BYKdb

Dataset for cluster tadcd of phylum metagenomes

[Download (right click)] [Alignment] [Repertoires]

40 sequence(s)

>gnl|bykdb|A0A0F9I1G8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=765 residues).
DLPIAPAPVRRDNEEMLPSTEFRQAAPDWEGEEVHLRDYLEVIARRKWLIFGFLALVFISTLIFTLTATKIYKANAVIEA
NRDAPRVTKFEEVTAALASAREFYQAQVSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEFVRSLIPQKK
EETAKRPVIPKETLKQQGLIGFVNGNLTPILQRNSNLISISFTSPDRHLSQDVVNTLIEEFVRWKMDQKLEASQLAREFL
TKQIYQSKINLEKVEEELNRFARMSGIVSLDTKLNSVYSQLGELNTALARAEAEMIGKRAIYNQAIKDGPASLPRVLSNL
VIANLKADYARLVSQYQDLTTTFLDDYPEVKNLKSRMLSIGERIHIEEKKIFKAIENEYQTALKKRTALQERVSLQKTLA
IDLNERATQYKIIAREVETNKGIYQSLLERAKEIESMVGVSSSNIHIVDRALLPIFPFKPNVRLNLLLAIVVGLMGGIGL
AFLLEYFADTITNPDQISERFQIPILGVVPLAKSGDYVLDKAFVSEPRAPISEAIRTTKVSLQLSGADALSKCFMITSTA
PEEGKTTLAANLAFAFAGSEEKVLLMDADLRKPHLHKIFTQWSDGTRPGLSSYLAGVIDKNLIQKTDIDNLWFVPSGPIP
PNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVVLVSSIGETTRDALRHFKKGILNVQGTILGC
IINKVNLTKRYGYRAYYKYYQAYNYDYGEDNKRKRVKKLKSDREK
>gnl|bykdb|A0A0F9JKD8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=721 residues).
MQQQEIHLRDYFRILRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIEKSEQYTITEYGFTVYDPEFYSTQYKII
KSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLLPGGGPEDEGADPEAAKRKLIVETILENISVNPEVDTRLVT
VSYLSGNPDLARLVVNTLANAYIEALFELRMDSSQRALQWMSRKVEEERNKLDDSESGLQAYMKANDIVTLEDRIAIVPQ
KLLELSTQLTRSETRRKELETLRNKIRSLKAAGKDLDSLPAIASDKTVASLRGQVLKGEQRITEFSKKYGQKHPLMIESV
GDLRVLREKKEQEIGRVVKSVENEYDLALSNEHNIRRLLSETKLEAHGINEKFVKYNSLKREVDTNRKLFESLLQKMHKE
RIEEEGQTVNVMLVETAETPSYPESPKKALNLIIGFMIGILGGAMLAFFFEYFDNTVKAAEDAEEKLGIPVLGMVSHLRR
EKKGKERHIERIVIEEPKSSFAENYKALRTAIMLSSAESTPKTLLITSMGPAEGKTATAVNLALVVAQSVGKVLLVDTDL
RKPRIHNIFGFSNKSGLSTYLVGSNAKIIKEGPSPNINIVTSGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVL
TVTDSLVLSKYVDGTIVVARAAKTSYEAVRKGLRQLNDVGSNVLGLLINAIDARKGGYYYNYYYYHDYNYYYSAKDEEGE
E
>gnl|bykdb|A0A0F9KY21 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=747 residues).
MVKLMNSKPIAPTNDQNKSSAQEIDLLALLGTLLDRKYFIVLFTAVFAVIGVAVAIFSTPIYKATALIQVEESSPSVPGL
DDMAGMFESSSEAVTEIELLKSRSVIGEAVDSLKLDITAEPKLFPIIGGKFYIEFTAEKPNDIAEPMLGASSYAWGGEFI
SVFRFVVPKALEGEEFELLVKQNSQYELLNPNGDVVLNGTVGKDEKDGFYELTVRELNARPDTIFTLVKNNRYRTVVKLQ
QEISASEKGKDSGIITLAYEHKNASHAEKVLDKVSDIYVRRNVERNSAEAKKSLDFLEVQLPEVKKQLEGSEQRFNDYQK
QRKSVNITLETQAILEQIVELDTTLQELDLKRLELSRKFKREHPAYQGVIKQIESIEAEKELLTSKVSNLPETQQELLRL
TRDVEVGNEIYMLLLSKTQELDIVRAGTVGNVRVVDAAAVDTTEPVKPKKALIAVVATLLGGFLAVAIVLIQKAMHRGVE
DPSEIEALGLAVYASVPHSDHQDKLSGFAERARKNKTNKPKSILALDNPADLAIEALRSLRTSLHFAMIEAKNNIIAISG
PSPSVGKSFISVNLASVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGRLNLEQVTKPTKVEGLSVITRGQIP
PNPSELLMHSNFSKLVEEVSTAYDIIIVDTPPILAVTDPAIVSAHCGTTLLVARFGQNHVREIELTRNRFEQNGIDVKGV
VFNGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0F9LFA5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=735 residues).
