BYKdb

Dataset for cluster tadcd of phylum metagenomes

[Download (right click)] [Edit] [Sequences] [Repertoires]

40 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A644ZI62      ---------------------------------------MELTLLDYLSLLRKYWRSIAA
A0A1J5RCY3      -----------------------------------MQGQALVELHDYLTIVRKRWVSILV
A0A1J5RUE5      ---------------------------------------MPVELDEYVLALRKRWLIIAA
A0A3B1C250      --------------MPGYNKDENSGGYVEPYQNSSDADGDEINLSEYWYTIKRNKWGILG
T0ZG59          ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------MQQQEIHLRDYFRILRKRRHVVLT
A0A0F9XPI6      -------------------------MTETPFNLDYDQKQDRFDLGEILKKYIKYWPWFAA
A0A3B1AK25      ---------------------------MQENKAQQPLEEDEIDLREYWRVIMRHKSSIFG
A0A2H9TBF4      -----------MQQSTDVSAQG----------TAASQDEDIIDLRSLFTTLFHYRWAILG
A0A0F9KY21      --MVKLMNSKPIAPTNDQNKSS----------------AQEIDLLALLGTLLDRKYFIVL
A0A0F9VQU4      --MTESVAIEPMSDLSQKSLPE-----------------ETIDLSRLFGALFRKKWLIIG
A0A0F9W5Q6      ---------MQTTSAPTANETS-----------------DEIDLLALLGALIDHKLTIIA
A0A2H9T6C5      -------MPNEMTQSRPTVADD-----------------DVISLSEILDILIKGKWWIAG
A0A1J5SM24      --MESPEKQQTPSKSSNYGGYAGYGAPYGYGYGPSEGGAGQRTFQDYVLILRERAWYIVA
A0A3B1C7A9      ------------------MDNE----------FDNNIQEETHSIKDYFNLIRINIIPILL
A0A1J5SPZ5      --MSDVPQQTPPPKPPPPPAAA----------REEDEIVERRTLRDYYIILRERFWIAFP
A0A1W1DYN8      -------------MDTLINTSS----------NLSTDSNEEIDLQELFGTLVEKKWLIAI
A0A1W1E4Z5      -------------MDTLINTSS----------NLSTDSNEEIDLQELFGTLVEKKWLIAI
A0A0F9UWR4      ---------MNSSIRPDRQWQP----------MPSDDDTDYIDLKKIWYAIWSRKWSIIS
A0A0F9U8M8      --------MNTSSNTFLET-------------------NNTLDLKRYLHACMEYKWRLIF
A0A381Y0U7      -----------MDKIPSTEQSL----------PSTEQSSDKLHILDYWRIIRVRFVVILL
A0A381Z3K5      -----------MDKTPS-----------------TDQSSDRLHIMDYWRIIRVRFVVILL
A0A0F9LFA5      --------MNQTNENLSNN-------------------EEIIDLGSYLNVIKRAKWRILG
A0A160TC29      --------MNNAAA------------------------VEVIDLTHYWHVIRRQMRKIMA
A0A1J5R1Y0      --------MDTPTANPAHTTIQ----------GAAQLSEEKLELLTYWRTFVKHKLTIFS
S0DG33          -----MDDYPMNSLYPAASTER----------GQLSASGMLTLMRD-------HIWEIVV
A0A380TGM5      ---MQMDRPNLTPAYPSVWAAE----------R-------SYDIRELTRIVRRRKSIVIG
A0A380TDI0      ------MDQRLTTATQSEPAEP----------RRRPLAALDSELRETIRSFWRHKWAILG
A0A380TDN3      ------MDQRLTTATQSEPAEP----------RRRPLAALDSELRETIRSFWRHKWAILG
A0A3B0VME9      MNNQTEPIDNAGEDRQTMVPAGDTHLPSTRVHEIMPPVEEEINLRDYLDVILRRRWVIIL
A0A3B1DSR1      ----------------------MNTQNNLSEFDQTGLTESSGFEIDLLSLASRHWKLLLL
A0A0F9I1G8      --------DLPIAPAPVRRDNEEMLPSTEFRQAAPDWEGEEVHLRDYLEVIARRKWLIFG
J9FGR8          --------------------------MTDQKKLAQNAANEFAWVTDLWGMFAPRWIWFLA
A0A0W8FS74      ----------------------MTPNVSIPPSQPLLRSGENAHIYDYLSVILRRRKLFTL
A0A3B0V744      ---------HDYPLNFGVKIMVQFNQNIGNNPPALEEENHDIDWIKLRLILRKGIPWFIT
A0A644WNK5      ---------------------MSQQEELQNTLAPYDSGEEGISIAELLHIFRKRFRWFVI
A0A1W1D4H7      ---------------------MNTMDNKYN-----DEFDDEIDLRELYKTLLKHKISIFL
A0A3B1CUQ0      ---------------------MSQLEHT-D-----DVEEREIHLNDYIEVLLRKKWIVIS
A0A1W1BK27      --------------------------MQNI-----QIEEDEIDLSQLFSTLKKNFFTIVF
A0A1W1CD04      ----------------------------MN-----EIEEDEIDLRELIDKLKNSLTTIVI
                                                                            

A0A644ZI62      ITLVAISLAATYCLLVQPTYTSKASLFFSVNSANSASDL-------NAGSSYAESQVQSF
A0A1J5RCY3      ATALSLVVAIGVTLLATPTYQASAQVFVSVNSAGTTADL-------LQGSNYSQQQVASY
A0A1J5RUE5      LALVGAVTGWLYAHSMTPNYRATANVFVSVNGGGTAGEL-------VQGSTFVQNSVESF
A0A3B1C250      LAFVATLIGVLTAFSMKPIYRASVTILIE------PEQPKFVSVIPMESGSNINYFYATQ
T0ZG59          -------IALILTLLATPIFRADTTLQINRDTVNVVQVQGFQPV----ESLNDQTFYQTQ
A0A0F9JKD8      FFFITLALVILFTFTASPLYKADTRLLIEKSEQ--------YTITEYGFTVYDPEFYSTQ
A0A0F9XPI6      SFLLTLAFAVFYLLSTAKIYESVAKIKIV----DNSTDIGLQSNAMSLFTNGSTINLDNQ
A0A3B1AK25      LAFLAAILSALVVFAMKPIYSSTVTLLIE-PGS--ANVVSIEDVY---GDSDTSTYYKTQ
A0A2H9TBF4      FTLIVTLLTVLVVFSITPKYQATAVLLIE-QEQ--AKVVSIEEV--YGIDGGGDSYLNTQ
A0A0F9KY21      FTAVFAVIGVAVAIFSTPIYKATALIQVE-ESS--PSVPGLDDMA---GMFESSSEAVTE
A0A0F9VQU4      VTLLFAFIGIVHGMLSTPVYRADALVQVE-RRNTVSPFGNVDNVTGSG---SGELNTSAE
A0A0F9W5Q6      CTLVFAVCGIAYALLSTPIYQANAVIQIE-EKS--QGIGSLLGDAAGGEMFSSASAATTE
A0A2H9T6C5      ATLFFAVCSLAYLWVATPVFQSDALVQVE-SQK--SPVGALVDMS---DMLGSESPSEAE
A0A1J5SM24      VFLVVFSTALIITLSKTKIYESSASVQIF-RRD--PVIMQTQAV--MDNEVRSAEDLNTQ
A0A3B1C7A9      IGLTGLAVSVIYAFTARDIYTASTALKIQKPQA--GGILSSPLLP-EISDFGNDRFIANE
A0A1J5SPZ5      LALLVSLGVGYYQSRQTPMYMSTATMQFE--KP--DRIVTTEGV--TNPAVQSEIDINTN
A0A1W1DYN8      ITSIIFMASVFYVLIATPVYRADTVLQVE-DKS--NNMLNLSDL----TNFSASSPTSTE
A0A1W1E4Z5      ITSIIFMASVFYVLIATPVYRADTVLQVE-DKS--NNMLNLSDL----TNFSASSPTSTE
A0A0F9UWR4      LVVVVSMLATLAVMQMTPVYRASTTMMIE-GKG--NQLVAFQQV--YDNTGQLNEYLQTQ
A0A0F9U8M8      ISSLISVIAAFVVMQIKPTYESTATLLIE-PEQ--KNVVSIDEM--YGFNTAKREFYSTQ
A0A381Y0U7      VFLITAVTTTVVTFLLPPTYMSLSRISVE-KET--SDIAPLLGMQ-SGPTAFDPYFIQTE
A0A381Z3K5      VFLITAVTTTVVTFLIPPTYMSLSRISIE-KDT--SDIAPLLGMQ-SGPMAFDPYFIQTE
A0A0F9LFA5      FATVVTLLAIMVALTLIPKYVATATLLIE-AEQ--TKAVSFDEI--YGLDSTKKEYYLTQ
A0A160TC29      LSVIATIVAVLVALVMTPIYRATATLLIE-SEE--AKILSIEEV--YGLSGQSSEYFLTQ
A0A1J5R1Y0      LALAVGILAAVVVYMMRPIYRATAMIQLE-DNN--AKVLSIEQV--YSSLAHGSEHVQTQ
S0DG33          TTVVVLTLAVAYLLIATPIYSADVLIRVD-PPE--PNALGLALQD-QEALPPPAPAPVTE
A0A380TGM5      TVTLILALTVFFLSQLTPTYRAEALVIVE-SRK--ANIADLR-EI-LTDVSANQETTRNE
A0A380TDI0      VVVLLTGIAVLYVQTATPRYTAELQVVFE-NKT--GPLFDFQ-AA-VAGAPQDEASILTE
A0A380TDN3      VVVLLTGIAVLYVQTATPRYTAELQVVFE-NKT--GPLFDFQ-AA-VAGAPQDEASILTE
A0A3B0VME9      TLLVTFSLVAVFTFSSTPLFLAQGTLKAS-PRVASITSFKGIAQGMDESFMQSKEFIATQ
A0A3B1DSR1      GLIVGLVLGELYYRKAGPEYDATARILVE-KKVSVQLKDG---------DAKIYGDRAEH
A0A0F9I1G8      FLALVFISTLIFTLTATKIYKANAVIEAN-RDAPR----VTKFEEVTAALASAREFYQAQ
J9FGR8          SVLLFMSGAVLYLMSTPAVYTRTASILIK-DDSKSGSSSNAMSEFSDLGIFKNNTNIQNE
A0A0W8FS74      AFCAVLFSVVLYTYFMKPIYEASSTLHIK-KEKGPGVLVDMNFD--------SSNSIDAE
A0A3B0V744      IFVLLILVAALYLRYTKPMYQSNSEIKLD-QEDQSNVLGLPQYE-----QSSNMGLLSSE
A0A644WNK5      GLVLVVGLAVGYLQIAVPQYESQVSVLVE-PIQRSSSFESLLD------VSASTTKIATE
A0A1W1D4H7      ITFLFFIGSLIFAYYKPNIYSSNMSLEIL-KENKGGMESSIALNQML--LGSDQVNLENE
A0A3B1CUQ0      CFVVIVLATGIGTYLATPIYEATTSILID-DSKGGGQALFTELAGL-----PQTSEIPSQ
A0A1W1BK27      ITLFITSLVVVYSYFLPPIYSSDVKISFS-NEEKSSMSSLIPNALADF-TATTEKKLETV
A0A1W1CD04      ITVLFMIGAGGYIYFSKPVYKSSVTISLD-SEKKSKLGDMLQDPFSQ--AGLGKERLKLA
                                   :     :                                  

