSARENT-TPVKPKRVLIVVVSVISGLII
A0A3B1CUQ0      NINAFLFQKLNEATITQAS----TISSIQVVDPAIVPK-KPIKPQKKRNILLAVVVGLMS
A0A1W1BK27      NIYTFLLQKKMETQMSLAS----VIENTQIIESAREGL-KPIKPNKKLIVIVGFITSLIL
A0A1W1CD04      EIYTFLLQRKIEIEISKAS----TIANTRVVENAYVAK-GAYKPKKTLIMAVATIVGFIL
                                                                        .   

A0A644ZI62      GAGLAIVRDMLNLSIHSERDIERVT--EIPVIGVV-------------------------
T0ZG59          GIAAALVLDHLDDTVHIATDAEQKL--GLAVLGII-------------------------
A0A6J6XYC8      GAAMALLFENLDTSLRSEEELKSVS--GLDVLAVI-------------------------
A0A6J6U1T4      GAAMALLFENLDTSLRSEEELKTVS--GLDVLAVI-------------------------
A0A6J7LYN9      GLGAAFLIDYLDDTLNSPEDLERTA--GGLAVLSV-------------------------
A0A1J5RCY3      GVGLAVLREVLDTKVRNEADVRRVT--EASVLGSV-------------------------
A0A1J5RUE5      GVILALLLTIFDTRVRTAADIERVI--HLPALATI-------------------------
A0A3B1C250      GVILAFVQEHLDKTFRNTDDVERFL--TLPVLGSV-------------------------
A0A0F9JKD8      GAMLAFFFEYFDNTVKAAEDAEEKL--GIPVLGMV-------------------------
A0A0F9XPI6      PFVFFYIKFSLNDKIGSKSDVLAIES-SIPFLGEI-------------------------
A0A3B1AK25      GILLAFLFEHLDNTIKKASDLEDRL--HLPVLGLL-------------------------
A0A2H9TBF4      ACGMAYLLEMLNNTIRTAKDVEDQL--NLPVLGVL-------------------------
A0A0F9KY21      AVAIVLIQKAMHRGVEDPSEIE-AL--GLAVYASV-------------------------
A0A0F9VQU4      ITGYVLLKELFKRGVESPDQIE-RL--GLTVYANV-------------------------
A0A0F9W5Q6      GVAIALLRHALNRGIENPELIE-QM--GLPVYAAV-------------------------
A0A2H9T6C5      GTGFVFLRTMLRQGVKTPEEIESKT--GLSVYATV-------------------------
A0A1J5SM24      GLAFAFFVAYIDDRVKSSYDIESVI--GLPLIGII-------------------------
A0A3B1C7A9      GVGFAFVRDYFDNTVKTPEDIEKE---NINVLTWI-------------------------
A0A1J5SPZ5      FLGVAVGLSFIDDRIKSAWDVEHFI--GANLLGII-------------------------
A0A1W1DYN8      VIAWVLVRRAMNKGVEDSDLIERDI--GIPVYANV-------------------------
A0A1W1E4Z5      VIAWVLVRRAMNKGVEDSDLIERDI--GIPVYANV-------------------------
A0A0F9UWR4      GVAIALIADFLNNTFKSAEDVENNL--NLPVLGIV-------------------------
A0A0F9U8M8      FVGLVILFEMLDDTIKSPSDIESKL--SMRMLGMI-------------------------
A0A381Y0U7      GVGLAFFIEYLDTSVKTIDDVERAL--GAAVLGVI-------------------------
A0A381Z3K5      GVGLAFFIEYLDTSVKTIDDVERAL--GAAVLGVI-------------------------
A0A0F9LFA5      AVVMSFIFDALNDTVKTKSDVEGKL--AQRMLGLL-------------------------
A0A160TC29      GIALAFLLDALDATVKNAEDVDRKL--GVSLLGIV-------------------------
A0A1J5R1Y0      GIAVAFLLERLDTTVRSTEEVGLRL--GQPILTTL-------------------------
S0DG33          GVVLVFMRRYVMTGVTDPRYVERRM--SVPVFGEILFSQQQVLLDRSFAARKSLPGLGGR
A0A380TGM5      GLGLALMAERLDYGFRHAEQVSEAT--GLPVIAHL-------------------------
A0A380TDI0      GGLLALTLESLDAGFRSAEQIEAVT--ELPVMAHV-------------------------
A0A380TDN3      GGLLALTLESLDAGFRSAEQIESVT--ELPVMAHV-------------------------
A0A3B0VME9      GVGLAFVLEYLDDTIKNPDEFPQRY--HIPVLGLI-------------------------
A0A3B1DSR1      LFGFIYLRAFLDTTVHTVNDIRDNF--NLPILGAI-------------------------
A0A0F9I1G8      GIGLAFLLEYFADTITNPDQISERF--QIPILGVV-------------------------
J9FGR8          PAAVIYLMENMDNRVRGRKDLELLT---VPLVGEI-------------------------
A0A0W8FS74      GIGLAFFQEYLDDTIKDAEEAKRAI--GLPLLAVI-------------------------
A0A3B0V744      SFLFAGVMYLAHNKIQSLHEIEFLT--TATTLGAV-------------------------
A0A644WNK5      GLLLTLGIETLDVSIQSEQQIQKIVGKDVPILGWI-------------------------
A0A1W1D4H7      GIFLAFLREFFTTTLQSLEELEHIT--SLPIYGVI-------------------------