MNQTNENLSNNEEIIDLGSYLNVIKRAKWRILGFATVVTLLAIMVALTLIPKYVATATLLIEAEQTKAVSFDEIYGLDST
KKEYYLTQFEVIKSDSIAREVITKLNLKAHTDFIAKPSVLGELKATVKEQLPFLNKKEVTVYAPEEQAEREMLGLLAVFK
SRLSVSPIRKTQLVQVSFESSDPKLAALVANTVGEVYIESQMRAKMGITQQASSWLNTRLSQLRIQLDNSEVRLQEYREL
QKLVDIEGIAGLVTQELEQISQQLIVARNEKNNLESINRVISEYGNNNLELLGSMPEITSHRVIQDVKREVILVERKLSD
LGEVYGPRHPKIISANAELATVKNNLNKQIKGLITGIEKELNRVTRTVSALERDLVKIRAEYQDITRKETQYNQLKREVE
TNRNIFNTFLSRSKETEVTSDFSSAAARFTDRAYAPNNPVKPNKKLIVILAFVASFGFAVVMSFIFDALNDTVKTKSDVE
GKLAQRMLGLLPHVQTPKNSVFPIHAYLDDNYRRFAESVRTFRTSLLLTQLERDHKVIAVTSSSPGEGKTTTSANLAMSL
AQMGKVLLIDADLRKPSIAKRFDIPVFHPGLSNLIVGTEQLSECIHVDVQSGVTIMPSGQIPSNPLELLSNARFSEVIDD
FKAQYDHIIIDTPPTQAVSDALVIAQSVDSVIYVVKSDITRIKPIKAGIERLFEAKAHVAGIVLNQVDMSKSKDEHSHGY
YDYYDYSQKPEQPNA
>gnl|bykdb|A0A0F9U8M8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=724 residues).
MNTSSNTFLETNNTLDLKRYLHACMEYKWRLIFISSLISVIAAFVVMQIKPTYESTATLLIEPEQKNVVSIDEMYGFNTA
KREFYSTQFEILQSKYIAEAVIEKLNLIKHPEFNDEENNLFGLKALFSSFFGEGGTDDELDLEYKMAHLINDFRQRLSVK
PIQGTQLVHITYQASDRKLAAKIANAIGEVYIETHLEAKLGVTRRASAWMSEKMAGLTKQLERSETAFESFRQKNNIVDI
DSAVLRIDSELEKTQATLAIAESDKSKVDSILELINRFGKSDFENLKSLPEIISHSSISEGRVLLETAELKFAELSKIYG
PKHPKLIAASEELDMRVEQVNAQIQSLISGIEKESYTAAQRVKRYRKELSDIRSKYSDITGLDTKYTALKIELDTNRNLY
NTFLERSRETEATSDYKASPAHFTGVAAASLYPVKPNKKMIVAGAFFLSLMFFVGLVILFEMLDDTIKSPSDIESKLSMR
MLGMIPLSKNTALDIRTFFDKEQQQFSEAVRTLRTGVVLSQMDAENNKVIEVTSSIPGEGKTTTSINLAFSLGQIEKVLL
IDADMRKPSICKRFDMPTYHPGLSNFIAGTDTLENCLYQDEQSGITVMPCGQLPPNPLELLSSNKFSKVIEQLKEKFDRI
IIDTAPIQAVSDSLMISKSVDSVIYVVKSDDTHLSIIKNGIGRLLQDKAKLAGVVLNHVDTDKVAKTQGYNGYYDYYSYG
KKNT
>gnl|bykdb|A0A0F9UWR4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=740 residues).
MNSSIRPDRQWQPMPSDDDTDYIDLKKIWYAIWSRKWSIISLVVVVSMLATLAVMQMTPVYRASTTMMIEGKGNQLVAFQ
QVYDNTGQLNEYLQTQIGLISSRGVAERVVRELNLVEHPEFDPRQQDQPLIDIRGIIKSLQGMVLGEDPSDGAEPMTEAQ
IMDNVTQQFMQRVSVSVEGKSQLVRISVEMADRLTAAQAANSVANSYIEGQLEAQMEMSMAATTWMNSRLSELRTSLKEA
ENRLQAYREQEGLVDVDGVGTVSANELALTGDRMVDARSQRAEAESQYRQVQAMSEQGWERMASVPAVLGHPLIQQFKSE
QARARARVEELSRRYGERYPAMQAAQSDLNAATASLRAQVEQVVAGIERNYQLAVANEQSVRASFDANKEQIQDISRKEF
RVRELTREVESNRELYETFMTRLRETTSTQDLSTTNARIVDQAIPPSRPSAPNTKLLIIIATMLALIVGVAIALIADFLN
NTFKSAEDVENNLNLPVLGIVPLVAKKQQKKVSHLFEKGDDMRFCEAVRTIRTSVMLADMSRPQKVIVITSSVPGEGKSS
VAANMAFALGQLQRVLLIDADLRRPTLARNFDFPVGTPGLANLIAGTAKVEDCIQTVDAQLDMLTAGAVPPNPLELLASP
RFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVIYVIKSESTSISMAQKGVGQLLQSGASIVGVVLNQVDVKKA
AKKGEYSGYYDHYGYSEQNA
>gnl|bykdb|A0A0F9VQU4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=742 residues).