A0A644ZI62      AKVARTDIVLQPVIDKLGLATT--------------------------------------
A0A1J5RCY3      TDLVTSPRVLIPVIEKLALGVR--------------------------------------
A0A1J5RUE5      AKLASMPVVLDPVIEDLQLDTT--------------------------------------
A0A3B1C250      YKIIRSRSVAESVIDKLNLAEK--------------------------------------
T0ZG59          YDLLKSHSLARRVVVAMDLQHDAAFQGLLRPSPLARLLGFLHGA----------------
A0A0F9JKD8      YKIIKSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLL----------------
A0A0F9XPI6      IEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKE----------------
A0A3B1AK25      HEILESRLLITKVIAKLNLQEN-------------PEFLPDESE----------------
A0A2H9TBF4      HEVLKSRALVEKVVKKLNLIDH-------------PEFNHALRE----------------
A0A0F9KY21      IELLKSRSVIGEAVDSLKLDITAEPKLFPIIGGKFYIEFTAEKP--NDIAEPMLGASSYA
A0A0F9VQU4      LQILQSRMVLGQVVDRVSSDLIISPVQVPFIGGFVLRRGIPRPA--------FLQGYPHI
A0A0F9W5Q6      IELLKSRKVIGQAVDNLKLDIVAEPKLMPVIGSFFYRRFSPTSD--EPLANSFLGFDSYA
A0A2H9T6C5      IEVIRSRFVLGEVVDDLTLDIVAKPDYFPIIGQAVARRFSPDAEANEPLNSPWLWFSGYA
A0A1J5SM24      VKILESEAIIQKVADRLTGNDL-------------AMFKAPYEK-----DGA--------
A0A3B1C7A9      IEILKSRRLRDIIASALIDSFNTVNNPDSFYVLLDHSFDLEDNG-----VK---------
A0A1J5SPZ5      IEILKSDRLRERVIHSLTPEEV--------------------------------------
A0A1W1DYN8      IEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNI-----TKD-NSRTGYA
A0A1W1E4Z5      IEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNI-----TKD-NSRTGYA
A0A0F9UWR4      IGLISSRGVAERVVRELNLVEH-------------PEFDPRQQD-----QPLIDIRGIIK
A0A0F9U8M8      FEILQSKYIAEAVIEKLNLIKH-------------PEFNDEENN-----LFGLKA-----
A0A381Y0U7      FEKIQSQKVLDKVVTKCNL-----------------------------------------
A0A381Z3K5      FEKIQSQKVLDKVVAKCSL-----------------------------------------
A0A0F9LFA5      FEVIKSDSIAREVITKLNLKAH-------------TDFIAKPSV-----LGELKAT-VKE
A0A160TC29      FEILKSRELAKRVVLQLGLVDN-------------PEFNPYHEA-----NGK--------
A0A1J5R1Y0      ADILRSRTIAELVLTKLDLVHN-------------PEFSPGRDL-----T----------
S0DG33          MAVMKSRSVLEPVIDKFRFDVSVTPHKVPILGDIAEKFATPGEP-----SAPWLGLKSFA
A0A380TGM5      IEVIRSRTLARRVIEQLGLAER-------------DEFTSS--R-----SRSLLEIASKA
A0A380TDI0      IEVIRSRKLADRVIKALQLDQD-------------PEFNGKLRP-----PSAFATFFKDT
A0A380TDN3      IEVIRSRKLADRVIKALQLDQD-------------PEFNGKLRP-----PSTLATFFKDT
A0A3B0VME9      VKLLKNEGLLIKLIKKMDLQDNILFVGKKDNDTGHGILGGVKEA-----FASLKNMIRPR
A0A3B1DSR1      IKLIMSPLIVNIAIENQNLDKLPSLLGEENPAGEILDT----------------------
A0A0F9I1G8      VSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEF-----VRSLIP-----
J9FGR8          LLTLKSPELIAEVVSRLQLNETYT-VRQQLKRVDLYKHTPCLLI-----GAAQTD-----
A0A0W8FS74      LEIIKSRTNLEHVAKRLHLDWQVT-----------KKSKDLDFK-----LLDFSS-----
A0A3B0V744      MEIIQSRLFFNKVVETVNLNPQYF-TYGNILDDEKYLNPPFKVS-----YKILNA-----
A0A644WNK5      VELITSRKNIEYALGTLDLSSYHN------------------------------------
A0A1W1D4H7      KVVLQSRFIVQKALEKLDLDTKYYVINRFFKKIELYKDAPFDVK-----IISLDD-----
A0A3B1CUQ0      IELIKSRTIAEEVVRKLKYDQRVFDIS-----------GDLDPR-----VTNLQ------
A0A1W1BK27      KLTLETRKFINSVIKELDINQRYF-IEHNYRKDELYAFDNLEVS-----LNIHDDNFKEK
A0A1W1CD04      KVTLMSKKFIGTIIDKVDIAKEFF-IQRNFRKVELKNFSNLKID-----IKYNNN-----
                                                                            

A0A644ZI62      -----------------------------------------------------PGQLAEQ
A0A1J5RCY3      -----------------------------------------------------PETLANS
A0A1J5RUE5      -----------------------------------------------------AKALGRS
A0A3B1C250      ------------------EGFADLVSKKKTGFIEEYLPASWFPEKREATEEEKKRRLIAY
T0ZG59          -------------------------------------------SARKPSQTDQLRADADA
A0A0F9JKD8      -------------------------------------PGGGPEDEGADPEAAKRKLIVET
A0A0F9XPI6      ------------TSEELKKAQSLSVNFMANDIEVTDSNGNNFTLFYKQSENALKTSPFRI
A0A3B1AK25      ---PLISIDWRAWIKELLPDNTIPEEPGIDEYEAF------------------NAELIKD
A0A2H9TBF4      -------------------EPWYVSMMNWRQWLGLALPQDTVSGETI------LNRTIDA
A0A0F9KY21      WGGEFISVFRFVVPKALEGEEFELLVKQNSQYELLNPNGDVVLNGTVGKDE--KDGFYEL
A0A0F9VQU4      WGDESINVARFTTLDSSRGRSFIVERGAGDSYHIMQGDS-RLGTGTLGQPEVFLDGELEL
A0A0F9W5Q6      WGGEQLKIFQLEVPRAYEGEELVLRAEENNGYTLLNEDGETLVSGTVDQPL--DEQGFRI
A0A2H9T6C5      WGGEAVKIERFETPDSQIGKTYTLVTGENNRYELYDEDDEKILVGKVGLSAVSRDNQVRL
A0A1J5SM24      -------------------------------------------------LS--HVPITTI
A0A3B1C7A9      -------------------------------------------------LK--SKYDLME
A0A1J5SPZ5      ----------------KILQRPYLKDLPP--------------------GA--SPPSAAA
A0A1W1DYN8      WGGERIQIEQFTLSRSLQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELA--QANGVTI
A0A1W1E4Z5      WGGERIQIEQFTLSRSLQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELA--QANGVTI
A0A0F9UWR4      SLQGMVLGEDPSDGAEPMTEAQIMDNV----------------------TQ--Q------
A0A0F9U8M8      ---LFSSFFGEGGTDDELDLEYKMAHL----------------------IN--D------
A0A381Y0U7      ------------------TESLVLGKT----------------------LN--EREARKI
A0A381Z3K5      ------------------TESLVLGEV----------------------LN--DRAARKI
A0A0F9LFA5      QLPFLNKKEVTVYAPEEQAEREMLG-L----------------------LA--V------
A0A160TC29      ---SFSLREFILGAKEPPTADEVLAKT----------------------IE--N------
A0A1J5R1Y0      ---WLAKAKIALGIAHPPTVSDQPGTV----------------------LG--E------
S0DG33          WGGERVQIGTLEVPIELEEEKLTLIALQDGAYELRGPADQLLVKGVVGTTA--QDNGVSI
A0A380TGM5      AA---LGGKDDTNPGSADRQALEARAARA--------------------AS--LDEVVDE
A0A380TDI0      LG---LNLFPARAPNETDPTQLTVEELRD--------------------KE--NNKIIDA
A0A380TDN3      LG---LDLLLAKAPDETDPTQLTVEELRD--------------------KE--NNKIIDA
A0A3B0VME9      LD----------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          -----ASFSCTLQPVSAEQCQLTEWSVNG------------------DETDETYTVAFGD
A0A0W8FS74      ---TAKNPSYKIEMTGADTFTVKD-----------------------EDGKLIGEGISGR
A0A3B0V744      ---SIYNIPIDVIVINQKTFQLNYTV---------------------REKEYSLNARFED
A0A644WNK5      ----------------------------------------------SDGIDYRSK-----
A0A1W1D4H7      ---MMYGKTFELIPIDSVSFRLEIKPLSKYSIKGILATLNIISLDEKDKISYNQIHHYNE
A0A3B1CUQ0      ------------IPQKFIDEEIKVEFTDSKG--------NFTVTKEGESLGRGIVGTPFK
A0A1W1BK27      YDGTLYDKLFTIKPIDKKHFLLSV-----------------------DAMEYNRTCSYNK
A0A1W1CD04      ---SLYGKFFKIVPYGNQRFLLII-----------------------KGINYKKVHSYSE
                                                                            

A0A644ZI62      VTVTV-------------------------------------------------------
A0A1J5RCY3      VTASS-------------------------------------------------------
A0A1J5RUE5      ISANN-------------------------------------------------------
A0A3B1C250      FSSNL--------------------------------RVVG-------------------
T0ZG59          LLHMV--------------------------------SVQP-------------------
A0A0F9JKD8      ILENI--------------------------------SVNP-------------------
A0A0F9XPI6      LMIDT--------------------------------LQNLNLIGQEYEVVISPIKNTVL
A0A3B1AK25      FSARL--------------------------------SVAP-------------------
A0A2H9TBF4      FAENV--------------------------------RIEP-------------------
A0A0F9KY21      TVREL--------------------------------NARPDTIFTLVKNNRYRTVVKLQ
A0A0F9VQU4      TVESF--------------------------------NAAEGAQYVLTRLQKTSAIRGIA
A0A0F9W5Q6      QIETL--------------------------------SAHPGTEFLVTKRNDLSTILDYQ
A0A2H9T6C5      FVSEL--------------------------------IARPQTRFNVIRQPMVTAINHLS
A0A1J5SM24      LRLNR--------------------------------KVVP-------------------
A0A3B1C7A9      MLDKV--------------------------------KIEQ-------------------
A0A1J5SPZ5      AMPNV--------------------------------DVSA-------------------
A0A1W1DYN8      FISEL--------------------------------VARIGTEFSLSKDNRAEIVDDLK
A0A1W1E4Z5      FISEL--------------------------------VARIGTEFSLSKDNRAEIVDDLK
A0A0F9UWR4      FMQRV--------------------------------SVSV-------------------
A0A0F9U8M8      FRQRL--------------------------------SVKP-------------------
A0A381Y0U7      LEKSI--------------------------------DVRQ-------------------
A0A381Z3K5      LEKSI--------------------------------DVRQ-------------------
A0A0F9LFA5      FKSRL--------------------------------SVSP-------------------
A0A160TC29      FWQAI--------------------------------SIEP-------------------
A0A1J5R1Y0      LRAHL--------------------------------TIAP-------------------
S0DG33          LVKEL--------------------------------DARPGTKFEVIRWNALDAVKRFG
A0A380TGM5      FLKHL--------------------------------DVRP-------------------
A0A380TDI0      VLEDV--------------------------------QAKQ-------------------
A0A380TDN3      VLEDV--------------------------------QAKQ-------------------
A0A3B0VME9      -------------------------------------SDPANKMNRKVQENITLDNNLGK
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      -------------------------------------QKKEETAKRPVIPKETLKQQGLI
J9FGR8          SVATSFGTFILTKTPAFTE------------------QWVGRSIRFAKTNPQACADV---
A0A0W8FS74      LMQAKGFSLLLNDLK----------------------GEKGDSFRLKLLPLQNIAVS---
A0A3B0V744      SVKTELINLKIELNESWA-------------------IEDGSRFYFRINSREVLINY---
A0A644WNK5      ---------------------------------------------------EVLGNV---
A0A1W1D4H7      LIKTPYFTIMVDKLKHIDGLKYNFS------------FIKQDKLY------DFYKD----
A0A3B1CUQ0      SDSGLYF-----DLKEVNPYKGASF------------KIKRSRFY------EAVEDL---
A0A1W1BK27      LVSNAYFSIKVIKKS----------------------YLEDTNYYISQSNPQLLADH---
A0A1W1CD04      EIKTKFFTLRVIKVDGENPYKTIAMNENPIESFIASLGLEEESYYFRSFDRDTQENM---
                                                                            