A0A3B1CUQ0      GVGFAFFFDYLDNSIKTPRDVEERL--GLPVFGHI-------------------------
A0A1W1BK27      AIFYVFLKSMLDTKIRNEANIKELT--DAPLYGSL-------------------------
A0A1W1CD04      AIFFVLMRDFFDTKIRTVRDIESLT--DKPIYGSL-------------------------
                              .                   :                         

A0A644ZI62      -------------------------------------PE---DDDAVRNPLVLHADPHSQ
T0ZG59          -------------------------------------PL-----ARAGTPEQAMQDPRSA
A0A6J6XYC8      -------------------------------------PIYEGDSKGEEMSVISSTDPTSY
A0A6J6U1T4      -------------------------------------PIYDGDSKGEEMSVISSTDPTSY
A0A6J7LYN9      -------------------------------------IP---DTSPPDSRPLALSEPDNS
A0A1J5RCY3      -------------------------------------HY---DPDAPDHPLIVQSGPQSH
A0A1J5RUE5      -------------------------------------VR---ARQSQQPATTVAHDPSSR
A0A3B1C250      -------------------PTVKKGGDD-----------------AFGPEWHSLANPRSP
A0A0F9JKD8      -------------------SHLRREKKG----------------KERHIERIVIEEPKSS
A0A0F9XPI6      -------------------PHFKTE------------------------KKFIDFNDHSV
A0A3B1AK25      -------------------PKLDLKKHK-----------------TASPLSYAKGNKQSF
A0A2H9TBF4      -------------------PEVDIKASSVPVSQLFINKD--------------ISKEQRA
A0A0F9KY21      -------------------PHSDHQDKLSGFAERARKNKTNKPKS-----ILALDNPADL
A0A0F9VQU4      -------------------PQSSAQRKL----NRALKRRGEKTSKSVVGGVLAQRDPMDL
A0A0F9W5Q6      -------------------PFSKDQQIL----ERGSKTKGNIQGSH----LLAATNPADL
A0A2H9T6C5      -------------------PVSEQNRLL----ERNSHKNGD---SC----LLACSAPDDL
A0A1J5SM24      -------------------PEIKKMEQP---------D----------KAQIVMNNADRQ
A0A3B1C7A9      -------------------PKIEGVETN---------KE---------FEFIIHEKSDSI
A0A1J5SPZ5      -------------------PEIGQIKDE---------D----------KYQLVLNNKPNP
A0A1W1DYN8      -------------------ALSAKQKLL---------NKDIITNKIK-HAILCEHDPQDS
A0A1W1E4Z5      -------------------ALSAKQKLL---------NKDIITNKIK-HAILCEHDPQDS
A0A0F9UWR4      -------------------PLVAKKQQK---------K----------VSHLFEKGDDMR
A0A0F9U8M8      -------------------PLSKNTAL---------------------DIRTFFDKEQQQ
A0A381Y0U7      -------------------PQN--------------------------VGSLLEEGDESP
A0A381Z3K5      -------------------PQN--------------------------VGSLLEEGDESP
A0A0F9LFA5      -------------------PHVQTPKN------------------SVFPIHAYLDDNYRR
A0A160TC29      -------------------PLIASGKRN---------KKIDPNKLDATLVRAFVEGSDHG
A0A1J5R1Y0      -------------------PLLKDHDH---------------------IGRRYLADPHSQ
S0DG33          SNLPFQRSAPDIDMRTGASAMSAAASYS---------GDN--------SRILAARFPHDT
A0A380TGM5      -------------------PV---ARSG---------RDG--------PEAAMLDSQPSL
A0A380TDI0      -------------------PLLTAAKGG---------GDR--------PETFILKRPDSA
A0A380TDN3      -------------------PLLTAAKGG---------GDR--------PETFILKRPDSA
A0A3B0VME9      -------------------PFKDAG---------------KTDDEFDEIALTFYNEPKAP
A0A3B1DSR1      -------------------PEFAPIATK---------ELKQIDSHKIAPELYYFHKPGSI
A0A0F9I1G8      -------------------PLAKSG------------------DYVL--DKAFVSEPRAP
J9FGR8          -------------------PFTGDK-------------KKKKDASQH--TILVKEGSRDM
A0A0W8FS74      -------------------PFITSR------------AENGEAKKRL--PLITRLEPKSQ
A0A3B0V744      -------------------PKHNLN------------------GKVA--KIIVDKHPKSA
A0A644WNK5      -------------------PMMKVS-----------------DNDKY--PTLSVYNDPLS