MTESVAIEPMSDLSQKSLPEETIDLSRLFGALFRKKWLIIGVTLLFAFIGIVHGMLSTPVYRADALVQVERRNTVSPFGN
VDNVTGSGSGELNTSAELQILQSRMVLGQVVDRVSSDLIISPVQVPFIGGFVLRRGIPRPAFLQGYPHIWGDESINVARF
TTLDSSRGRSFIVERGAGDSYHIMQGDSRLGTGTLGQPEVFLDGELELTVESFNAAEGAQYVLTRLQKTSAIRGIAGRLQ
VAEVGGAGTTTGMIRLMMFGEDPSEITRSLDAVAQTFLTQNIERQSEQAQQSLEFLQRQAPELREQLDLAEQNLNDYRAN
LDSVDLSSEAQAAIQRYIELDTRLDELEFQEAELAQRFTPSHPNYQALIRQRRQIQRDLQELNARVNELPAAQQEVLRRT
RDVEVTQAIYVNILNKVQELEVARAGTIGNIRIIDSAVLSGQVAPNTPRIFILYTILGLLLITGYVLLKELFKRGVESPD
QIERLGLTVYANVPQSSAQRKLNRALKRRGEKTSKSVVGGVLAQRDPMDLSLESLRGLRTSLHFTMMDGRNNRVMLTGPS
PGVGKSFVSVNLGAISALAGKKVLIVDADLRKGNLHHAFGQASTGGLVEFLSGELTLEDIIKPTGIPHYDVITRGVSASN
PSELLMRPGFEQALEDLSEMYDMVIVDTPPVLAVTDACVAGKHCGTTLLVTRFDRNSVREILMAKKRLESSGLEIQGAIL
NGVKISSRGASGYYGYGTYKYQ
>gnl|bykdb|A0A0F9W5Q6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=741 residues).
MQTTSAPTANETSDEIDLLALLGALIDHKLTIIACTLVFAVCGIAYALLSTPIYQANAVIQIEEKSQGIGSLLGDAAGGE
MFSSASAATTEIELLKSRKVIGQAVDNLKLDIVAEPKLMPVIGSFFYRRFSPTSDEPLANSFLGFDSYAWGGEQLKIFQL
EVPRAYEGEELVLRAEENNGYTLLNEDGETLVSGTVDQPLDEQGFRIQIETLSAHPGTEFLVTKRNDLSTILDYQRRVGA
SEKGKDSGIISMSLASPHPAKATATLDEISRLYVRQNVERKSAEAQQSLDFLKEQLPEVRRQLEAAENALNEYQASAGSV
DITLETQAVLDQVVELETAISELALKRSEMERRFTRQHPTYQALMEQKRQLETRRDDLLKRVGGLPETQQELLRFARDVK
VSTEIYTAMLNKSQELDIVRAGTVGNVRIIDDAVVDTSQPVKPKKALIVVLATLLGGMLGVAIALLRHALNRGIENPELI
EQMGLPVYAAVPFSKDQQILERGSKTKGNIQGSHLLAATNPADLSIEALRSLRTSLHFAMMEAKNNILMISGPSPSVGKS
FISANLAAIVAQTGQKVVLLDGDMRKGYVHKLLNREPEPGLSNMLVSTHALADIVHKTEVENLHFISRGQIPPNPSELLM
HANFETLLKKLSSMYDLVIVDTPPVLAVTDAALVGRLAGTSLIVTRFGLNPVREIEQTLQRFRNNGVDIKGAIFNAVEKK
ASAYGYGNYGYYQYEYKSDGK
>gnl|bykdb|A0A0F9XPI6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=769 residues).
MTETPFNLDYDQKQDRFDLGEILKKYIKYWPWFAASFLLTLAFAVFYLLSTAKIYESVAKIKIVDNSTDIGLQSNAMSLF
TNGSTINLDNQIEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKETSEELKKAQSLSVNFMANDIEVTDS
NGNNFTLFYKQSENALKTSPFRILMIDTLQNLNLIGQEYEVVISPIKNTVLGLINKMEIQTTTKDSDVLAISLSGNYPTK
SELILNTLIKKFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSIEGGKQAFKTRNNLSYIEADAGVSLERKSETENDVI
KLETQISLSALLKNSVVGQAAFELLPVDVGLENSGLNSMVDRYNDQVLQRNKLLQTVGIQHPSLIAISTQLEVAKVNIIK
TINIYQTQLRTSLIQSNQAQNKVNSVFSGLPEKEKMLRSIERQQSIKENLFLLLLQKREEAGISLAVTTPLVKIVDYALT
STTPIAPKKTIILGVSGILGLLIPFVFFYIKFSLNDKIGSKSDVLAIESSIPFLGEIPHFKTEKKFIDFNDHSVLAESFR
ILATNINYMLPKRKDGSGNVIFVTSGYMGEGKSLLAYNLSVAYASINKKVLLIDADLRSPEQHKYFKMDRNTKGLTDYLK
EEEINWKSFIFSGLEKSKNHHVCLSGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTLF
VIRAGVTDKAILHGASEDSHRDKLKNMAYVLNDVHARNIKSYNYGYGEV
>gnl|bykdb|A0A0W8FS74 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrocarbon metagenome] (length=812 residues).
MTPNVSIPPSQPLLRSGENAHIYDYLSVILRRRKLFTLAFCAVLFSVVLYTYFMKPIYEASSTLHIKKEKGPGVLVDMNF
DSSNSIDAELEIIKSRTNLEHVAKRLHLDWQVTKKSKDLDFKLLDFSSTAKNPSYKIEMTGADTFTVKDEDGKLIGEGIS
GRLMQAKGFSLLLNDLKGEKGDSFRLKLLPLQNIAVSLKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQVYLGQ
NIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKSSSGMFKLDSEAQEVVKNLSETEKLRAEVIFQKKQVEFALDA
LNSALRKGNIYSPAIMRDDPLVAGLAAKLSELEIQKRTLLTDYTENHPAVRTIQGQIDEIQKKIRSTYETNLVNLNKQQS
SVTHQLDIYESKLRKLPKAERDLARLTRVSNVNAGIYTFLLQKHEEARIAKATTVSNINIVDPAITPVSPIKPDKPKNLL
LGFLVACILGIGLAFFQEYLDDTIKDAEEAKRAIGLPLLAVIPFITSRAENGEAKKRLPLITRLEPKSQVAEAFRSLRTS
LHFSAINRDKKIILITSTFPGEGKSIITANLSNTMAQTGVKVLVVDCDLRRSSLHDKFGVNKVPGLSEVLTGDTTFREVL
HDTGIPGIDVITAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVLLIMEAGRVPIKAA
QHMREMLSNVQAPVAGFVLNDKTGSGETYGYYGSRYYRYGRYGKGYGYGYGYGYGYYSDDEPNRCKNPQRWEKVLNFIPE
KLRKEIKKRFKF
>gnl|bykdb|A0A160TC29 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=729 residues).