A0A644ZI62      -----------PTKTATLDLAVVTNSPDSAAQLADAISEQLVTTTIDQLSPPSPDGT---
A0A1J5RCY3      -----------PPNSVLIDITVTDTVARRASDIANAIAGS--------------------
A0A1J5RUE5      -----------PLNTVILQISTTDSQPQRAADISNAVARQ--------------------
A0A3B1C250      -----------YKNSQIAIINYEAYNPQLAADIANAVAAAYIETGMESRLMMAKQATSWL
T0ZG59          -----------VLNSKLVDVSVDTPDPRLSAQIANVYADQFIRSNLDRRMAASGYAKQYL
A0A0F9JKD8      -----------EVDTRLVTVSYLSGNPDLARLVVNTLANAYIEALFELRMDSSQRALQWM
A0A0F9XPI6      GLINKMEIQTTTKDSDVLAISLSGNYPTKSELILNTLIKKFNQDGINDRQQVSKRTLDFI
A0A3B1AK25      -----------VRKSQLVKISFEANNRKLAAQVANTLANTYIESDMEARLEMTSTASNWL
A0A2H9TBF4      -----------VRKTQVARIHVMSEDPQLAATAANAMGEAYIESWLEAKLSLTTNATRWM
A0A0F9KY21      QEISASE---KGKDSGIITLAYEHKNASHAEKVLDKVSDIYVRRNVERNSAEAKKSLDFL
A0A0F9VQU4      GRLQVAEVGGAGTTTGMIRLMMFGEDPSEITRSLDAVAQTFLTQNIERQSEQAQQSLEFL
A0A0F9W5Q6      RRVGASE---KGKDSGIISMSLASPHPAKATATLDEISRLYVRQNVERKSAEAQQSLDFL
A0A2H9T6C5      KRLSVSE---KGKKTGVLSLSLSGPSSVHNSHILEAIIQRYVRQNVERVSAEAQNSLKFL
A0A1J5SM24      -----------QRLSLVIDVQYDHPDPVVAAKVANLFVDEYIAYNARMRIDESMKAVEDL
A0A3B1C7A9      -----------KRGLDIVEISVESPVPYEAQMIANCYAQSYEKLNLKYTRQQLSKVVAFL
A0A1J5SPZ5      -----------VRNSLLIRITTTDRDPEAAKIIADKYVDQFMQYLLENVGGKNEYAVDWL
A0A1W1DYN8      KIIKVTE---RGKKTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVFL
A0A1W1E4Z5      KIIKVTE---KGKKTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVFL
A0A0F9UWR4      -----------EGKSQLVRISVEMADRLTAAQAANSVANSYIEGQLEAQMEMSMAATTWM
A0A0F9U8M8      -----------IQGTQLVHITYQASDRKLAAKIANAIGEVYIETHLEAKLGVTRRASAWM
A0A381Y0U7      -----------YRNTSIIELRAYDRKPTKAQEIAQALASEYQDHRSSLHKVAVQKGIDSL
A0A381Z3K5      -----------YRNTSIIELRAYDRKQKKAQEIANALAEEYQSHRTDLHKERVTKGINAL
A0A0F9LFA5      -----------IRKTQLVQVSFESSDPKLAALVANTVGEVYIESQMRAKMGITQQASSWL
A0A160TC29      -----------VRKTQLVKISVESQSPELAYTAANAVAEGYIESQMEARVGLTQQAAVWL
A0A1J5R1Y0      -----------VPRSNLIQVSYDSPDPRMAALIANTFAEQYIRNDMENKFRMTQEANSWL
S0DG33          DLVKVGD---KVKDSGLLQVEYADANPDKATAVANALGEQYLASAIASRQLNDTNTLAFI
A0A380TGM5      -----------TKASRVISVRFQSRDAQLAADVANAVADTYTNRFIETKIAIAEKATGWL
A0A380TDI0      -----------IPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWL
A0A380TDN3      -----------IPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWL
A0A3B0VME9      IKNSLTITPVRG--TQLIKISFQSPHSGLAADIVNNLMKEFIQVNAEQKLAAFHSSGVFL
A0A3B1DSR1      -LVVKRTAGRDRSFSNVLDLSYRNRYKEDAKTILSAIIEAYQEYLTRNQNKNQKKSLELI
A0A0F9I1G8      GFVNGNLTPILQRNSNLISISFTSPDRHLSQDVVNTLIEEFVRWKMDQKLEASQLAREFL
J9FGR8          -YAESLVAALSNKEASVITLTINNPSIAKAEDFLNTLIEVYNEKWVQDRNQIAISTSKFI
A0A0W8FS74      -LKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQVYLGQNIELKTEEASRTVSFI
A0A3B0V744      -VESNLSVEPLNFQANTFQISFTDHNLNKAHALVSAIDTLYYNYSLQEKTKANRNKIDYL
A0A644WNK5      -KERIVVSTVKD--TNIVRIAVTDANPAFARDFANALAASYDSLLTGIAKNSKTAQREFI
A0A1W1D4H7      --NLSVKNMLKS--SSVLELTYQDTVSLRAKEILDAISTTYIATTVKQKTEANGLTLNFI
A0A3B1CUQ0      -QKKVTVSPVRN--TNIVYIKVQDSDPRMAAAIANSIVKRYIQHDISKRSKEATYMIKFV
A0A1W1BK27      -ILENMKTTILS--DNVLQITYTDTVAKRAKEIVQEIANQFREFTLVKKTSELKKRLIFI
A0A1W1CD04      -IIKNMSVSDLS--ENILKIEYSDNIPQQTKEIAEEIARSFIEYNLENKTAELEQTLEFL
                                   :              .                         