A0A1W1D4H7      -------------------PYNKDE------------------------------STENT
A0A3B1CUQ0      -------------------PLVQAEETK---------KPLSGGNSNS--GLITINSTKSI
A0A1W1BK27      -------------------PNKKHK---------------------------------RF
A0A1W1CD04      -------------------PPLKNE---------------------------------RF
                                                                            

A0A644ZI62      RAEAYRSLRTNLQFLGL---DRGKR-SIVVTSSVPGEGKTTTAINTASTLAAAG-ERVLL
T0ZG59          LAEAYRSARTALQFATA---DGVPR-SLLITSTRPGEGKSTTALALAQSFAQMG-RRVLL
A0A6J6XYC8      PAEAYRSLRTAVQFLAI---DRPIR-TVQVTSPRPSDGKTTTAANFAVAVARAG-KRVVL
A0A6J6U1T4      PAEAYRSLRTAVQFLAI---DRPIR-TVQVTSPRPGDGKTTTAANFAVAVARAG-KRVVL
A0A6J7LYN9      AVETYRRLRTGLQFIAL---ERPLT-TIQVTSALPGEGKTNTAANLALIFAQAG-KRVIL
A0A1J5RCY3      RAESFRRLRTNLQFIDV---AEQPK-TIVVTSSLPGEGKTTTSINLAITLADAG-ARVVL
A0A1J5RUE5      RAEGFRRLQANLQYLDV---GKPLS-SVVVTSAVPGEGKSTTALNLALAVAENG-KSVLV
A0A3B1C250      FAESVNHIRTSVMFSNI---DNPPK-IIMITSAMPSEGKSTLATNMALAYSNLG--KTLL
A0A0F9JKD8      FAENYKALRTAIMLSSA---ESTPK-TLLITSMGPAEGKTATAVNLALVVAQSV-GKVLL
A0A0F9XPI6      LAESFRILATNINYMLPKRKDGSGN-VIFVTSGYMGEGKSLLAYNLSVAYASIN-KKVLL
A0A3B1AK25      FSESIRTIRTAMLLSGL---DDPYK-VILVTSSVPGEGKSAVATTLAESMGELH--KVLL
A0A2H9TBF4      FVESVRTIRTGLNLSLMSVGQEAHKKIIAITSTMPGEGKSSVAANLSSALGQLG--SVVL
A0A0F9KY21      AIEALRSLRTSLHFAMI---EAKNN-IIAISGPSPSVGKSFISVNLASVLAQSG-KKVLI
A0A0F9VQU4      SLESLRGLRTSLHFTMM---DGRNN-RVMLTGPSPGVGKSFVSVNLGAISALAG-KKVLI
A0A0F9W5Q6      SIEALRSLRTSLHFAMM---EAKNN-ILMISGPSPSVGKSFISANLAAIVAQTG-QKVVL
A0A2H9T6C5      AVESLRSLRTNLAFAMM---EEKDS-RIMITGSSPTVGKSFVSANLALLLAESG-KKVLL
A0A1J5SM24      VAESFLTLHSSLRLKDE---SKNAK-VFLTTSTIPGEGKSFMTTNLALTFASHG-ERVLV
A0A3B1C7A9      YSEAFRVLRTRIQFSKL---NNGGVKVIHITSSTPQEGKTTIAINVAGSFAQTN-KRTII
A0A1J5SPZ5      GQESFLSVYSSVKIQSK---LDFPK-SILVTSTIPGEGKTLVSCNLAGAFARHG-RNTLL
A0A1W1DYN8      AIEGLRSLRTNLHFALL---EAKNN-IVMVTGPSPDIGKSFVSINFAHTIAQAG-QKVLL
A0A1W1E4Z5      AIEGLRSLRTNLHFALL---EAKNN-IVMVTGPSPDIGKSFVSINFAHTIAQAG-QKVLL
A0A0F9UWR4      FCEAVRTIRTSVMLADM---SRPQK-VIVITSSVPGEGKSSVAANMAFALGQLQ--RVLL
A0A0F9U8M8      FSEAVRTLRTGVVLSQM---DAENNKVIEVTSSIPGEGKTTTSINLAFSLGQIE--KVLL
A0A381Y0U7      HAEAYRVLRTNILFAGR---KSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG-DRILI
A0A381Z3K5      HAEAYRVLRTNILFAGR---KSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG-DRILI
A0A0F9LFA5      FAESVRTFRTSLLLTQL---ERDHK-VIAVTSSSPGEGKTTTSANLAMSLAQMG--KVLL
A0A160TC29      FQESIRTLRTSLTLASL---ENKAQ-VMLFTSSVPGEGKTTTSTNLAEAFGQME--KVVL
A0A1J5R1Y0      FAEAVRTARTGVLLSAI---DQPHK-IVVVTSSLPGEGKTTFAANLALAHAQTK--RVLL
S0DG33          SVEALRAVRTAVTRDLA---HARNN-ILMVIGPTPSAGKSFVAANLAILHAEIG-SRVVL
A0A380TGM5      FLEGIRSTYIQLALRSK---RPAIR-SLLVTSSMPKEGKTTLAIGLTRARAIAG-HRALL
A0A380TDI0      YAEAIRSLRTRLLLAFG---DRPPQ-VVVLTSAEPDEGKSTLGLSLVRAQAQAD-RRTLL
A0A380TDN3      YAEAIRSLRTRLLLAFG---DRPPQ-VLVLTSAEPDEGKSTLGLSLVRAQAQAD-RRTLL
A0A3B0VME9      LSEAIRTAMVAINLSTA---ATP-PKTVLITSVLPDAGKSTLASNLSLSLLASS-AKVLL
A0A3B1DSR1      EAESFRSVRTALYVIAA---SDK-AQVIQVTSPLSGDGKTTLIGNLAVAMANSG-KSVLL
A0A0F9I1G8      ISEAIRTTKVSLQLSGA---DAL-SKCFMITSTAPEEGKTTLAANLAFAFAGSE-EKVLL
J9FGR8          LNEAFRVMRSNLDFMSG---DTTQSQVFITTSFNPGSGKSFLTINMGMSFVLKG-KKVML
A0A0W8FS74      VAEAFRSLRTSLHFSAI---NRD-KKIILITSTFPGEGKSIITANLSNTMAQTG-VKVLV
A0A3B0V744      VSEALRSIRTNIEFMIP---DKD-SKVLSVTSTIGSEGKTFISTNLGALLAMAG-KKTVI
A0A644WNK5      FESERFKLVANMLYNKT---DKK---VFSITSCAMAEGKSTIIGNVALALAQMG-SKVLV