MNNAAAVEVIDLTHYWHVIRRQMRKIMALSVIATIVAVLVALVMTPIYRATATLLIESEEAKILSIEEVYGLSGQSSEYF
LTQFEILKSRELAKRVVLQLGLVDNPEFNPYHEANGKSFSLREFILGAKEPPTADEVLAKTIENFWQAISIEPVRKTQLV
KISVESQSPELAYTAANAVAEGYIESQMEARVGLTQQAAVWLSDRLGGLKDKLSESERKLQTYREQNDLVDIEGVNTLVA
KETDQITERLIEARSRRLELEGTYRQLQSLAEQTYESLSSLPSILNNPLVVKLRENETNAELKVSELSKRYGPLHPRMIA
AQSDLDAVRDSVFTQMKRIANGIENDFLVAKSKENSLQSALNSTKARIRDMNRTEFELNDYVREVRANRGLYETFFNRIS
ETSVTGDLQTANARVIDPAVLPKEPIKPNKKLIVALALVVSAMFGIALAFLLDALDATVKNAEDVDRKLGVSLLGIVPLI
ASGKRNKKIDPNKLDATLVRAFVEGSDHGFQESIRTLRTSLTLASLENKAQVMLFTSSVPGEGKTTTSTNLAEAFGQMEK
VVLIDADMRRPTVARKLNMPPNSRGLSNAVAYPETLDDCIHHVADLGIDVIPAGPIPPNPLELLASKNFSALLETLKGRY
DRIIIDSAPTHAVSDATYLSTLVDGVVYVVKADETKDKLITSGIARLHDSNARILGVLLNQMDVEKEARYGGHYSGYYDG
YGYTTTEQS
>gnl|bykdb|A0A1J5R1Y0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=733 residues).
MDTPTANPAHTTIQGAAQLSEEKLELLTYWRTFVKHKLTIFSLALAVGILAAVVVYMMRPIYRATAMIQLEDNNAKVLSI
EQVYSSLAHGSEHVQTQADILRSRTIAELVLTKLDLVHNPEFSPGRDLTWLAKAKIALGIAHPPTVSDQPGTVLGELRAH
LTIAPVPRSNLIQVSYDSPDPRMAALIANTFAEQYIRNDMENKFRMTQEANSWLNEHLAGLKAKLEASEQRLQTYRNQQN
IIDVNGSALSGTGNQLEGLVTNLVTARMKMAEAASAYQQIRNAQASGTSLDSLPLVVRDPVVAQLEQVVAQKQQKVSELS
KRYGPKFITMIQAQAELQQARDNLKHQVAIVVSSIEHAYNEARANVQALSGAVAEVRGSIRQANEKQFALADLQRDVQTN
QQVYDMFLQRFKETSAATDLTKPIASVVDPATAPVVPLRPHKARVIAAALLVGLLFGIAVAFLLERLDTTVRSTEEVGLR
LGQPILTTLPLLKDHDHIGRRYLADPHSQFAEAVRTARTGVLLSAIDQPHKIVVVTSSLPGEGKTTFAANLALAHAQTKR
VLLIDADMRKPRLGRELGLDDDLVGLSSLASGEREAKDCMRSVPESTLQVITAGAVPPNPLELLLSQRFQETIAALSREF
DLVILDSPPVHLVSDAIILSTLATGVVFVMKANSTPYQVAQRCLRALQGAKATLFGVVLNQLDFKKAESHYGDYSGYGSY
GKDAAGYYMKESS
>gnl|bykdb|A0A1J5RCY3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=544 residues).
MQGQALVELHDYLTIVRKRWVSILVATALSLVVAIGVTLLATPTYQASAQVFVSVNSAGTTADLLQGSNYSQQQVASYTD
LVTSPRVLIPVIEKLALGVRPETLANSVTASSPPNSVLIDITVTDTVARRASDIANAIAGSLGTQVSELETPSSGAASPV
KVSTVRTATVPLAPATPKKTLNLALGLLVGLALGVGLAVLREVLDTKVRNEADVRRVTEASVLGSVHYDPDAPDHPLIVQ
SGPQSHRAESFRRLRTNLQFIDVAEQPKTIVVTSSLPGEGKTTTSINLAITLADAGARVVLVDADLRRPSVAEYMGLEGS
VGLTTVLIGRAAVLDVVQPWGNGQLHVLPSGQIPPNPSELLGSRAMVTLLDKLAQLYDLVLIDTPPLLPVTDAAILSRLT
GGALVVVGAGKLQRQQLAEAMGALETVGARVLGLVLNRLAKTPSDSYTYYDYSTETGSTVTKKRSRTAASTSETQRPPAH
TGSRRLVPRTGQIRAVSAAEVAPRGEIDDPMGDLFPPTGPQRTSAWPGERMSGGTTEDWSSHQV
>gnl|bykdb|A0A1J5RUE5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=539 residues).