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      TEKLSLLRTKLEESEKTLQRYQAREGV-VDTKSQKSIINRK---LV--------SITEEL
T0ZG59          QDRLQQLKLRLEDSDKELVAFAQKHQI-VNISDRQSLVGQQ---LE--------QLNVAL
A0A0F9JKD8      SRKVEEERNKLDDSESGLQAYMKANDI-VTLEDRIAIVPQK---LL--------ELSTQL
A0A0F9XPI6      DERFVYLSTELDSIEGGKQAFKTRNNL-SYIEADAGVSLER---KS--------ETENDV
A0A3B1AK25      TERLVTLKSNLQQSENELQAYREKEEL-LEAGGVSTLSTRQ---LQ--------DLNEKL
A0A2H9TBF4      QDRLQDLSEKLKTAESQLHKFRVSEDL-VDIEGVLTISTDE---LK--------ALTESL
A0A0F9KY21      EVQLPEVKKQLEGSEQRFNDYQKQRKS-VNITLETQAILEQ-------------------
A0A0F9VQU4      QRQAPELREQLDLAEQNLNDYRANLDS-VDLSSEAQAAIQR-------------------
A0A0F9W5Q6      KEQLPEVRRQLEAAENALNEYQASAGS-VDITLETQAVLDQ-------------------
A0A2H9T6C5      EHQLPDMKKDVELAESKLHRFQQENQT-VDLTMETQAVLDQ-------------------
A0A1J5SM24      KVRAEQQRSKVNELALALQAYREKNNL-VSLDQRKDIVTEK---LK--------ALNLLL
A0A3B1C7A9      QKQRTKKYQELLVVEEKMKKFQVEGRI-IALDDQAKALIDI---LS--------TFEAQR
A0A1J5SPZ5      TSRAEQLRRESEAAALKLQNFMQAQGM-VSLDDSTNLITAR---LQ--------AVSNAL
A0A1W1DYN8      QKQTPLIKDEMEAAEVELNNYKGYKNS-VNLTLETQSLLNR-------------------
A0A1W1E4Z5      QKQTPLIKDEMEAAEVELNNYKGYKNS-VNLTLETQSLLNR-------------------
A0A0F9UWR4      NSRLSELRTSLKEAENRLQAYREQEGL-VDVDGVGTVSANE---LA--------LTGDRM
A0A0F9U8M8      SEKMAGLTKQLERSETAFESFRQKNNI-VDIDSAVLRIDSE---LE--------KTQATL
A0A381Y0U7      KSRMGEMNTEISDMQSNVDKFRTDLGI-SDAAGEESYSIIEPEIVR--------RYEVEL
A0A381Z3K5      NKRMEEINEDITGMQSKVDRLRTDLGI-SDAAGDESYSLIEPEIVR--------RYQAEL
A0A0F9LFA5      NTRLSQLRIQLDNSEVRLQEYRELQKL-VDIEGIA-GLVTQE--LE--------QISQQL
A0A160TC29      SDRLGGLKDKLSESERKLQTYREQNDL-VDIEGVN-TLVAKE--TD--------QITERL
A0A1J5R1Y0      NEHLAGLKAKLEASEQRLQTYRNQQNI-IDVNGSALSGTGNQ--LE--------GLVTNL
S0DG33          NGELPRLLADLRKSEDALKHFRS-------------------------------------
A0A380TGM5      KGQVKALREAVARSEKAVEAFRTQSGL---LRGSQVTLISEE--IS--------EINRRL
A0A380TDI0      AGRIQVLREKVEASEREIEAYRKRHGL---FEGRATSLVTEH--VS--------DLSSKL
A0A380TDN3      AGRIQVLREKVEASEREIEAYRKRHGL---FEGRATSLVTEH--VS--------DLSSKL
A0A3B0VME9      DKQVNASKIKLEKSEQELNGYARRTGI-ISLNSKLNLVMGQ---LE--------AVNDAL
A0A3B1DSR1      TQANDELEVKLNKKKEEYQKFRDNAPLYWNAAPGVKGVGSS---VTNVHRDRFLKLEEKR
A0A0F9I1G8      TKQIYQSKINLEKVEEELNRFARMSGI-VSLDTKLNSVYSQ---LG--------ELNTAL
J9FGR8          SDRLGVIERELGHVDENISNYKSEHLM-PDVQAASNLYMSQ---TV--------EYKKQL
A0A0W8FS74      ENQLKGLRGELEGAEQDLETYKSSSGM-FKLDSEAQEVVKN---LS--------ETEKLR
A0A3B0V744      DKQLEETEKKLDNFETYFEDFTIDNKT-VDLNEDVRRTVDA---IN--------GLDSQR
A0A644WNK5      ESQIPINDRELSKAGDALGDFRENSDI-IQLTDKSSLLVEQ---IS--------YYTLRL
A0A1W1D4H7      DTQLKVISANLKNSEKNLENYKIHHSV-VDLKTKLEVKTQK---IA--------EYEGEQ
A0A3B1CUQ0      KKQIEPTQKKLENALESLAAHKRNSRV-VYLKEGTKKLIEN---IG--------ALEQEK
A0A1W1BK27      NGQIGIIENQLQGEGKNLKEYQKKHKTFFTIETNNKMILEK---LA--------EKKEMI
A0A1W1CD04      DKQLIEVKSDLKNKGEKLKKHQEKSGS--AVMSSGEALLES---ID--------EKKDLI
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      IKAQTRRAEAEIRYMEIKNVKNERGYE---------------------------------
T0ZG59          AQAEQDRYKAEAKWRQLQGAPADQIAQ---------------------------------
A0A0F9JKD8      TRSETRRKELETLRNKIRSLKAAGKDL--------------------------------D
A0A0F9XPI6      IKLETQISLSALLKNSVVGQAAFELLP---------------------------------
A0A3B1AK25      VLATQQRATAEISLKQIKSLAGESPDK-----------------------LGA-IPAVLN
A0A2H9TBF4      VETRRKLTLSENIYRQIQDGKNLQADQ-----------------------YQS-LPAVLA
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      TQSASTLADAQVKWQQVQDCRRQGRSL-----------------------ID--LPFILN
A0A3B1C7A9      DATSLELSQAEENIKQYKEEMNKQNSS-----------------------ISKYIENYAT
A0A1J5SPZ5      TQNQLQLLQLQAQYSQIQQY-IQSGQN-----------------------LLE-IQAIAT
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      VDARSQRAEAESQYRQVQAMSEQGWER-----------------------MAS-VPAVLG
A0A0F9U8M8      AIAESDKSKVDSILELINRFGKSDFEN-----------------------LKS-LPEIIS
A0A381Y0U7      IAAKGVHTTQSSLLDGLKA--QSAEEL-----------------------RAS-ILTAHP
A0A381Z3K5      ITAKGVYTTQATLLAGLKD--QSVDEL-----------------------RAS-IMTAHP
A0A0F9LFA5      IVARNEKNNLESINRVISEYGNNNLEL-----------------------LGS-MPEITS
A0A160TC29      IEARSRRLELEGTYRQLQSLAEQTYES-----------------------LSS-LPSILN
A0A1J5R1Y0      VTARMKMAEAASAYQQIRN-AQASGTS-----------------------LDS-LPLVVR
S0DG33          ----------------------------------------------------T-SQSMQP
A0A380TGM5      AAASADRAQATATLNEVQA--LQKASN-----------------------IEA-AQAIME
A0A380TDI0      TDATIERRAAEARLAQVRN--LKNAEN-----------------------VDT-AVQVLD
A0A380TDN3      TDATIERRAAEARLAQVRN--LKNAEN-----------------------VDT-AVQVLD
A0A3B0VME9      AQAVTARISKESLYLQTKKNGGENMPQ---------------------------------
A0A3B1DSR1      REVVTRQAETKARIISLEEAVAARQSP--------------KKLERMVRIFLSYQTGRGG
A0A0F9I1G8      ARAEAEMIGKRAIYNQAIKDGPASLPR---------------------------------
J9FGR8          QELNNQLSTAQYIRRELTGKQLSQLLPANSGIA---------------------------
A0A0W8FS74      AEVIFQKKQVEFALDALNSALRKGNIY---------------------------------
A0A3B0V744      IKIDNKLSELELLQAKLSKTPYENLTP---------------------------------
A0A644WNK5      EPLKLQLKESEVFIDSYN------ASLKQAGIDGVLTLEQIK-----------------N
A0A1W1D4H7      LELQTEINILNNIKYYINKN-KDLTAL--------------------------------S
A0A3B1CUQ0      TNLDIKEQQVRYLYDEVQKNITDTSTL--------------------------------N
A0A1W1BK27      ETLKLQLKELNDFQKSFKKGNLNTVSLLNNGINISSIEPLIERFHAIDIELEDMRIQAKN
A0A1W1CD04      EKIILQLQEVKNFRASLQNGIMSSVALTSVGIDTSSIQSLIDSYTKSEETIRELRLQQNN
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      SIRAVLRHPLIQKLKEEESRMARRVSEL---SKRYGKKHPKMIAAISDYKEARRTVRK--
T0ZG59          ----VLGDPVIEKLQQAYAEDQAKYQDQ---LRIYKPAFPAMLQLHAKLDEIHRQIAA--
A0A0F9JKD8      SLPAIASDKTVASLRGQVLKGEQRITEF---SKKYGQKHPLMIESVGDLRVLREKKEQ--
A0A0F9XPI6      -VDVGLENSGLNSMVDRYNDQVLQRNKL---LQTVGIQHPSLIAISTQLEVAKVNIIK--
A0A3B1AK25      D-------DLVGSLKHSESDMQREVSAL---AKRYGPMHPEMIQAKANLAKATQNVNR--
A0A2H9TBF4      H-------PLVQQLKQREAELEQKVREL---GRRYGPKHPKMIAANTELESISNNIRL--
A0A0F9KY21      ----------IVELDTTLQELDLKRLEL---SRKFKREHPAYQGV---------------
A0A0F9VQU4      ----------YIELDTRLDELEFQEAEL---AQRFTPSHPNYQAL---------------
A0A0F9W5Q6      ----------VVELETAISELALKRSEM---ERRFTRQHPTYQAL---------------
A0A2H9T6C5      ----------AVDIDTQLAQLDMQIKQM---GQRYTKSHPVMEEL---------------
A0A1J5SM24      SSNDNSGPSLVSQLNQQVAQQEIDIAKL---RERYRDKHPIMVAALNSLAQTKAQLKL--
A0A3B1C7A9      E-------PRMRALQEEIARLEMERDVAMSDTTMSATRKELLVNKNRTIRDLRKQLNE--
A0A1J5SPZ5      H-------GEIPSLVSQLMSLKQQQQVL---AERYLERYPKMIDIANQISVAQSQLDK--
A0A1W1DYN8      ----------IIMIETQLAELEVKHSDL---SKKYTDIHPIMITL---------------
A0A1W1E4Z5      ----------IIMIETQLAELEVKHSDL---SKKYTDIHPIMITL---------------
A0A0F9UWR4      H-------PLIQQFKSEQARARARVEEL---SRRYGERYPAMQAAQSDLNAATASLRA--
A0A0F9U8M8      H-------SSISEGRVLLETAELKFAEL---SKIYGPKHPKLIAASEELDMRVEQVNA--
A0A381Y0U7      D-------AQLDALTREFHTGQQTLANQ---SIDLGDQHPRIKGLKKVVATLEEQIDN--
A0A381Z3K5      D-------AQLDSLIREFLTGQQALANQ---SIDLGDQHPRIKGLKKVVAILEGQIDA--
A0A0F9LFA5      H-------RVIQDVKREVILVERKLSDL---GEVYGPRHPKIISANAELATVKNNLNK--
A0A160TC29      N-------PLVVKLRENETNAELKVSEL---SKRYGPLHPRMIAAQSDLDAVRDSVFT--
A0A1J5R1Y0      D-------PVVAQLEQVVAQKQQKVSEL---SKRYGPKFITMIQAQAELQQARDNLKH--
S0DG33          T-------SEAQAYLQGGLDLDKQIAGL-----------------QLQRTQLLERYRP--
A0A380TGM5      S-------PVVQQLRIQEAAVLRELAEL---SIELGERHPRVINKKSELEKFRAKIEA--
A0A380TDI0      S-------ALIQRLREQELELERKEAEL---GQNLGARHPAMIQLQAERQRFREKLQA--
A0A380TDN3      S-------ALIQRLREQELELERKEAEL---GQNLGARHPAMIQLQAERQRFREKLQA--
A0A3B0VME9      ----VLNNPLLQNLKKQYSDLRSQYEVL---STVFKDQYPKVKKLKAQMKDLRNRYAQ--
A0A3B1DSR1      QSAATQLNPDLVTLESRLVPLVLRERSL---LREFGKDHSDVIGIREQINALRDIYRQKG
A0A0F9I1G8      ----VLSNLVIANLKADYARLVSQYQDL---TTTFLDDYPEVKNLKSRMLSIGERIHI--
J9FGR8          -------STTLAGQIEEYNKLVLDRNRL---VANSSEKNPLVVDMTETLRALKNTLIQ--
A0A0W8FS74      SPAIMRDDPLVAGLAAKLSELEIQKRTL---LTDYTENHPAVRTIQGQIDEIQKKIRS--
A0A3B0V744      --KVNVYPNYLNRAFDEFNLLKNDLQKL---GLSYKENTYTFKSRQKEVELMRADILA--
A0A644WNK5      DSVIISKLADLSAWKTELTMYESLSNPA---RNTATLAPSTTLDSSSRTYVISSAISQ--
A0A1W1D4H7      IGTVKFTDNRISLLVTSLEALMNRREQL---ASKYTQFHPDIVKIDKSIKIAKKAIKK--
A0A3B1CUQ0      LSVLE--DTVVQSMISSLAMLENNRKSL---LSEYTARHPQVVALSAEINEIKKRINA--
A0A1W1BK27      IEKSLTKRPQLEQLIQRLHKEKDTLEEL---NFNFTPTHPQVVKTNNTIIEIENDIRS--
A0A1W1CD04      ITKSVTSNLLIAALINELKEKETLLRSL---LTDFTEEHPQVIEQKKEVDNMRNKIHG--
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      ----------------------------EVKRVVDGI------------------RRDFE
T0ZG59          ----------------------------RTALVSGAA------------------QSAYG
A0A0F9JKD8      ----------------------------EIGRVVKSV------------------ENEYD
A0A0F9XPI6      ----------------------------TINIYQTQL------------------RTSLI
A0A3B1AK25      ----------------------------RIRSVTNGV------------------EKEYQ
A0A2H9TBF4      ----------------------------QVQRIVLGV------------------ENEFE
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ----------------------------AIDAAAAAV------------------QANYQ
A0A3B1C7A9      ----------------------------QLKIYKESIYAASPAELKELSLKLLTEEVRYK
A0A1J5SPZ5      ----------------------------AIKLAVDEI------------------KSQLA
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ----------------------------QVEQVVAGI------------------ERNYQ
A0A0F9U8M8      ----------------------------QIQSLISGI------------------EKESY
A0A381Y0U7      ----------------------------RIKGILAGL------------------ELRVN
A0A381Z3K5      ----------------------------RIQGVLAGL------------------ELRVK
A0A0F9LFA5      ----------------------------QIKGLITGI------------------EKELN
A0A160TC29      ----------------------------QMKRIANGI------------------ENDFL
A0A1J5R1Y0      ----------------------------QVAIVVSSI------------------EHAYN
S0DG33          ----------------------------DSRWV---------------------------
A0A380TGM5      ----------------------------EMERVLKGY------------------ATAVS
A0A380TDI0      ----------------------------EIGKIVQRA------------------ENEVV
A0A380TDN3      ----------------------------EIGKIVQRA------------------ENEVV
A0A3B0VME9      ----------------------------EQQLILDSI------------------RLAYE
A0A3B1DSR1      IDISESGITDEGIEEGAVKIDFVALYIQSLKQLLVEL------------------KQRKL
A0A0F9I1G8      ----------------------------EEKKIFKAI------------------ENEYQ
J9FGR8          ----------------------------TVDNLIRSL------------------NTEMA
A0A0W8FS74      ----------------------------TYETNLVNL------------------NKQQS
A0A3B0V744      ----------------------------EVNDYKQDL------------------QKQKS
A0A644WNK5      ----------------------------VTKELLNRV------------------AALTR
A0A1W1D4H7      ----------------------------AVQNSLDQL------------------NQRSI
A0A3B1CUQ0      ----------------------------SILNTLDSL------------------RTKKE
A0A1W1BK27      ----------------------------YIQTDLNRL------------------RKSKS
A0A1W1CD04      ----------------------------NIVTNIQKL------------------KKNRA
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      -----------------------LGTQVSELETPSSGAA---------------------
A0A1J5RUE5      -----------------------LAVTVQNLSPRTVAGQ---------------------
A0A3B1C250      AAVANEKE---------------LRRLSNTTEKDARRIKGKEFEMAKLEREVSA---NRQ
T0ZG59          AAKARETL---------------LRQRVADLRQQVLNLEQRSIRYNILKREVDT---NRQ
A0A0F9JKD8      LALSNEHN---------------IRRLLSETKLEAHGINEKFVKYNSLKREVDT---NRK
A0A0F9XPI6      Q----------------------SNQAQNKVNSVFSGLPEKEKMLRSIERQQSI---KEN
A0A3B1AK25      IAMAAESS---------------LKRSLQRAKGEMQNINRKGYKLGVLEREVES---NRQ
A0A2H9TBF4      VARANEQS---------------LVAAMTTAKQAVQTINSKQFRLKALEREVRT---NKD
A0A0F9KY21      --IKQIES---------------IEAEKELLTSKVSNLPETQQELLRLTRDVEV---GNE
A0A0F9VQU4      --IRQRRQ---------------IQRDLQELNARVNELPAAQQEVLRRTRDVEV---TQA
A0A0F9W5Q6      --MEQKRQ---------------LETRRDDLLKRVGGLPETQQELLRFARDVKV---STE
A0A2H9T6C5      --QLQRQL---------------IVDRKNKFSDEARGLPKTQQEVMRLARDVQV---NTE
A0A1J5SM24      TAQSDYQH---------------AKAALAAQEQESLELDRYGVEYTNLERDYNI---NNQ
A0A3B1C7A9      SLQATYQN---------------LNKIIDNYESKFNELPNRTIGFARYQRELNA---YEK
A0A1J5SPZ5      KTIDAEKR---------------LEAEKAIQEKAFLHLGDVRTEYESLKNQSDV---KRK
A0A1W1DYN8      --TNQEVK---------------LQEQLEKINAKAHGLPKTQQEILRLSRDVEV---ATT
A0A1W1E4Z5      --TNQEVK---------------LQEQLEKINAKAHGLPKTQQEILRLSRDVEV---ATT
A0A0F9UWR4      LAVANEQS---------------VRASFDANKEQIQDISRKEFRVRELTREVES---NRE
A0A0F9U8M8      TAAQRVKR---------------YRKELSDIRSKYSDITGLDTKYTALKIELDT---NRN
A0A381Y0U7      SSMAQVEQ---------------LKRDVEDAKKRESDMREKGREYFNAKRELAN---TTR
A0A381Z3K5      SSKAQVDQ---------------LQQDVSGAKTKESEMREKGREYFDAKRALAN---TTR
A0A0F9LFA5      RVTRTVSA---------------LERDLVKIRAEYQDITRKETQYNQLKREVET---NRN
A0A160TC29      VAKSKENS---------------LQSALNSTKARIRDMNRTEFELNDYVREVRA---NRG
A0A1J5R1Y0      EARANVQA---------------LSGAVAEVRGSIRQANEKQFALADLQRDVQT---NQQ
S0DG33          ------QS---------------VDTQLAQLKDAKAQFNGHFNGMPSSERESVDLLRAQK
A0A380TGM5      VATAREDS---------------LERELNKLKSKQALANSREIELRELEREAEA---NRK
A0A380TDI0      VARGREAA---------------LQRDLASVKGDMVQSNQASIGLRALEREADA---NKL
A0A380TDN3      VARGREAA---------------LQRDLASVKGDMVQSNQASIGLRALEREADA---NKL
A0A3B0VME9      EALEKEKR---------------LTTKAEAQKKLAIELNSRATQYKILRREVAT---NRE
A0A3B1DSR1      T----------------------FDELIALESQESKKLSRYLMEDQTHSDEIER---LKT
A0A0F9I1G8      TALKKRTA---------------LQERVSLQKTLAIDLNERATQYKIIAREVET---NKG
J9FGR8          S----------------------IRRQSEAATSQLASNPGQAKYLLSVERQQKV---KEE
A0A0W8FS74      S----------------------VTHQLDIYESKLRKLPKAERDLARLTRVSNV---NAG
A0A3B0V744      N----------------------LVTTKQQLRRQLISLPSKNTEYNKSKRFYSV---YEE
A0A644WNK5      KYANEANTQAIVQALTTEVGIQVLQKRGAVFVEELSQLPVLERRLSELQRDVQI---YEA
A0A1W1D4H7      D----------------------LGNMVVQLNKSLESLPTEEKKLAQLLRPLKV---NQK
A0A3B1CUQ0      S----------------------FSKEIGRLRAELKVLPEEEKTLAGLVLNKEV---LSN
A0A1W1BK27      SIKTKIIANINTTKKSIEHKLNIFKHDIQNENALMQTLPEKSLTVQELKRKFTL---SEN
A0A1W1CD04      IAKSTILNNMLMVQNNLTDKLRLLKSDIRQKKSLLRSMPKENLVNASLKRNFAL---NEE
                                                                            