A0A1W1D4H7      YKEAFRNLRTNLQFLPE---SKN-HKIISITSSISGEGKTTISTTLGEMLAKGD-KKVIL
A0A3B1CUQ0      TAESFRSLRTNLQFAVP---EKR-GRVFHFTSTMQGEGKTTITANLGVTLALMG-SRTLI
A0A1W1BK27      FEEAMRVIRTNLQFIIP---KDKQCISILVSSTVPGEGKTTVIANLAHIIAQSNQKRVLI
A0A1W1CD04      FKEALRSIRTNLQFVIS---KNG-CTKILISSTVPQEGKTTISAGLAKIISEAD-KKVLL
                  .        :               .   .     **:                  ::

A0A644ZI62      IDADLRRPKVARYLSV--E-GGVGLTTVL-IGEAQLGDVVQPCGVND---------LHVV
T0ZG59          VDADMRNPAQHNLGTV--D-NSRGLSNVL-AGALTWREAVVG---GE-------NGPALL
A0A6J6XYC8      VDCDLRNPRVHRCFGL--S-NEHGFTSLL-LGEGTFEGIGQRIP-GE-------PNLLVV
A0A6J6U1T4      VDCDLRNPRVHRCFGL--S-NEHGFTSLL-LGEGTFEGVGQRIP-GE-------PNLLVV
A0A6J7LYN9      VDADLRRPRIHHVFGI--Q-ASPGLTNGV-LGEP-LAPLMHPIAVGE-------STLQVL
A0A1J5RCY3      VDADLRRPSVAEYMGL--E-GSVGLTTVL-IGRAAVLDVVQPWGNGQ---------LHVL
A0A1J5RUE5      IDADLRRPAIALDTGL--E-AAAGLTTIL-IGRATLEDVVQPWGEHD-------G-LHVL
A0A3B1C250      IDADLRKHSLTEFLDS--NSNGLGLTDLV-SGQNTFQDCIRRLKLS--------KNLYIL
A0A0F9JKD8      VDTDLRKPRIHNIFGF--S-NKSGLSTYL-VGSNA--KIIKEG--PS-------PNINIV
A0A0F9XPI6      IDADLRSPEQHKYFKM--DRNTKGLTDYLKEEEINWKSFIFSGLEKS-------KNHHVC
A0A3B1AK25      IDADMRRPTIAKTWDF--DPRSPGLSEFI-AESAQLSECVYQI--QD-------SNVHIM
A0A2H9TBF4      VDGDLRRPTVGKNFSI--KGGSAGLANLL-SGHAQMNECLHPR-----------NSIMVM
A0A0F9KY21      IDADMRKGYLQTQFGL--K-WDDGLSDYL-SGRLNLEQVTKPT--KV-------EGLSVI
A0A0F9VQU4      VDADLRKGNLHHAFGQ--A-STGGLVEFL-SGELTLEDIIKPT--GI-------PHYDVI
A0A0F9W5Q6      LDGDMRKGYVHKLLNR--E-PEPGLSNML-VSTHALADIVHKT--EV-------ENLHFI
A0A2H9T6C5      IDADMRKGRLHHYFAV--H-RGKGLSDIL-AGNADSSAI--RG--IN-------EKCHLL
A0A1J5SM24      VDCDLRKPNIHKSFRL--E-NLKGVIDVV-TGTAKLDDVIVKG--VY-------PNLDVL
A0A3B1C7A9      VDCDLRKPRVHTVFKE--Q-RFPGFTDYF-LGHTDLESVIHKS--KL-------PNLDFI
A0A1J5SPZ5      IDCDLRRPMLHRHYKQ--A-NNNGLISWY-ENGADLESDLLGN--PHLGIVKIGENLSLL
A0A1W1DYN8      IDADMRKGHIHKEYNL--S-RSPGLSELI-TNQVDKKVAVHNS--EF-------KNIDIL
A0A1W1E4Z5      IDADMRKGHIHKEYNL--S-RSPGLSELI-TNQVDKKVAVHNS--EF-------KNIDIL
A0A0F9UWR4      IDADLRRPTLARNFDF--PVGTPGLANLI-AGTAKVEDCIQTV--D--------AQLDML
A0A0F9U8M8      IDADMRKPSICKRFDM--PTYHPGLSNFI-AGTDTLENCLYQD--EQ-------SGITVM
A0A381Y0U7      VDSDLRRPSMHRYLKV--S-NNIGLTNYL-LGQVAIDEVIQTT--EL-------PSLHFI
A0A381Z3K5      VDSDLRRPSMHRYLKV--S-NNIGLTNYL-LGQVAIDEVIQTT--EL-------PSLHFI
A0A0F9LFA5      IDADLRKPSIAKRFDI--PVFHPGLSNLI-VGTEQLSECIHVD--VQ-------SGVTIM
A0A160TC29      IDADMRRPTVARKLNM--PPNSRGLSNAV-AYPETLDDCIHHV--AD-------LGIDVI
A0A1J5R1Y0      IDADMRKPRLGRELGL--DDDLVGLSSLA-SGEREAKDCMRSV--PE-------STLQVI
S0DG33          IDADMRRGHLASLFD---ESNRGGLSEVL-SERMALRNALRTT--GV-------DGLTFL
A0A380TGM5      IDADLRRPSVHVRLK---LAREPGLVDLL-VGDASLEQVLQRD--EP-------TGAFVI
A0A380TDI0      IDADFRRSRLTTRITG--ISAQPGLYEVL-SGQATAEDAIQSD--PT-------SLADLM
A0A380TDN3      IDADFRRSRLTTRIPG--ISAQPGLYEVL-SGQATAADAIQSD--PA-------SLADLM
A0A3B0VME9      IDTDLRKPGLHKIFGQ--KDNSIGLSSFL-AGTADIDEVIMKT--EF-------PNLFFI
A0A3B1DSR1      IDADMRHRSVHLLFGL--R-HNIGVSDVL-TGEIEFLNAVQKT--GF-------KNLSAL
A0A0F9I1G8      MDADLRKPHLHKIFTQWSDGTRPGLSSYL-AGVID-KNLIQKT--DI-------DNLWFV
J9FGR8          IDGDMRHGSLSAYAGS--P--KKGLSNYL-SGQAATWQEVTVDHPHN-------PNLKLI
A0A0W8FS74      VDCDLRRSSLHDKFGV--N-KVPGLSEVL-TGDTTFREVLHDT--GI-------PGIDVI
A0A3B0V744      VDLDLRKPKIHLAFEQ--KENANGVSSIL-IGKGKIEECIQNS--TI-------QNLDFI
A0A644WNK5      IDGDLRLPSMERYFRL--KHREIGLVDFV-TKKTRLEDCLIQPFENT-------PTLHLL