MPVELDEYVLALRKRWLIIAALALVGAVTGWLYAHSMTPNYRATANVFVSVNGGGTAGELVQGSTFVQNSVESFAKLASM
PVVLDPVIEDLQLDTTAKALGRSISANNPLNTVILQISTTDSQPQRAADISNAVARQLAVTVQNLSPRTVAGQSSIELTV
VAPAVPPETPFEPNTRFLSVTGLALGLGAGVILALLLTIFDTRVRTAADIERVIHLPALATIVRARQSQQPATTVAHDPS
SRRAEGFRRLQANLQYLDVGKPLSSVVVTSAVPGEGKSTTALNLALAVAENGKSVLVIDADLRRPAIALDTGLEAAAGLT
TILIGRATLEDVVQPWGEHDGLHVLTSGEIPPNPSQLLDSPAMHRVLDEAVKTYDLVVVDCPPVLPVVDASVLGRHVDGV
LLVIGLRQVRRQQVRSALAAITAVGATPLGLVITNAVDDGAGAPYSYRRPDEIRPHRSQPWRRRRPDEIRQNGADADVDA
AVSSTAGPEDPRTPISPEPREARASAVQNANAAADAPDADVPAGGDGQNRKKNVASPTA
>gnl|bykdb|A0A1J5SM24 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=744 residues).
MESPEKQQTPSKSSNYGGYAGYGAPYGYGYGPSEGGAGQRTFQDYVLILRERAWYIVAVFLVVFSTALIITLSKTKIYES
SASVQIFRRDPVIMQTQAVMDNEVRSAEDLNTQVKILESEAIIQKVADRLTGNDLAMFKAPYEKDGALSHVPITTILRLN
RKVVPQRLSLVIDVQYDHPDPVVAAKVANLFVDEYIAYNARMRIDESMKAVEDLKVRAEQQRSKVNELALALQAYREKNN
LVSLDQRKDIVTEKLKALNLLLTQSASTLADAQVKWQQVQDCRRQGRSLIDLPFILNSSNDNSGPSLVSQLNQQVAQQEI
DIAKLRERYRDKHPIMVAALNSLAQTKAQLKLAIDAAAAAVQANYQTAQSDYQHAKAALAAQEQESLELDRYGVEYTNLE
RDYNINNQLLQQILERMRETSMTSTIETQNARIVDRGQVAKKPVSPNVPLNLGLGFVGGLGLGLAFAFFVAYIDDRVKSS
YDIESVIGLPLIGIIPEIKKMEQPDKAQIVMNNADRQVAESFLTLHSSLRLKDESKNAKVFLTTSTIPGEGKSFMTTNLA
LTFASHGERVLVVDCDLRKPNIHKSFRLENLKGVIDVVTGTAKLDDVIVKGVYPNLDVLTTGGRAKNPTQILNSKDFELM
ISDLKKRYDRVFVDSPPLAAVSDAMIILPLCDGSLFTIFFNKVRRKAAQFVAHKLTDSNVPNFGAVLNGLNLAVSGYYYA
QYYDKTYKDYYVVMAKQDPDTPER
>gnl|bykdb|A0A1J5SPZ5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=725 residues).
MSDVPQQTPPPKPPPPPAAAREEDEIVERRTLRDYYIILRERFWIAFPLALLVSLGVGYYQSRQTPMYMSTATMQFEKPD
RIVTTEGVTNPAVQSEIDINTNIEILKSDRLRERVIHSLTPEEVKILQRPYLKDLPPGASPPSAAAAMPNVDVSAVRNSL
LIRITTTDRDPEAAKIIADKYVDQFMQYLLENVGGKNEYAVDWLTSRAEQLRRESEAAALKLQNFMQAQGMVSLDDSTNL
ITARLQAVSNALTQNQLQLLQLQAQYSQIQQYIQSGQNLLEIQAIATHGEIPSLVSQLMSLKQQQQVLAERYLERYPKMI
DIANQISVAQSQLDKAIKLAVDEIKSQLAKTIDAEKRLEAEKAIQEKAFLHLGDVRTEYESLKNQSDVKRKNYMDILDRL
NQTQTTSNIDKIPLRPLDRAQIAGAPYTPNMGRIIKTCTGLGVLVFLGVAVGLSFIDDRIKSAWDVEHFIGANLLGIIPE
IGQIKDEDKYQLVLNNKPNPGQESFLSVYSSVKIQSKLDFPKSILVTSTIPGEGKTLVSCNLAGAFARHGRNTLLIDCDL
RRPMLHRHYKQANNNGLISWYENGADLESDLLGNPHLGIVKIGENLSLLCSGGRSKTPSELLESNTFAQLLERLKRRFDL
IVVDSPPLGAVTDSLLIAERIDEVIYVCRFNRAYRKHIKLYIKALRSGKNEILGIVLNGLSPRRIEYYSNYRYYRSYKKY
YGAQT
>gnl|bykdb|A0A1W1BK27 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=812 residues).