A0A644ZI62      ----------------------KSVTATIITSAELPV-IPTTPNTMRNLALGAMLGLLMG
A0A1J5RCY3      ----------------------SPVKVSTVRTATVPL-APATPKKTLNLALGLLVGLALG
A0A1J5RUE5      ----------------------SSIELTVVAPAVPPE-TPFEPNTRFLSVTGLALGLGAG
A0A3B1C250      LHDLFLTRFKETNMGENA----NVTNVRIIDRAEPPM-RPHKPKKSRIVGLALFIGIFLG
T0ZG59          LYDAILQRYKEIGVAGGV----GINNISVVDRAEPPM-VRYRPRLKLNLTIGLLLGLFAG
A0A0F9JKD8      LFESLLQKMHKERIEEEG----QTVNVMLVETAETPS-YPESPKKALNLIIGFMIGILGG
A0A0F9XPI6      LFLLLLQKREEAGISLAV----TTPLVKIVDYALTST-TPIAPKKTIILGVSGILGLLIP
A0A3B1AK25      LYKLFLNRFKETKETSGL----EQVRARIVDPAEPSI-KPIKPKKQLIVLIATLISGFLG
A0A2H9TBF4      LYDAFFKRIQETSATSDL----QSANARVVDRAFTPE-HPVKPKKKLIVGIAALLSLLIA
A0A0F9KY21      IYMLLLSKTQELDIVRAG----TVGNVRVVDAAAVDTTEPVKPKKALIAVVATLLGGFLA
A0A0F9VQU4      IYVNILNKVQELEVARAG----TIGNIRIIDSAVLSG--QVAPNTPRIFILYTILGLLLI
A0A0F9W5Q6      IYTAMLNKSQELDIVRAG----TVGNVRIIDDAVVDTSQPVKPKKALIVVLATLLGGMLG
A0A2H9T6C5      VYTELLNKAQELKIVKAS----AVGNVRILDHA-LSAIEAVKPKKSLIFVLAVLLGAMLG
A0A1J5SM24      LLQQILERMRETSMTSTI----ETQNARIVDRGQVAK-KPVSPNVPLNLGLGFVGGLGLG
A0A3B1C7A9      LYLLIEEKYQEALISEQS----TPGNVLIIDEAQRPV-KPSKPNRKLIVVIGLILGFGFG
A0A1J5SPZ5      NYMDILDRLNQTQTTSNI----DKIPLRPLDRAQIAG-APYTPNMGRIIKTCTGLGVLVF
A0A1W1DYN8      IYTQLLNKTQELKVVKAG----AVGNVRIIDTALTAQ-RPIKPKKLLIVLISTLLGLFLV
A0A1W1E4Z5      IYTQLLNKTQELKVVKAG----TVGNVRIIDTALTAQ-RPIKPKKLLIVLISTLLGLFLV
A0A0F9UWR4      LYETFMTRLRETTSTQDL----STTNARIVDQAIPPS-RPSAPNTKLLIIIATMLALIVG
A0A0F9U8M8      LYNTFLERSRETEATSDY----KASPAHFTGVAAASL-YPVKPNKKMIVAGAFFLSLMFF
A0A381Y0U7      IRDTILLRVMQEEVDLELG--SKESSVEIIDEADLPI-KAVRPNIPLNISLGVVVGLILG
A0A381Z3K5      IRDTILLRVMQEEVDLEL---PKESTVEIIDEADLPI-KAVRPNIPLNISLGVVVGLVLG
A0A0F9LFA5      IFNTFLSRSKETEVTSDF----SSAAARFTDRAYAPN-NPVKPNKKLIVILAFVASFGFA
A0A160TC29      LYETFFNRISETSVTGDL----QTANARVIDPAVLPK-EPIKPNKKLIVALALVVSAMFG
A0A1J5R1Y0      VYDMFLQRFKETSAATDL----TKPIASVVDPATAPV-VPLRPHKARVIAAALLVGLLFG
S0DG33          VAETIYLGMVQKAEQLQVRRASTTGGAHIVDAAIRPH-RPVKPRPELVLGGGLILGLISG
A0A380TGM5      LLETFLTRLKETTPQLDTE--MQVPGATVLSPAAVPL-R-SLPDKRIVLAVATIIALLLG
A0A380TDI0      LLEQFLASFMQASAQEDMR--AQLPDARVVSPAAMPD-KPSYPRKVFVVMIAFLGSILVG
A0A380TDN3      LLEQFLASFMQASAQEDMR--AQLPDARVVSPAAMPD-KPSYPRKVFVVMIAFLGSILVG
A0A3B0VME9      VYSSLLSRSKEIEASAGS----DNGNIMIVSMARPPL-YPYKPKVARNLLLGIVLGSFAG
A0A3B1DSR1      IWQIAVDQLNRTTLSKNH----SGYSMEKMAPVRAEL-S--FKRHLKFLGGGVVGGMLVL
A0A0F9I1G8      IYQSLLERAKEIESMVGV----SSSNIHIVDRALLPI-FPFKPNVRLNLLLAIVVGLMGG
J9FGR8          LYLYLLQKREENELSQAF----TAYNTRVINAPRGSM-APTAPQRSKILLIAFVLGLALP
A0A0W8FS74      IYTFLLQKHEEARIAKAT----TVSNINIVDPAITPV-SPIKPDKPKNLLLGFLVACILG
A0A3B0V744      MYLSLMQSKNEFEIAIAG----SITKIKILSPASLSN-TPIYPVPLFAYATAVILSIVLS
A0A644WNK5      IGLKLREMLEEVKLTEAA----VTGNVTVVDAANLPL-NPVSPNKLLIIAVAMLLGAAIG
A0A1W1D4H7      IYEFLLQKRAETAILKSA----TIANARILDSARENT-TPVKPKRVLIVVVSVISGLIIG
A0A3B1CUQ0      INAFLFQKLNEATITQAS----TISSIQVVDPAIVPK-KPIKPQKKRNILLAVVVGLMSG
A0A1W1BK27      IYTFLLQKKMETQMSLAS----VIENTQIIESAREGL-KPIKPNKKLIVIVGFITSLILA
A0A1W1CD04      IYTFLLQRKIEIEISKAS----TIANTRVVENAYVAK-GAYKPKKTLIMAVATIVGFILA
                                                                       .    

A0A644ZI62      AGLAIVRDMLNLSIHSERDIERVT--EIPVIGVV--------------------------
A0A1J5RCY3      VGLAVLREVLDTKVRNEADVRRVT--EASVLGSV--------------------------
A0A1J5RUE5      VILALLLTIFDTRVRTAADIERVI--HLPALATI--------------------------
A0A3B1C250      VILAFVQEHLDKTFRNTDDVERFL--TLPVLGSV--------------------------
T0ZG59          IAAALVLDHLDDTVHIATDAEQKL--GLAVLGII--------------------------
A0A0F9JKD8      AMLAFFFEYFDNTVKAAEDAEEKL--GIPVLGMV--------------------------
A0A0F9XPI6      FVFFYIKFSLNDKIGSKSDVLAIES-SIPFLGEI--------------------------
A0A3B1AK25      ILLAFLFEHLDNTIKKASDLEDRL--HLPVLGLL--------------------------
A0A2H9TBF4      CGMAYLLEMLNNTIRTAKDVEDQL--NLPVLGVL--------------------------
A0A0F9KY21      VAIVLIQKAMHRGVEDPSEIE-AL--GLAVYASV--------------------------
A0A0F9VQU4      TGYVLLKELFKRGVESPDQIE-RL--GLTVYANV--------------------------
A0A0F9W5Q6      VAIALLRHALNRGIENPELIE-QM--GLPVYAAV--------------------------
A0A2H9T6C5      TGFVFLRTMLRQGVKTPEEIESKT--GLSVYATV--------------------------
A0A1J5SM24      LAFAFFVAYIDDRVKSSYDIESVI--GLPLIGII--------------------------
A0A3B1C7A9      VGFAFVRDYFDNTVKTPEDIEKE---NINVLTWI--------------------------
A0A1J5SPZ5      LGVAVGLSFIDDRIKSAWDVEHFI--GANLLGII--------------------------
A0A1W1DYN8      IAWVLVRRAMNKGVEDSDLIERDI--GIPVYANV--------------------------
A0A1W1E4Z5      IAWVLVRRAMNKGVEDSDLIERDI--GIPVYANV--------------------------
A0A0F9UWR4      VAIALIADFLNNTFKSAEDVENNL--NLPVLGIV--------------------------
A0A0F9U8M8      VGLVILFEMLDDTIKSPSDIESKL--SMRMLGMI--------------------------
A0A381Y0U7      VGLAFFIEYLDTSVKTIDDVERAL--GAAVLGVI--------------------------
A0A381Z3K5      VGLAFFIEYLDTSVKTIDDVERAL--GAAVLGVI--------------------------
A0A0F9LFA5      VVMSFIFDALNDTVKTKSDVEGKL--AQRMLGLL--------------------------
A0A160TC29      IALAFLLDALDATVKNAEDVDRKL--GVSLLGIV--------------------------
A0A1J5R1Y0      IAVAFLLERLDTTVRSTEEVGLRL--GQPILTTL--------------------------
S0DG33          VVLVFMRRYVMTGVTDPRYVERRM--SVPVFGEILFSQQQVLLDRSFAARKSLPGLGGRS
A0A380TGM5      LGLALMAERLDYGFRHAEQVSEAT--GLPVIAHL--------------------------
A0A380TDI0      GLLALTLESLDAGFRSAEQIEAVT--ELPVMAHV--------------------------
A0A380TDN3      GLLALTLESLDAGFRSAEQIESVT--ELPVMAHV--------------------------
A0A3B0VME9      VGLAFVLEYLDDTIKNPDEFPQRY--HIPVLGLI--------------------------
A0A3B1DSR1      FGFIYLRAFLDTTVHTVNDIRDNF--NLPILGAI--------------------------
A0A0F9I1G8      IGLAFLLEYFADTITNPDQISERF--QIPILGVV--------------------------
J9FGR8          AAVIYLMENMDNRVRGRKDLELLT---VPLVGEI--------------------------
A0A0W8FS74      IGLAFFQEYLDDTIKDAEEAKRAI--GLPLLAVI--------------------------
A0A3B0V744      FLFAGVMYLAHNKIQSLHEIEFLT--TATTLGAV--------------------------
A0A644WNK5      LLLTLGIETLDVSIQSEQQIQKIVGKDVPILGWI--------------------------
A0A1W1D4H7      IFLAFLREFFTTTLQSLEELEHIT--SLPIYGVI--------------------------
A0A3B1CUQ0      VGFAFFFDYLDNSIKTPRDVEERL--GLPVFGHI--------------------------
A0A1W1BK27      IFYVFLKSMLDTKIRNEANIKELT--DAPLYGSL--------------------------
A0A1W1CD04      IFFVLMRDFFDTKIRTVRDIESLT--DKPIYGSL--------------------------
                             .                   :                          