A0A1W1D4H7      LDLDLRKSSFHTEFEV--K-NDVGVSNYL-IAQNKLSEIIQTT--NI-------ENLDII
A0A3B1CUQ0      IDLDLRKPRIHHIFDI--N-REPGITHLL-AGKSDFKEIIRPT--AT-------EHLYVI
A0A1W1BK27      MDLDLRKPRLYQELNK--S-NKLGMTQYL-TGDFELESCIQEV--N--------EHLDFF
A0A1W1CD04      VDLDLRKAKLHQELKQ--K-NRMGMSNYL-SGDIEIIDIIKPL--P--------NNLDFI
                :* *:*                 *.                                   

A0A644ZI62      AAGALPPNPAELLGLPQMQQLLAEASRRYDTVIIDAPPLLPVTDAAVLSRITDGTLVVVG
T0ZG59          ACGPLPPNPAELLAGPRLATLLAEAQAEYDLVILDSPPVLGLADAPVLGHCAAGTLLVIE
A0A6J6XYC8      PSGPIPPDPSELLSGKRAQALLASMADVADLVVIDSPPVLAVSDPLVLSAVADGVILVAS
A0A6J6U1T4      PSGPIPPDPSELLSGKRAQALLAGIADVADLVVIDSPPVLAVSDPLVLSAVADGVILVAS
A0A6J7LYN9      ASGTIPGNPSEMLGSSRMRAVLAELQASADVVIIDSAPVLPVTDSVVLAGLVDAVVLVTE
A0A1J5RCY3      PSGQIPPNPSELLGSRAMVTLLDKLAQLYDLVLIDTPPLLPVTDAAILSRLTGGALVVVG
A0A1J5RUE5      TSGEIPPNPSQLLDSPAMHRVLDEAVKTYDLVVVDCPPVLPVVDASVLGRHVDGVLLVIG
A0A3B1C250      TSGATPPNPLEFLSSRRLANTFNQVKKAFDTIIIDTPPILLFSDAMVVGQLVDCCILSIR
A0A0F9JKD8      TSGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVLTVTDSLVLSKYVDGTIVVAR
A0A0F9XPI6      LSGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTLFVIR
A0A3B1AK25      PSGTVPPNPLALLSSNRFTTALDHLGKNFDHIIIDSAPCLAVSDALVLSRCASGVILVVK
A0A2H9TBF4      PAGMMPPDPTQLFAEEKFKNVLSQLSERFDTVIMDCPPMQGISDTLMISQLCDAVVYVVE
A0A0F9KY21      TRGQIPPNPSELLMHSNFSKLVEEVSTAYDIIIVDTPPILAVTDPAIVSAHCGTTLLVAR
A0A0F9VQU4      TRGVSASNPSELLMRPGFEQALEDLSEMYDMVIVDTPPVLAVTDACVAGKHCGTTLLVTR
A0A0F9W5Q6      SRGQIPPNPSELLMHANFETLLKKLSSMYDLVIVDTPPVLAVTDAALVGRLAGTSLIVTR
A0A2H9T6C5      TAGRIPPNPSELLMSQSFSAFLEKASDVYDVVLVDTPPILAVTDAAIIGRQCSQTFLVAW
A0A1J5SM24      TTGGRAKNPTQILNSKDFELMISDLKKRYDRVFVDSPPLAAVSDAMIILPLCDGSLFTIF
A0A3B1C7A9      TCGTIPPNPSEILGSQQMVDLLARLKTKYDLIVLDSPPIIAVTDSEILSRIADTTILVAA
A0A1J5SPZ5      CSGGRSKTPSELLESNTFAQLLERLKRRFDLIVVDSPPLGAVTDSLLIAERIDEVIYVCR
A0A1W1DYN8      TTGALPPNPSELLMHKNFGQYLTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLH
A0A1W1E4Z5      TTGALPPNPSELLMHKNFGRYLTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLH
A0A0F9UWR4      TAGAVPPNPLELLASPRFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVIYVIK
A0A0F9U8M8      PCGQLPPNPLELLSSNKFSKVIEQLKEKFDRIIIDTAPIQAVSDSLMISKSVDSVIYVVK
A0A381Y0U7      PSGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQ
A0A381Z3K5      PSGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQ
A0A0F9LFA5      PSGQIPSNPLELLSNARFSEVIDDFKAQYDHIIIDTPPTQAVSDALVIAQSVDSVIYVVK
A0A160TC29      PAGPIPPNPLELLASKNFSALLETLKGRYDRIIIDSAPTHAVSDATYLSTLVDGVVYVVK
A0A1J5R1Y0      TAGAVPPNPLELLLSQRFQETIAALSREFDLVILDSPPVHLVSDAIILSTLATGVVFVMK
S0DG33          SCGLRPENPAALLMKPRFKDVLERLAGQFDLVIIDTPPFLAVTDASIIANEAGASLLVLR
A0A380TGM5      ASGSAARDPSDLLGSKAVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETVFVIQ
A0A380TDI0      VSGASSADRKVLGDAARLEGLLAKLRGRYDLIVIDAPPALALAEGQVIPMVADATLLVVR
A0A380TDN3      VSGSSSADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATLLVVR
A0A3B0VME9      PSGPIPPSPAELLASSTMRAFIAAAAREYDYLILDAPPFHGFAEILILSNMVDGVILTTQ
A0A3B1DSR1      TAGEEPENPAELLASPTFKKMLSEAKSQFDFILIDTPPLLAVSDPCIVAPQTDGLLLILR
A0A0F9I1G8      PSGPIPPNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVVLVSS
J9FGR8          PVGTVPPNPTELLENGKLARLVDALKAEFDYIFIDCPPVDIIADTQIIAQVADRTLFVVR
A0A0W8FS74      TAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVLLIME
A0A3B0V744      TAGAIPPNPSELILRKEFGEMIENLKLKYEVVILDTPPVGLVTDGLLAMQKADLPLYVIK
A0A644WNK5      PPGNAPLVPAAIFSNPRYIQGLSYLENLYDFIIIDAPPLESASELLSISKHVDGLIITVR
A0A1W1D4H7      PTGPLPPNPSELILSKAFTKMLEVLKKKYDYIIIDTPPAGLVTDAIIVMNYSDLSLFLVR
A0A3B1CUQ0      PAGIIPPNPSELLSQQDLRDFLDKTRKEFDYILIDSPPVLPVTDSLLLGRLADASFIIIK
A0A1W1BK27      PAGAIPPNPSELLMSEKFDKTIKKLFLTYDYILFDTSPIGSIIDAKILLPYSDIVLLVVR
A0A1W1CD04      SAGAKPPNPSELLMSEKFNKAINELEKHYDYIIFDTAPIGIVTDANMILKHTDIVLLIVK
                  *  .     :         .       : :..* .*     :           .    

A0A644ZI62      SSIARRPELAKALEALERVDTRILGLLLTRARGHD-----------------AG------
T0ZG59          AGGARIDHIRDALKRLRAARARVVGAAITKLDARH-----------------GAYGYGY-
A0A6J6XYC8      VGNSDRNQIAKAVSQLRQVDSPLIGAVLNRFRGDS-----------------STYGYGY-
A0A6J6U1T4      VGNSDRNQIAKALSQLRQVDSPLIGAVLNRFKGDS-----------------STYGYGY-
A0A6J7LYN9      AHHTSRRELASAIETLNRVGAPLVGLVLNRLEAKR-----------------SPYGYGY-
A0A1J5RCY3      AGKLQRQQLAEAMGALETVGARVLGLVL-NRLAKT-----------------PSDSYTYY
A0A1J5RUE5      LRQVRRQQVRSALAAITAVGATPLGLVITNAVDDG-----------------AGAPYSYR
A0A3B1C250      SDQTTHNMAQDAVKRLTSSQLKPLGVVLSYANTKG---------GKSYGGYYGDY-YGD-
A0A0F9JKD8      AAKTSYEAVRKGLRQLNDVGSNVLGLLINAIDARK-------------GGYYYNYYYYH-
A0A0F9XPI6      AGVTDKAILHGASEDSHRDKLKNMAYVLNDVHARN----------------------IK-
A0A3B1AK25      ADATPYPVAQDAIKRLHQSNARIIGGVLNNVSKSK---------KGGYG----NYGKYS-
A0A2H9TBF4      AGRASKTAISHSTGRLLQNSVPLTGVVLNKVNTRR---------GHEDG----YYGYYD-
A0A0F9KY21      FGQNHVREIELTRNRFEQNGIDVKGVVFNGVVKKA---------SN-------AYGYYG-
A0A0F9VQU4      FDRNSVREILMAKKRLESSGLEIQGAILNGV-KIS---------SRG------ASGYYG-
A0A0F9W5Q6      FGLNPVREIEQTLQRFRNNGVDIKGAIFNAVEKKA---------SAY------GYGNYG-
A0A2H9T6C5      AEKNTASEISYAAKRLQQAKVNVKGCILNGMVHTS---------SR--------YGQYG-
A0A1J5SM24      FNKVRRKAAQFVAHKLTDSNVPNFGAVLNGLNLAV---------S--------GYYYAQ-
A0A3B1C7A9      SGETEIELLKKSAELLQHDSDSFIGVVLNKFTFKS------------------GYGSYY-
A0A1J5SPZ5      FNRAYRKHIKLYIKALRSGKNEILGIVLNGLSPRR---------IEYYS----NYRYYR-
A0A1W1DYN8      YGMHSMSEIRATINRLRQNNIETKGFIFNGIKAHG------------------GYGKYA-
A0A1W1E4Z5      YGMHSMSEIRATINRLRQNNIETKGFIFNGIKAHG------------------GYGKYA-
A0A0F9UWR4      SESTSISMAQKGVGQLLQSGASIVGVVLNQVDVKK---------AAKKG-EYSGY-----
A0A0F9U8M8      SDDTHLSIIKNGIGRLLQDKAKLAGVVLNHVDTDK---------VAKTQ-GYNGY-----
A0A381Y0U7      YRKYPQLMTQRAKGMVTKVGGELVGVVLNNINISQ---------DSYYY-YYSGY-----
A0A381Z3K5      YRKYPQLMTQRAKGMVTKVGGELVGVVLNNINISQ---------DSYYY-YYSGY-----
A0A0F9LFA5      SDITRIKPIKAGIERLFEAKAHVAGIVLNQVDMSK---------SKDEHSH--GY-----
A0A160TC29      ADETKDKLITSGIARLHDSNARILGVLLNQMDVEK---------EARYGGHYSGY-----
A0A1J5R1Y0      ANSTPYQVAQRCLRALQGAKATLFGVVLNQLDFKK---------AESHYGDYSGYGSYG-
S0DG33          SGMQSEEEIADTVKKMERAEGRISGAVFNGIPLRR---------STRNY----GY-ETN-
A0A380TGM5      WGKTGREVVKLALEKLTETQGVPRGIVLSRVDTAK----------IRLY----GYGDAA-
A0A380TDI0      WGKTRKRVVRYTMDQLTRFGMPLHGVVLNMVDVRK----------QAYY----GYGDAG-
A0A380TDN3      WGKTRKRVVRYTMDQLTRFGMPLHGVVLNMVDVRK----------QAYY----GYGDAG-
A0A3B0VME9      LNRTPRDGVEYFRKAVTNVGGRILGTLVNKVPTGK-----------TGSRYYGGYKYYK-
A0A3B1DSR1      LKKDSRADITRAAELLDTHNIDVLGAIVNGVEISP---------------DEQTYGNYY-
A0A0F9I1G8      IGETTRDALRHFKKGILNVQGTILGCIINKVNLTK------------RYGYRAYYKYYQ-
J9FGR8          AGLLDRSMLPVLQGMYDDKRFQGMAMILNGTESSR-------------GRYSYRYGYYY-
A0A0W8FS74      AGRVPIKAAQHMREMLSNVQAPVAGFVLNDKTGSGETYGYYGSRYYRYGRYGKGYGYGY-