MQNIQIEEDEIDLSQLFSTLKKNFFTIVFITLFITSLVVVYSYFLPPIYSSDVKISFSNEEKSSMSSLIPNALADFTATT
EKKLETVKLTLETRKFINSVIKELDINQRYFIEHNYRKDELYAFDNLEVSLNIHDDNFKEKYDGTLYDKLFTIKPIDKKH
FLLSVDAMEYNRTCSYNKLVSNAYFSIKVIKKSYLEDTNYYISQSNPQLLADHILENMKTTILSDNVLQITYTDTVAKRA
KEIVQEIANQFREFTLVKKTSELKKRLIFINGQIGIIENQLQGEGKNLKEYQKKHKTFFTIETNNKMILEKLAEKKEMIE
TLKLQLKELNDFQKSFKKGNLNTVSLLNNGINISSIEPLIERFHAIDIELEDMRIQAKNIEKSLTKRPQLEQLIQRLHKE
KDTLEELNFNFTPTHPQVVKTNNTIIEIENDIRSYIQTDLNRLRKSKSSIKTKIIANINTTKKSIEHKLNIFKHDIQNEN
ALMQTLPEKSLTVQELKRKFTLSENIYTFLLQKKMETQMSLASVIENTQIIESAREGLKPIKPNKKLIVIVGFITSLILA
IFYVFLKSMLDTKIRNEANIKELTDAPLYGSLPNKKHKRFFEEAMRVIRTNLQFIIPKDKQCISILVSSTVPGEGKTTVI
ANLAHIIAQSNQKRVLIMDLDLRKPRLYQELNKSNKLGMTQYLTGDFELESCIQEVNEHLDFFPAGAIPPNPSELLMSEK
FDKTIKKLFLTYDYILFDTSPIGSIIDAKILLPYSDIVLLVVRANVAEKGFIEHFNNLRKETEIQSSGIILNDVKHDKSS
SYGYGYGYGYGV
>gnl|bykdb|A0A1W1CD04 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=824 residues).
MNEIEEDEIDLRELIDKLKNSLTTIVIITVLFMIGAGGYIYFSKPVYKSSVTISLDSEKKSKLGDMLQDPFSQAGLGKER
LKLAKVTLMSKKFIGTIIDKVDIAKEFFIQRNFRKVELKNFSNLKIDIKYNNNSLYGKFFKIVPYGNQRFLLIIKGINYK
KVHSYSEEIKTKFFTLRVIKVDGENPYKTIAMNENPIESFIASLGLEEESYYFRSFDRDTQENMIIKNMSVSDLSENILK
IEYSDNIPQQTKEIAEEIARSFIEYNLENKTAELEQTLEFLDKQLIEVKSDLKNKGEKLKKHQEKSGSAVMSSGEALLES
IDEKKDLIEKIILQLQEVKNFRASLQNGIMSSVALTSVGIDTSSIQSLIDSYTKSEETIRELRLQQNNITKSVTSNLLIA
ALINELKEKETLLRSLLTDFTEEHPQVIEQKKEVDNMRNKIHGNIVTNIQKLKKNRAIAKSTILNNMLMVQNNLTDKLRL
LKSDIRQKKSLLRSMPKENLVNASLKRNFALNEEIYTFLLQRKIEIEISKASTIANTRVVENAYVAKGAYKPKKTLIMAV
ATIVGFILAIFFVLMRDFFDTKIRTVRDIESLTDKPIYGSLPPLKNERFFKEALRSIRTNLQFVISKNGCTKILISSTVP
QEGKTTISAGLAKIISEADKKVLLVDLDLRKAKLHQELKQKNRMGMSNYLSGDIEIIDIIKPLPNNLDFISAGAKPPNPS
ELLMSEKFNKAINELEKHYDYIIFDTAPIGIVTDANMILKHTDIVLLIVKAGSAEKDFINNFNKMVKDKNIESSGIILNG
VKISKGKNYGYGYGYGYGYGYGEE
>gnl|bykdb|A0A1W1D4H7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=778 residues).
MNTMDNKYNDEFDDEIDLRELYKTLLKHKISIFLITFLFFIGSLIFAYYKPNIYSSNMSLEILKENKGGMESSIALNQML
LGSDQVNLENEKVVLQSRFIVQKALEKLDLDTKYYVINRFFKKIELYKDAPFDVKIISLDDMMYGKTFELIPIDSVSFRL
EIKPLSKYSIKGILATLNIISLDEKDKISYNQIHHYNELIKTPYFTIMVDKLKHIDGLKYNFSFIKQDKLYDFYKDNLSV
KNMLKSSSVLELTYQDTVSLRAKEILDAISTTYIATTVKQKTEANGLTLNFIDTQLKVISANLKNSEKNLENYKIHHSVV
DLKTKLEVKTQKIAEYEGEQLELQTEINILNNIKYYINKNKDLTALSIGTVKFTDNRISLLVTSLEALMNRREQLASKYT
QFHPDIVKIDKSIKIAKKAIKKAVQNSLDQLNQRSIDLGNMVVQLNKSLESLPTEEKKLAQLLRPLKVNQKIYEFLLQKR
AETAILKSATIANARILDSARENTTPVKPKRVLIVVVSVISGLIIGIFLAFLREFFTTTLQSLEELEHITSLPIYGVIPY
NKDESTENTYKEAFRNLRTNLQFLPESKNHKIISITSSISGEGKTTISTTLGEMLAKGDKKVILLDLDLRKSSFHTEFEV
KNDVGVSNYLIAQNKLSEIIQTTNIENLDIIPTGPLPPNPSELILSKAFTKMLEVLKKKYDYIIIDTPPAGLVTDAIIVM
NYSDLSLFLVRANYTKKEFIKNIDKLVKEYKENRVGIIFNGATINSQYGYYGYYNYYK
>gnl|bykdb|A0A1W1DYN8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=730 residues).