A0A644ZI62      ------------------PEDDDAVRN---------------------PLVLHADPHSQR
A0A1J5RCY3      ---------------------------------------HYDPDAPDHPLIVQSGPQSHR
A0A1J5RUE5      ---------------------------------------VRARQSQQPATTVAHDPSSRR
A0A3B1C250      ------------------PTVKKGGDD-----------------AFGPEWHSLANPRSPF
T0ZG59          ------------------PLARAG-----------------------TPEQAMQDPRSAL
A0A0F9JKD8      ------------------SHLRREKKG----------------KERHIERIVIEEPKSSF
A0A0F9XPI6      ------------------PHFKTE------------------------KKFIDFNDHSVL
A0A3B1AK25      ------------------PKLDLKKHK-----------------TASPLSYAKGNKQSFF
A0A2H9TBF4      ------------------PEVDIKASSVPVSQLFINKD--------------ISKEQRAF
A0A0F9KY21      ------------------PHSDHQDKLSGFAERARKNKTNKPKS-----ILALDNPADLA
A0A0F9VQU4      ------------------PQSSAQRKL----NRALKRRGEKTSKSVVGGVLAQRDPMDLS
A0A0F9W5Q6      ------------------PFSKDQQIL----ERGSKTKGNIQGSH----LLAATNPADLS
A0A2H9T6C5      ------------------PVSEQNRLL----ERNSHKNGD---SC----LLACSAPDDLA
A0A1J5SM24      ------------------PEIKKMEQP---------D----------KAQIVMNNADRQV
A0A3B1C7A9      ------------------PKIEGVETN---------KE---------FEFIIHEKSDSIY
A0A1J5SPZ5      ------------------PEIGQIKDE---------D----------KYQLVLNNKPNPG
A0A1W1DYN8      ------------------ALSAKQKLL---------NKDIITNKIK-HAILCEHDPQDSA
A0A1W1E4Z5      ------------------ALSAKQKLL---------NKDIITNKIK-HAILCEHDPQDSA
A0A0F9UWR4      ------------------PLVAKKQQK---------K----------VSHLFEKGDDMRF
A0A0F9U8M8      ------------------PLSKNTAL---------------------DIRTFFDKEQQQF
A0A381Y0U7      ------------------PQN--------------------------VGSLLEEGDESPH
A0A381Z3K5      ------------------PQN--------------------------VGSLLEEGDESPH
A0A0F9LFA5      ------------------PHVQTPKN------------------SVFPIHAYLDDNYRRF
A0A160TC29      ------------------PLIASGKRN---------KKIDPNKLDATLVRAFVEGSDHGF
A0A1J5R1Y0      ------------------PLLKDHDH---------------------IGRRYLADPHSQF
S0DG33          NLPFQRSAPDIDMRTGASAMSAAASYS---------GDN--------SRILAARFPHDTS
A0A380TGM5      ------------------PV---ARSG---------RDG--------PEAAMLDSQPSLF
A0A380TDI0      ------------------PLLTAAKGG---------GDR--------PETFILKRPDSAY
A0A380TDN3      ------------------PLLTAAKGG---------GDR--------PETFILKRPDSAY
A0A3B0VME9      ------------------PFKDAG---------------KTDDEFDEIALTFYNEPKAPL
A0A3B1DSR1      ------------------PEFAPIATK---------ELKQIDSHKIAPELYYFHKPGSIE
A0A0F9I1G8      ------------------PLAKSG------------------DYVL--DKAFVSEPRAPI
J9FGR8          ------------------PFTGDK-------------KKKKDASQH--TILVKEGSRDML
A0A0W8FS74      ------------------PFITSR------------AENGEAKKRL--PLITRLEPKSQV
A0A3B0V744      ------------------PKHNLN------------------GKVA--KIIVDKHPKSAV
A0A644WNK5      ------------------PMMKVS-----------------DNDKY--PTLSVYNDPLSF
A0A1W1D4H7      ------------------PYNKDE------------------------------STENTY
A0A3B1CUQ0      ------------------PLVQAEETK---------KPLSGGNSNS--GLITINSTKSIT
A0A1W1BK27      ------------------PNKKHK---------------------------------RFF
A0A1W1CD04      ------------------PPLKNE---------------------------------RFF
                                                                            

A0A644ZI62      AEAYRSLRTNLQFLGL---DRGKR-SIVVTSSVPGEGKTTTAINTASTLAAAG-ERVLLI
A0A1J5RCY3      AESFRRLRTNLQFIDV---AEQPK-TIVVTSSLPGEGKTTTSINLAITLADAG-ARVVLV
A0A1J5RUE5      AEGFRRLQANLQYLDV---GKPLS-SVVVTSAVPGEGKSTTALNLALAVAENG-KSVLVI
A0A3B1C250      AESVNHIRTSVMFSNI---DNPPK-IIMITSAMPSEGKSTLATNMALAYSNLG--KTLLI
T0ZG59          AEAYRSARTALQFATA---DGVPR-SLLITSTRPGEGKSTTALALAQSFAQMG-RRVLLV
A0A0F9JKD8      AENYKALRTAIMLSSA---ESTPK-TLLITSMGPAEGKTATAVNLALVVAQSV-GKVLLV
A0A0F9XPI6      AESFRILATNINYMLPKRKDGSGN-VIFVTSGYMGEGKSLLAYNLSVAYASIN-KKVLLI
A0A3B1AK25      SESIRTIRTAMLLSGL---DDPYK-VILVTSSVPGEGKSAVATTLAESMGELH--KVLLI
A0A2H9TBF4      VESVRTIRTGLNLSLMSVGQEAHKKIIAITSTMPGEGKSSVAANLSSALGQLG--SVVLV
A0A0F9KY21      IEALRSLRTSLHFAMI---EAKNN-IIAISGPSPSVGKSFISVNLASVLAQSG-KKVLII
A0A0F9VQU4      LESLRGLRTSLHFTMM---DGRNN-RVMLTGPSPGVGKSFVSVNLGAISALAG-KKVLIV
A0A0F9W5Q6      IEALRSLRTSLHFAMM---EAKNN-ILMISGPSPSVGKSFISANLAAIVAQTG-QKVVLL
A0A2H9T6C5      VESLRSLRTNLAFAMM---EEKDS-RIMITGSSPTVGKSFVSANLALLLAESG-KKVLLI
A0A1J5SM24      AESFLTLHSSLRLKDE---SKNAK-VFLTTSTIPGEGKSFMTTNLALTFASHG-ERVLVV
A0A3B1C7A9      SEAFRVLRTRIQFSKL---NNGGVKVIHITSSTPQEGKTTIAINVAGSFAQTN-KRTIIV
A0A1J5SPZ5      QESFLSVYSSVKIQSK---LDFPK-SILVTSTIPGEGKTLVSCNLAGAFARHG-RNTLLI
A0A1W1DYN8      IEGLRSLRTNLHFALL---EAKNN-IVMVTGPSPDIGKSFVSINFAHTIAQAG-QKVLLI
A0A1W1E4Z5      IEGLRSLRTNLHFALL---EAKNN-IVMVTGPSPDIGKSFVSINFAHTIAQAG-QKVLLI
A0A0F9UWR4      CEAVRTIRTSVMLADM---SRPQK-VIVITSSVPGEGKSSVAANMAFALGQLQ--RVLLI
A0A0F9U8M8      SEAVRTLRTGVVLSQM---DAENNKVIEVTSSIPGEGKTTTSINLAFSLGQIE--KVLLI
A0A381Y0U7      AEAYRVLRTNILFAGR---KSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG-DRILIV
A0A381Z3K5      AEAYRVLRTNILFAGR---KSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQG-DRILIV
A0A0F9LFA5      AESVRTFRTSLLLTQL---ERDHK-VIAVTSSSPGEGKTTTSANLAMSLAQMG--KVLLI
A0A160TC29      QESIRTLRTSLTLASL---ENKAQ-VMLFTSSVPGEGKTTTSTNLAEAFGQME--KVVLI
A0A1J5R1Y0      AEAVRTARTGVLLSAI---DQPHK-IVVVTSSLPGEGKTTFAANLALAHAQTK--RVLLI
S0DG33          VEALRAVRTAVTRDLA---HARNN-ILMVIGPTPSAGKSFVAANLAILHAEIG-SRVVLI
A0A380TGM5      LEGIRSTYIQLALRSK---RPAIR-SLLVTSSMPKEGKTTLAIGLTRARAIAG-HRALLI
A0A380TDI0      AEAIRSLRTRLLLAFG---DRPPQ-VVVLTSAEPDEGKSTLGLSLVRAQAQAD-RRTLLI
A0A380TDN3      AEAIRSLRTRLLLAFG---DRPPQ-VLVLTSAEPDEGKSTLGLSLVRAQAQAD-RRTLLI
A0A3B0VME9      SEAIRTAMVAINLSTA---ATP-PKTVLITSVLPDAGKSTLASNLSLSLLASS-AKVLLI
A0A3B1DSR1      AESFRSVRTALYVIAA---SDK-AQVIQVTSPLSGDGKTTLIGNLAVAMANSG-KSVLLI
A0A0F9I1G8      SEAIRTTKVSLQLSGA---DAL-SKCFMITSTAPEEGKTTLAANLAFAFAGSE-EKVLLM
J9FGR8          NEAFRVMRSNLDFMSG---DTTQSQVFITTSFNPGSGKSFLTINMGMSFVLKG-KKVMLI
A0A0W8FS74      AEAFRSLRTSLHFSAI---NRD-KKIILITSTFPGEGKSIITANLSNTMAQTG-VKVLVV
A0A3B0V744      SEALRSIRTNIEFMIP---DKD-SKVLSVTSTIGSEGKTFISTNLGALLAMAG-KKTVIV
A0A644WNK5      ESERFKLVANMLYNKT---DKK---VFSITSCAMAEGKSTIIGNVALALAQMG-SKVLVI
A0A1W1D4H7      KEAFRNLRTNLQFLPE---SKN-HKIISITSSISGEGKTTISTTLGEMLAKGD-KKVILL
A0A3B1CUQ0      AESFRSLRTNLQFAVP---EKR-GRVFHFTSTMQGEGKTTITANLGVTLALMG-SRTLII
A0A1W1BK27      EEAMRVIRTNLQFIIP---KDKQCISILVSSTVPGEGKTTVIANLAHIIAQSNQKRVLIM
A0A1W1CD04      KEALRSIRTNLQFVIS---KNG-CTKILISSTVPQEGKTTISAGLAKIISEAD-KKVLLV
                 .        :               .   .     **:                  :::