A0A3B0V744      ADFSKRSFVQNVNRVLATGQFNNLSIILNATTTSE----------------T---GYGY-
A0A644WNK5      AGITSKGSLYDLVSNLRTANAPLIGFVFNGVIPGT----------------TSSYGYGY-
A0A1W1D4H7      ANYTKKEFIKNIDKLVKEYKENRVGIIFNGATINS----------------Q--YGYY--
A0A3B1CUQ0      LGETSFPAVEQAVKQLRSVDVNVAGAIINKIKPSA----------------G--YGYYH-
A0A1W1BK27      ANVAEKGFIEHFNNLRKETEIQSSGIILNDVKHDK----------------SSSYGYGY-
A0A1W1CD04      AGSAEKDFINNFNKMVKDKNIESSGIILNGVKISK----------------GKNYGYGY-
                                        .  .                                

A0A644ZI62      ------------------HYRYDYSYQPTTRGQGPVIEQISDAHEPPARAARRSDSWAVV
T0ZG59          ---------------NSYDYGDAYGGKTSRRNA---------------------------
A0A6J6XYC8      --------------------GYGYGAQNTQDAAKKSAKSSGSKTEDVSPSLIGSNDNN--
A0A6J6U1T4      ------------------GYGYGYGVKNTQDAAKKSAKKSSNKAKEPSPTLIGSNDNN--
A0A6J7LYN9      ------------------GYGKTYGAE---------TTTPETTKKSVLFGLLRGSR----
A0A1J5RCY3      ------------------DYSTETGSTVTKKRSRTAASTSETQRPPAHTGSRRLVPRTGQ
A0A1J5RUE5      RPDEIRPHRSQPWRRRRPDEIRQNGADADVDAAVSSTAGPEDPRTPISPEPRE--ARASA
A0A3B1C250      ------------------YYGAEFDEDEDDFITKKSNKSRRGKRKGRSLATVGGIALALT
A0A0F9JKD8      ------------------DYNYYYSAKDEEGEE---------------------------
A0A0F9XPI6      ------------------SYNYGYGEV---------------------------------
A0A3B1AK25      ------------------YYDGCYYGSYGYTND---------------------------
A0A2H9TBF4      ------------------YHGYSDGHQDNKKHPDAQGKRIKTAEIEPESVV---------
A0A0F9KY21      ------------------YYNYEYKSDK--------------------------------
A0A0F9VQU4      ------------------YGTYKYQ-----------------------------------
A0A0F9W5Q6      ------------------YYQYEYKSDGK-------------------------------
A0A2H9T6C5      ------------------YYHYAYGDKA--------------------------------
A0A1J5SM24      ------------------YYDKTYKDYYVVMAKQDPDTPER-------------------
A0A3B1C7A9      ------------------KYYYYYSNNKDAKKKKFFSKKT--------------------
A0A1J5SPZ5      ------------------SYKKYYGAQT--------------------------------
A0A1W1DYN8      ------------------HYHYEYKTQE--------------------------------
A0A1W1E4Z5      ------------------HYHYEYKTQE--------------------------------
A0A0F9UWR4      ------------------YDHYGYSEQNA-------------------------------
A0A0F9U8M8      ------------------YDYYSYGKKNT-------------------------------
A0A381Y0U7      ------------------YYDYYYKSREKEESADETQDGEKEAKLVANADIGGEDEKPKY
A0A381Z3K5      ------------------YYDYYYKSREKEESADETQDGEKEAKLVANADIGGEDEKPKY
A0A0F9LFA5      ------------------YDYYDYSQKPEQPNA---------------------------
A0A160TC29      ------------------YDGYGYTTTEQS------------------------------
A0A1J5R1Y0      ------------------KDAAGYYMKESS------------------------------
S0DG33          ------------------YASDVGDLEATR------------------------------
A0A380TGM5      ------------------YYDRTVREYYTRGSA---------------------------
A0A380TDI0      ------------------YYYGKRAKYYTS------------------------------
A0A380TDN3      ------------------YYYGKRAKYYTS------------------------------
A0A3B0VME9      ------------------YYSYDYEYGRDA------------------------------
A0A3B1DSR1      ------------------SSEQQEETKNNLAEAMVSQS----------------------
A0A0F9I1G8      ------------------AYNYDYGEDNKRKRVKKLKSDREK------------------
J9FGR8          ------------------GHGNYYSQQ---------------------------------
A0A0W8FS74      ------------------GYGYGYYSDDEPNRCKNPQRWEKVLNFIPEKLRKEIKKRFKF