MDTLINTSSNLSTDSNEEIDLQELFGTLVEKKWLIAIITSIIFMASVFYVLIATPVYRADTVLQVEDKSNNMLNLSDLTN
FSASSPTSTEIEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNITKDNSRTGYAWGGERIQIEQFTLSRS
LQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELAQANGVTIFISELVARIGTEFSLSKDNRAEIVDDLKKIIKVTERGK
KTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVFLQKQTPLIKDEMEAAEVELNNYKGYKNSVNLTLE
TQSLLNRIIMIETQLAELEVKHSDLSKKYTDIHPIMITLTNQEVKLQEQLEKINAKAHGLPKTQQEILRLSRDVEVATTI
YTQLLNKTQELKVVKAGAVGNVRIIDTALTAQRPIKPKKLLIVLISTLLGLFLVIAWVLVRRAMNKGVEDSDLIERDIGI
PVYANVALSAKQKLLNKDIITNKIKHAILCEHDPQDSAIEGLRSLRTNLHFALLEAKNNIVMVTGPSPDIGKSFVSINFA
HTIAQAGQKVLLIDADMRKGHIHKEYNLSRSPGLSELITNQVDKKVAVHNSEFKNIDILTTGALPPNPSELLMHKNFGQY
LTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLHYGMHSMSEIRATINRLRQNNIETKGFIFNGIKAHGGYGKYA
HYHYEYKTQE
>gnl|bykdb|A0A1W1E4Z5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=730 residues).
MDTLINTSSNLSTDSNEEIDLQELFGTLVEKKWLIAIITSIIFMASVFYVLIATPVYRADTVLQVEDKSNNMLNLSDLTN
FSASSPTSTEIEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNITKDNSRTGYAWGGERIQIEQFTLSRS
LQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELAQANGVTIFISELVARIGTEFSLSKDNRAEIVDDLKKIIKVTEKGK
KTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVFLQKQTPLIKDEMEAAEVELNNYKGYKNSVNLTLE
TQSLLNRIIMIETQLAELEVKHSDLSKKYTDIHPIMITLTNQEVKLQEQLEKINAKAHGLPKTQQEILRLSRDVEVATTI
YTQLLNKTQELKVVKAGTVGNVRIIDTALTAQRPIKPKKLLIVLISTLLGLFLVIAWVLVRRAMNKGVEDSDLIERDIGI
PVYANVALSAKQKLLNKDIITNKIKHAILCEHDPQDSAIEGLRSLRTNLHFALLEAKNNIVMVTGPSPDIGKSFVSINFA
HTIAQAGQKVLLIDADMRKGHIHKEYNLSRSPGLSELITNQVDKKVAVHNSEFKNIDILTTGALPPNPSELLMHKNFGRY
LTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLHYGMHSMSEIRATINRLRQNNIETKGFIFNGIKAHGGYGKYA
HYHYEYKTQE
>gnl|bykdb|A0A2H9T6C5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][invertebrate metagenome] (length=736 residues).
MPNEMTQSRPTVADDDVISLSEILDILIKGKWWIAGATLFFAVCSLAYLWVATPVFQSDALVQVESQKSPVGALVDMSDM
LGSESPSEAEIEVIRSRFVLGEVVDDLTLDIVAKPDYFPIIGQAVARRFSPDAEANEPLNSPWLWFSGYAWGGEAVKIER
FETPDSQIGKTYTLVTGENNRYELYDEDDEKILVGKVGLSAVSRDNQVRLFVSELIARPQTRFNVIRQPMVTAINHLSKR
LSVSEKGKKTGVLSLSLSGPSSVHNSHILEAIIQRYVRQNVERVSAEAQNSLKFLEHQLPDMKKDVELAESKLHRFQQEN
QTVDLTMETQAVLDQAVDIDTQLAQLDMQIKQMGQRYTKSHPVMEELQLQRQLIVDRKNKFSDEARGLPKTQQEVMRLAR
DVQVNTEVYTELLNKAQELKIVKASAVGNVRILDHALSAIEAVKPKKSLIFVLAVLLGAMLGTGFVFLRTMLRQGVKTPE
EIESKTGLSVYATVPVSEQNRLLERNSHKNGDSCLLACSAPDDLAVESLRSLRTNLAFAMMEEKDSRIMITGSSPTVGKS
FVSANLALLLAESGKKVLLIDADMRKGRLHHYFAVHRGKGLSDILAGNADSSAIRGINEKCHLLTAGRIPPNPSELLMSQ
SFSAFLEKASDVYDVVLVDTPPILAVTDAAIIGRQCSQTFLVAWAEKNTASEISYAAKRLQQAKVNVKGCILNGMVHTSS
RYGQYGYYHYAYGDKA
>gnl|bykdb|A0A2H9TBF4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][invertebrate metagenome] (length=763 residues).