A0A644ZI62      DADLRRPKVARYLSV--E-GGVGLTTVL-IGEAQLGDVVQPC--GV-------NDLHVVA
A0A1J5RCY3      DADLRRPSVAEYMGL--E-GSVGLTTVL-IGRAAVLDVVQPWGNG--------Q-LHVLP
A0A1J5RUE5      DADLRRPAIALDTGL--E-AAAGLTTIL-IGRATLEDVVQPWGEH--------DGLHVLT
A0A3B1C250      DADLRKHSLTEFLDS--NSNGLGLTDLV-SGQNTFQDCIRRLKLS--------KNLYILT
T0ZG59          DADMRNPAQHNLGTV--D-NSRGLSNVL-AGALTWREAVVGG--E--------NGPALLA
A0A0F9JKD8      DTDLRKPRIHNIFGF--S-NKSGLSTYL-VGSNA--KIIKEG--PS-------PNINIVT
A0A0F9XPI6      DADLRSPEQHKYFKM--DRNTKGLTDYLKEEEINWKSFIFSGLEKS-------KNHHVCL
A0A3B1AK25      DADMRRPTIAKTWDF--DPRSPGLSEFI-AESAQLSECVYQI--QD-------SNVHIMP
A0A2H9TBF4      DGDLRRPTVGKNFSI--KGGSAGLANLL-SGHAQMNECLHPR-----------NSIMVMP
A0A0F9KY21      DADMRKGYLQTQFGL--K-WDDGLSDYL-SGRLNLEQVTKPT--KV-------EGLSVIT
A0A0F9VQU4      DADLRKGNLHHAFGQ--A-STGGLVEFL-SGELTLEDIIKPT--GI-------PHYDVIT
A0A0F9W5Q6      DGDMRKGYVHKLLNR--E-PEPGLSNML-VSTHALADIVHKT--EV-------ENLHFIS
A0A2H9T6C5      DADMRKGRLHHYFAV--H-RGKGLSDIL-AGNADSSAI--RG--IN-------EKCHLLT
A0A1J5SM24      DCDLRKPNIHKSFRL--E-NLKGVIDVV-TGTAKLDDVIVKG--VY-------PNLDVLT
A0A3B1C7A9      DCDLRKPRVHTVFKE--Q-RFPGFTDYF-LGHTDLESVIHKS--KL-------PNLDFIT
A0A1J5SPZ5      DCDLRRPMLHRHYKQ--A-NNNGLISWY-ENGADLESDLLGN--PHLGIVKIGENLSLLC
A0A1W1DYN8      DADMRKGHIHKEYNL--S-RSPGLSELI-TNQVDKKVAVHNS--EF-------KNIDILT
A0A1W1E4Z5      DADMRKGHIHKEYNL--S-RSPGLSELI-TNQVDKKVAVHNS--EF-------KNIDILT
A0A0F9UWR4      DADLRRPTLARNFDF--PVGTPGLANLI-AGTAKVEDCIQTV--D--------AQLDMLT
A0A0F9U8M8      DADMRKPSICKRFDM--PTYHPGLSNFI-AGTDTLENCLYQD--EQ-------SGITVMP
A0A381Y0U7      DSDLRRPSMHRYLKV--S-NNIGLTNYL-LGQVAIDEVIQTT--EL-------PSLHFIP
A0A381Z3K5      DSDLRRPSMHRYLKV--S-NNIGLTNYL-LGQVAIDEVIQTT--EL-------PSLHFIP
A0A0F9LFA5      DADLRKPSIAKRFDI--PVFHPGLSNLI-VGTEQLSECIHVD--VQ-------SGVTIMP
A0A160TC29      DADMRRPTVARKLNM--PPNSRGLSNAV-AYPETLDDCIHHV--AD-------LGIDVIP
A0A1J5R1Y0      DADMRKPRLGRELGL--DDDLVGLSSLA-SGEREAKDCMRSV--PE-------STLQVIT
S0DG33          DADMRRGHLASLFD---ESNRGGLSEVL-SERMALRNALRTT--GV-------DGLTFLS
A0A380TGM5      DADLRRPSVHVRLK---LAREPGLVDLL-VGDASLEQVLQRD--EP-------TGAFVIA
A0A380TDI0      DADFRRSRLTTRITG--ISAQPGLYEVL-SGQATAEDAIQSD--PT-------SLADLMV
A0A380TDN3      DADFRRSRLTTRIPG--ISAQPGLYEVL-SGQATAADAIQSD--PA-------SLADLMV
A0A3B0VME9      DTDLRKPGLHKIFGQ--KDNSIGLSSFL-AGTADIDEVIMKT--EF-------PNLFFIP
A0A3B1DSR1      DADMRHRSVHLLFGL--R-HNIGVSDVL-TGEIEFLNAVQKT--GF-------KNLSALT
A0A0F9I1G8      DADLRKPHLHKIFTQWSDGTRPGLSSYL-AGVID-KNLIQKT--DI-------DNLWFVP
J9FGR8          DGDMRHGSLSAYAGS--P--KKGLSNYL-SGQAATWQEVTVDHPHN-------PNLKLIP
A0A0W8FS74      DCDLRRSSLHDKFGV--N-KVPGLSEVL-TGDTTFREVLHDT--GI-------PGIDVIT
A0A3B0V744      DLDLRKPKIHLAFEQ--KENANGVSSIL-IGKGKIEECIQNS--TI-------QNLDFIT
A0A644WNK5      DGDLRLPSMERYFRL--KHREIGLVDFV-TKKTRLEDCLIQPFENT-------PTLHLLP
A0A1W1D4H7      DLDLRKSSFHTEFEV--K-NDVGVSNYL-IAQNKLSEIIQTT--NI-------ENLDIIP
A0A3B1CUQ0      DLDLRKPRIHHIFDI--N-REPGITHLL-AGKSDFKEIIRPT--AT-------EHLYVIP
A0A1W1BK27      DLDLRKPRLYQELNK--S-NKLGMTQYL-TGDFELESCIQEV--N--------EHLDFFP
A0A1W1CD04      DLDLRKAKLHQELKQ--K-NRMGMSNYL-SGDIEIIDIIKPL--P--------NNLDFIS
                * *:*                 *.                                    

A0A644ZI62      AGALPPNPAELLGLPQMQQLLAEASRRYDTVIIDAPPLLPVTDAAVLSRITDGTLVVVGS
A0A1J5RCY3      SGQIPPNPSELLGSRAMVTLLDKLAQLYDLVLIDTPPLLPVTDAAILSRLTGGALVVVGA
A0A1J5RUE5      SGEIPPNPSQLLDSPAMHRVLDEAVKTYDLVVVDCPPVLPVVDASVLGRHVDGVLLVIGL
A0A3B1C250      SGATPPNPLEFLSSRRLANTFNQVKKAFDTIIIDTPPILLFSDAMVVGQLVDCCILSIRS
T0ZG59          CGPLPPNPAELLAGPRLATLLAEAQAEYDLVILDSPPVLGLADAPVLGHCAAGTLLVIEA
A0A0F9JKD8      SGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVLTVTDSLVLSKYVDGTIVVARA
A0A0F9XPI6      SGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTLFVIRA
A0A3B1AK25      SGTVPPNPLALLSSNRFTTALDHLGKNFDHIIIDSAPCLAVSDALVLSRCASGVILVVKA
A0A2H9TBF4      AGMMPPDPTQLFAEEKFKNVLSQLSERFDTVIMDCPPMQGISDTLMISQLCDAVVYVVEA
A0A0F9KY21      RGQIPPNPSELLMHSNFSKLVEEVSTAYDIIIVDTPPILAVTDPAIVSAHCGTTLLVARF
A0A0F9VQU4      RGVSASNPSELLMRPGFEQALEDLSEMYDMVIVDTPPVLAVTDACVAGKHCGTTLLVTRF
A0A0F9W5Q6      RGQIPPNPSELLMHANFETLLKKLSSMYDLVIVDTPPVLAVTDAALVGRLAGTSLIVTRF
A0A2H9T6C5      AGRIPPNPSELLMSQSFSAFLEKASDVYDVVLVDTPPILAVTDAAIIGRQCSQTFLVAWA
A0A1J5SM24      TGGRAKNPTQILNSKDFELMISDLKKRYDRVFVDSPPLAAVSDAMIILPLCDGSLFTIFF
A0A3B1C7A9      CGTIPPNPSEILGSQQMVDLLARLKTKYDLIVLDSPPIIAVTDSEILSRIADTTILVAAS
A0A1J5SPZ5      SGGRSKTPSELLESNTFAQLLERLKRRFDLIVVDSPPLGAVTDSLLIAERIDEVIYVCRF
A0A1W1DYN8      TGALPPNPSELLMHKNFGQYLTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLHY
A0A1W1E4Z5      TGALPPNPSELLMHKNFGRYLTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLHY
A0A0F9UWR4      AGAVPPNPLELLASPRFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVIYVIKS
A0A0F9U8M8      CGQLPPNPLELLSSNKFSKVIEQLKEKFDRIIIDTAPIQAVSDSLMISKSVDSVIYVVKS
A0A381Y0U7      SGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQY
A0A381Z3K5      SGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQY
A0A0F9LFA5      SGQIPSNPLELLSNARFSEVIDDFKAQYDHIIIDTPPTQAVSDALVIAQSVDSVIYVVKS
A0A160TC29      AGPIPPNPLELLASKNFSALLETLKGRYDRIIIDSAPTHAVSDATYLSTLVDGVVYVVKA
A0A1J5R1Y0      AGAVPPNPLELLLSQRFQETIAALSREFDLVILDSPPVHLVSDAIILSTLATGVVFVMKA
S0DG33          CGLRPENPAALLMKPRFKDVLERLAGQFDLVIIDTPPFLAVTDASIIANEAGASLLVLRS
A0A380TGM5      SGSAARDPSDLLGSKAVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETVFVIQW
A0A380TDI0      SGASSADRKVLGDAARLEGLLAKLRGRYDLIVIDAPPALALAEGQVIPMVADATLLVVRW
A0A380TDN3      SGSSSADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATLLVVRW
A0A3B0VME9      SGPIPPSPAELLASSTMRAFIAAAAREYDYLILDAPPFHGFAEILILSNMVDGVILTTQL
A0A3B1DSR1      AGEEPENPAELLASPTFKKMLSEAKSQFDFILIDTPPLLAVSDPCIVAPQTDGLLLILRL
A0A0F9I1G8      SGPIPPNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVVLVSSI
J9FGR8          VGTVPPNPTELLENGKLARLVDALKAEFDYIFIDCPPVDIIADTQIIAQVADRTLFVVRA
A0A0W8FS74      AGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVLLIMEA
A0A3B0V744      AGAIPPNPSELILRKEFGEMIENLKLKYEVVILDTPPVGLVTDGLLAMQKADLPLYVIKA
A0A644WNK5      PGNAPLVPAAIFSNPRYIQGLSYLENLYDFIIIDAPPLESASELLSISKHVDGLIITVRA
A0A1W1D4H7      TGPLPPNPSELILSKAFTKMLEVLKKKYDYIIIDTPPAGLVTDAIIVMNYSDLSLFLVRA
A0A3B1CUQ0      AGIIPPNPSELLSQQDLRDFLDKTRKEFDYILIDSPPVLPVTDSLLLGRLADASFIIIKL
A0A1W1BK27      AGAIPPNPSELLMSEKFDKTIKKLFLTYDYILFDTSPIGSIIDAKILLPYSDIVLLVVRA
A0A1W1CD04      AGAKPPNPSELLMSEKFNKAINELEKHYDYIIFDTAPIGIVTDANMILKHTDIVLLIVKA
                 *  .     :         .      :: :..* .*     :           .     