A0A3B0V744      ------------------GKKSAYYET---------------------------------
A0A644WNK5      ------------------GRGYGYGYSAYRYGYAQGQSGSRKKSKSHSRRRSTSWYRKRY
A0A1W1D4H7      ------------------GY-YNYYK----------------------------------
A0A3B1CUQ0      ------------------NY-YHYYYGDESPEEKKNT-----------------------
A0A1W1BK27      ------------------GYGYGV------------------------------------
A0A1W1CD04      ------------------GYGYGYGYGEE-------------------------------
                                                                            

A0A644ZI62      G-----------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      IRAVSAAEVAPRGEIDDPMGDLFPPTGPQRTSAWPGERMSGGTTEDWSSHQV--------
A0A1J5RUE5      VQNANAAADAPDADV-------------------PAGGDGQNRKKNVASPTA--------
A0A3B1C250      IIAYFLWNPDKSLLSALPTLDIGIGSTAEEPKGEALSKPWSPQTGAKGDPSVKPEPAQKN
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      KQDLRNRGKISSEQFDPILAFGEHAEYRTLEAWAQEHATTHSTAFTEARTSVFADLPPSN
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      SRTMKPNKPKAKPTAKKQPIAKFSTPRSGSAKPKPIPAILTLPAADGKSLQGKRVEIVAS
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      VESKPASPQQKPKAVLPTVELDGLGAIEKDPDAVGKKQEE--------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      STTGDTRVTGGGFGSSTAAGDMSKWIGEGWEKMNTEGIEAACPVWEAGLRSSTAESVVLI
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
T0ZG59          ------------------------------------------------------------
A0A6J6XYC8      ------------------------------------------------------------
A0A6J6U1T4      ------------------------------------------------------------
A0A6J7LYN9      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      VGRYSGLTKAKVPLELLGEELPIFAVCAKYRGKNAYYVLAAPSPANLKKTQKIIRSRLNI
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      -------------------
T0ZG59          -------------------
A0A6J6XYC8      -------------------
A0A6J6U1T4      -------------------
A0A6J7LYN9      -------------------
A0A1J5RCY3      -------------------
A0A1J5RUE5      -------------------
A0A3B1C250      KSVKGNYPQKLVRIIDRGR
A0A0F9JKD8      -------------------
A0A0F9XPI6      -------------------
A0A3B1AK25      -------------------
A0A2H9TBF4      -------------------
A0A0F9KY21      -------------------
A0A0F9VQU4      -------------------
A0A0F9W5Q6      -------------------
A0A2H9T6C5      -------------------
A0A1J5SM24      -------------------
A0A3B1C7A9      -------------------
A0A1J5SPZ5      -------------------
A0A1W1DYN8      -------------------
A0A1W1E4Z5      -------------------
A0A0F9UWR4      -------------------
A0A0F9U8M8      -------------------
A0A381Y0U7      -------------------
A0A381Z3K5      -------------------
A0A0F9LFA5      -------------------
A0A160TC29      -------------------
A0A1J5R1Y0      -------------------
S0DG33          -------------------
A0A380TGM5      -------------------
A0A380TDI0      -------------------
A0A380TDN3      -------------------
A0A3B0VME9      -------------------
A0A3B1DSR1      -------------------
A0A0F9I1G8      -------------------
J9FGR8          -------------------
A0A0W8FS74      -------------------
A0A3B0V744      -------------------
A0A644WNK5      -------------------
A0A1W1D4H7      -------------------
A0A3B1CUQ0      -------------------
A0A1W1BK27      -------------------
A0A1W1CD04      -------------------
                                   

© 1998-2021Legal notice