A0A644ZI62      SIARRPELAKALEALERVDTRILGLLL-TRARGHD----------------------AGH
A0A1J5RCY3      GKLQRQQLAEAMGALETVGARVLGLVL-NRLAKTP------------------------S
A0A1J5RUE5      RQVRRQQVRSALAAITAVGATPLGLVITNAVDDGA------------------------G
A0A3B1C250      DQTTHNMAQDAVKRLTSSQLKPLGVVL-SYANTKG---------GKSYGGYYGDY-YGDY
T0ZG59          GGARIDHIRDALKRLRAARARVVGAAI-TKLDARH------------------GAYGYGY
A0A0F9JKD8      AKTSYEAVRKGLRQLNDVGSNVLGLLI-NAIDARK-------------GGYYYNYYYYHD
A0A0F9XPI6      GVTDKAILHGASEDSHRDKLKNMAYVL-NDVHARN----------------------IKS
A0A3B1AK25      DATPYPVAQDAIKRLHQSNARIIGGVL-NNVSKSK---------KGGYG----NYGKYSY
A0A2H9TBF4      GRASKTAISHSTGRLLQNSVPLTGVVL-NKVNTRR---------GHEDG----YYGYYDY
A0A0F9KY21      GQNHVREIELTRNRFEQNGIDVKGVVF-NGVVKKA---------SN-------AYGYYGY
A0A0F9VQU4      DRNSVREILMAKKRLESSGLEIQGAIL-NGV-KIS---------SRG------ASGYYGY
A0A0F9W5Q6      GLNPVREIEQTLQRFRNNGVDIKGAIF-NAVEKKA---------SAY------GYGNYGY
A0A2H9T6C5      EKNTASEISYAAKRLQQAKVNVKGCIL-NGMVHTS---------SR--------YGQYGY
A0A1J5SM24      NKVRRKAAQFVAHKLTDSNVPNFGAVL-NGLNLAV---------S--------GYYYAQY
A0A3B1C7A9      GETEIELLKKSAELLQHDSDSFIGVVL-NKFTFKS------------------GYGSYYK
A0A1J5SPZ5      NRAYRKHIKLYIKALRSGKNEILGIVL-NGLSPRR---------IEYYS----NYRYYRS
A0A1W1DYN8      GMHSMSEIRATINRLRQNNIETKGFIF-NGIKAHG------------------GYGKYAH
A0A1W1E4Z5      GMHSMSEIRATINRLRQNNIETKGFIF-NGIKAHG------------------GYGKYAH
A0A0F9UWR4      ESTSISMAQKGVGQLLQSGASIVGVVL-NQVDVKK---------AAKKG-EYSGY----Y
A0A0F9U8M8      DDTHLSIIKNGIGRLLQDKAKLAGVVL-NHVDTDK---------VAKTQ-GYNGY----Y
A0A381Y0U7      RKYPQLMTQRAKGMVTKVGGELVGVVL-NNINISQ---------DSYYY-YYSGY----Y
A0A381Z3K5      RKYPQLMTQRAKGMVTKVGGELVGVVL-NNINISQ---------DSYYY-YYSGY----Y
A0A0F9LFA5      DITRIKPIKAGIERLFEAKAHVAGIVL-NQVDMSK---------SKDEHSH--GY----Y
A0A160TC29      DETKDKLITSGIARLHDSNARILGVLL-NQMDVEK---------EARYGGHYSGY----Y
A0A1J5R1Y0      NSTPYQVAQRCLRALQGAKATLFGVVL-NQLDFKK---------AESHYGDYSGYGSYGK
S0DG33          GMQSEEEIADTVKKMERAEGRISGAVF-NGIPLRR---------STRNY----GY-ETNY
A0A380TGM5      GKTGREVVKLALEKLTETQGVPRGIVL-SRVDTAK----------IRLY----GYGDAAY
A0A380TDI0      GKTRKRVVRYTMDQLTRFGMPLHGVVL-NMVDVRK----------QAYY----GYGDAGY
A0A380TDN3      GKTRKRVVRYTMDQLTRFGMPLHGVVL-NMVDVRK----------QAYY----GYGDAGY
A0A3B0VME9      NRTPRDGVEYFRKAVTNVGGRILGTLV-NKVPTGK-----------TGSRYYGGYKYYKY
A0A3B1DSR1      KKDSRADITRAAELLDTHNIDVLGAIV-NGVEISP---------------DEQTYGNYYS
A0A0F9I1G8      GETTRDALRHFKKGILNVQGTILGCII-NKVNLTK------------RYGYRAYYKYYQA
J9FGR8          GLLDRSMLPVLQGMYDDKRFQGMAMIL-NGTESSR-------------GRYSYRYGYYYG
A0A0W8FS74      GRVPIKAAQHMREMLSNVQAPVAGFVL-NDKTGSGETYGYYGSRYYRYGRYGKGYGYGYG
A0A3B0V744      DFSKRSFVQNVNRVLATGQFNNLSIIL-NATTTSE----------------T---GYGYG
A0A644WNK5      GITSKGSLYDLVSNLRTANAPLIGFVF-NGVIPGT----------------TSSYGYGYG
A0A1W1D4H7      NYTKKEFIKNIDKLVKEYKENRVGIIF-NGATINS----------------Q--YGYY-G
A0A3B1CUQ0      GETSFPAVEQAVKQLRSVDVNVAGAII-NKIKPSA----------------G--YGYYHN
A0A1W1BK27      NVAEKGFIEHFNNLRKETEIQSSGIIL-NDVKHDK----------------SSSYGYGYG
A0A1W1CD04      GSAEKDFINNFNKMVKDKNIESSGIIL-NGVKISK----------------GKNYGYGYG
                                       .  . .                               

A0A644ZI62      YRYDYSYQPTTRGQGPVIEQISDAHEPPARAARRSDSWAVVG------------------
A0A1J5RCY3      DSYTYY------------------DYSTETGSTVTKKRSRTAASTSETQRPPAHTGSRRL
A0A1J5RUE5      APYSYRRPDEIRPHRSQPWRRRRPDEIRQNGADADVDAAVSSTAGPEDPRTPISPEPRE-
A0A3B1C250      YGAEFDEDEDDFITKKSNKSRRGKRKGRSLATVGGIALALTIIAYFLWNPDKSLLSALPT
T0ZG59          NSYDYGDAYGGKTSRRNA------------------------------------------
A0A0F9JKD8      YNYYYSAKDEEGEE----------------------------------------------
A0A0F9XPI6      YNYGYGEV----------------------------------------------------
A0A3B1AK25      YDGCYYGSYGYTND----------------------------------------------
A0A2H9TBF4      HGYSDGHQDNKKHPDAQGKRIKTAEIEPESVV----------------------------
A0A0F9KY21      YNYEYKSDK---------------------------------------------------
A0A0F9VQU4      GTYKYQ------------------------------------------------------
A0A0F9W5Q6      YQYEYKSDGK--------------------------------------------------
A0A2H9T6C5      YHYAYGDKA---------------------------------------------------
A0A1J5SM24      YDKTYKDYYVVMAKQDPDTPER--------------------------------------
A0A3B1C7A9      YYYYYSNNKDAKKKKFFSKKT---------------------------------------
A0A1J5SPZ5      YKKYYGAQT---------------------------------------------------
A0A1W1DYN8      YHYEYKTQE---------------------------------------------------
A0A1W1E4Z5      YHYEYKTQE---------------------------------------------------
A0A0F9UWR4      DHYGYSEQNA--------------------------------------------------
A0A0F9U8M8      DYYSYGKKNT--------------------------------------------------
A0A381Y0U7      YDYYYKSREKEESADETQDGEKEAKLVANADIGGEDEKPKY-------------------
A0A381Z3K5      YDYYYKSREKEESADETQDGEKEAKLVANADIGGEDEKPKY-------------------
A0A0F9LFA5      DYYDYSQKPEQPNA----------------------------------------------
A0A160TC29      DGYGYTTTEQS-------------------------------------------------
A0A1J5R1Y0      DAAGYYMKESS-------------------------------------------------
S0DG33          ASDVGDLEATR-------------------------------------------------
A0A380TGM5      YDRTVREYYTRGSA----------------------------------------------
A0A380TDI0      YYGKRAKYYTS-------------------------------------------------
A0A380TDN3      YYGKRAKYYTS-------------------------------------------------
A0A3B0VME9      YSYDYEYGRDA-------------------------------------------------
A0A3B1DSR1      SEQQEETKNNLAEAMVSQS-----------------------------------------
A0A0F9I1G8      YNYDYGEDNKRKRVKKLKSDREK-------------------------------------
J9FGR8          HGNYYSQQ----------------------------------------------------
A0A0W8FS74      YGYGYYSDDEPNRCKNPQRWEKVLNFIPEKLRKEIKKRFKF-------------------
A0A3B0V744      KKSAYYET----------------------------------------------------
A0A644WNK5      RGYGYGYSAYRYGYAQGQSGSRKKSKSHSRRRSTSWYRKRYKQDLRNRGKISSEQFDPIL
A0A1W1D4H7      Y-YNYYK-----------------------------------------------------
A0A3B1CUQ0      Y-YHYYYGDESPEEKKNT------------------------------------------
A0A1W1BK27      YGYGV-------------------------------------------------------
A0A1W1CD04      YGYGYGYGEE--------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      VPRTGQIRAVSAAEVAPRGEIDDPMGDLFPPTGPQRTSAWPGERMSGGTTEDWSSHQV--
A0A1J5RUE5      -ARASAVQNANAAADAPDADV-------------------PAGGDGQNRKKNVASPTA--
A0A3B1C250      LDIGIGSTAEEPKGEALSKPWSPQTGAKGDPSVKPEPAQKNSRTMKPNKPKAKPTAKKQP
T0ZG59          ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      AFGEHAEYRTLEAWAQEHATTHSTAFTEARTSVFADLPPSNVESKPASPQQKPKAVLPTV
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      IAKFSTPRSGSAKPKPIPAILTLPAADGKSLQGKRVEIVASSTTGDTRVTGGGFGSSTAA
T0ZG59          ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      ELDGLGAIEKDPDAVGKKQEE---------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      GDMSKWIGEGWEKMNTEGIEAACPVWEAGLRSSTAESVVLIVGRYSGLTKAKVPLELLGE
T0ZG59          ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

A0A644ZI62      ------------------------------------------------------------
A0A1J5RCY3      ------------------------------------------------------------
A0A1J5RUE5      ------------------------------------------------------------
A0A3B1C250      ELPIFAVCAKYRGKNAYYVLAAPSPANLKKTQKIIRSRLNIKSVKGNYPQKLVRIIDRGR
T0ZG59          ------------------------------------------------------------
A0A0F9JKD8      ------------------------------------------------------------
A0A0F9XPI6      ------------------------------------------------------------
A0A3B1AK25      ------------------------------------------------------------
A0A2H9TBF4      ------------------------------------------------------------
A0A0F9KY21      ------------------------------------------------------------
A0A0F9VQU4      ------------------------------------------------------------
A0A0F9W5Q6      ------------------------------------------------------------
A0A2H9T6C5      ------------------------------------------------------------
A0A1J5SM24      ------------------------------------------------------------
A0A3B1C7A9      ------------------------------------------------------------
A0A1J5SPZ5      ------------------------------------------------------------
A0A1W1DYN8      ------------------------------------------------------------
A0A1W1E4Z5      ------------------------------------------------------------
A0A0F9UWR4      ------------------------------------------------------------
A0A0F9U8M8      ------------------------------------------------------------
A0A381Y0U7      ------------------------------------------------------------
A0A381Z3K5      ------------------------------------------------------------
A0A0F9LFA5      ------------------------------------------------------------
A0A160TC29      ------------------------------------------------------------
A0A1J5R1Y0      ------------------------------------------------------------
S0DG33          ------------------------------------------------------------
A0A380TGM5      ------------------------------------------------------------
A0A380TDI0      ------------------------------------------------------------
A0A380TDN3      ------------------------------------------------------------
A0A3B0VME9      ------------------------------------------------------------
A0A3B1DSR1      ------------------------------------------------------------
A0A0F9I1G8      ------------------------------------------------------------
J9FGR8          ------------------------------------------------------------
A0A0W8FS74      ------------------------------------------------------------
A0A3B0V744      ------------------------------------------------------------
A0A644WNK5      ------------------------------------------------------------
A0A1W1D4H7      ------------------------------------------------------------
A0A3B1CUQ0      ------------------------------------------------------------
A0A1W1BK27      ------------------------------------------------------------
A0A1W1CD04      ------------------------------------------------------------
                                                                            

© 1998-2020Legal notice