MQQSTDVSAQGTAASQDEDIIDLRSLFTTLFHYRWAILGFTLIVTLLTVLVVFSITPKYQATAVLLIEQEQAKVVSIEEV
YGIDGGGDSYLNTQHEVLKSRALVEKVVKKLNLIDHPEFNHALREEPWYVSMMNWRQWLGLALPQDTVSGETILNRTIDA
FAENVRIEPVRKTQVARIHVMSEDPQLAATAANAMGEAYIESWLEAKLSLTTNATRWMQDRLQDLSEKLKTAESQLHKFR
VSEDLVDIEGVLTISTDELKALTESLVETRRKLTLSENIYRQIQDGKNLQADQYQSLPAVLAHPLVQQLKQREAELEQKV
RELGRRYGPKHPKMIAANTELESISNNIRLQVQRIVLGVENEFEVARANEQSLVAAMTTAKQAVQTINSKQFRLKALERE
VRTNKDLYDAFFKRIQETSATSDLQSANARVVDRAFTPEHPVKPKKKLIVGIAALLSLLIACGMAYLLEMLNNTIRTAKD
VEDQLNLPVLGVLPEVDIKASSVPVSQLFINKDISKEQRAFVESVRTIRTGLNLSLMSVGQEAHKKIIAITSTMPGEGKS
SVAANLSSALGQLGSVVLVDGDLRRPTVGKNFSIKGGSAGLANLLSGHAQMNECLHPRNSIMVMPAGMMPPDPTQLFAEE
KFKNVLSQLSERFDTVIMDCPPMQGISDTLMISQLCDAVVYVVEAGRASKTAISHSTGRLLQNSVPLTGVVLNKVNTRRG
HEDGYYGYYDYHGYSDGHQDNKKHPDAQGKRIKTAEIEPESVV
>gnl|bykdb|A0A380TDI0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=752 residues).
MDQRLTTATQSEPAEPRRRPLAALDSELRETIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFENKTGPLF
DFQAAVAGAPQDEASILTEIEVIRSRKLADRVIKALQLDQDPEFNGKLRPPSAFATFFKDTLGLNLFPARAPNETDPTQL
TVEELRDKENNKIIDAVLEDVQAKQIPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWLAGRIQV
LREKVEASEREIEAYRKRHGLFEGRATSLVTEHVSDLSSKLTDATIERRAAEARLAQVRNLKNAENVDTAVQVLDSALIQ
RLREQELELERKEAELGQNLGARHPAMIQLQAERQRFREKLQAEIGKIVQRAENEVVVARGREAALQRDLASVKGDMVQS
NQASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPAAMPDKPSYPRKVFVVMIAFLGSILVGGLLA
LTLESLDAGFRSAEQIEAVTELPVMAHVPLLTAAKGGGDRPETFILKRPDSAYAEAIRSLRTRLLLAFGDRPPQVVVLTS
AEPDEGKSTLGLSLVRAQAQADRRTLLIDADFRRSRLTTRITGISAQPGLYEVLSGQATAEDAIQSDPTSLADLMVSGAS
SADRKVLGDAARLEGLLAKLRGRYDLIVIDAPPALALAEGQVIPMVADATLLVVRWGKTRKRVVRYTMDQLTRFGMPLHG
VVLNMVDVRKQAYYGYGDAGYYYGKRAKYYTS
>gnl|bykdb|A0A380TDN3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=752 residues).
MDQRLTTATQSEPAEPRRRPLAALDSELRETIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFENKTGPLF
DFQAAVAGAPQDEASILTEIEVIRSRKLADRVIKALQLDQDPEFNGKLRPPSTLATFFKDTLGLDLLLAKAPDETDPTQL
TVEELRDKENNKIIDAVLEDVQAKQIPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWLAGRIQV
LREKVEASEREIEAYRKRHGLFEGRATSLVTEHVSDLSSKLTDATIERRAAEARLAQVRNLKNAENVDTAVQVLDSALIQ
RLREQELELERKEAELGQNLGARHPAMIQLQAERQRFREKLQAEIGKIVQRAENEVVVARGREAALQRDLASVKGDMVQS
NQASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPAAMPDKPSYPRKVFVVMIAFLGSILVGGLLA
LTLESLDAGFRSAEQIESVTELPVMAHVPLLTAAKGGGDRPETFILKRPDSAYAEAIRSLRTRLLLAFGDRPPQVLVLTS
AEPDEGKSTLGLSLVRAQAQADRRTLLIDADFRRSRLTTRIPGISAQPGLYEVLSGQATAADAIQSDPASLADLMVSGSS
SADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATLLVVRWGKTRKRVVRYTMDQLTRFGMPLHG
VVLNMVDVRKQAYYGYGDAGYYYGKRAKYYTS
>gnl|bykdb|A0A380TGM5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=744 residues).
MQMDRPNLTPAYPSVWAAERSYDIRELTRIVRRRKSIVIGTVTLILALTVFFLSQLTPTYRAEALVIVESRKANIADLRE
ILTDVSANQETTRNEIEVIRSRTLARRVIEQLGLAERDEFTSSRSRSLLEIASKAAALGGKDDTNPGSADRQALEARAAR
AASLDEVVDEFLKHLDVRPTKASRVISVRFQSRDAQLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVA
RSEKAVEAFRTQSGLLRGSQVTLISEEISEINRRLAAASADRAQATATLNEVQALQKASNIEAAQAIMESPVVQQLRIQE
AAVLRELAELSIELGERHPRVINKKSELEKFRAKIEAEMERVLKGYATAVSVATAREDSLERELNKLKSKQALANSREIE
LRELEREAEANRKLLETFLTRLKETTPQLDTEMQVPGATVLSPAAVPLRSLPDKRIVLAVATIIALLLGLGLALMAERLD
YGFRHAEQVSEATGLPVIAHLPVARSGRDGPEAAMLDSQPSLFLEGIRSTYIQLALRSKRPAIRSLLVTSSMPKEGKTTL
AIGLTRARAIAGHRALLIDADLRRPSVHVRLKLAREPGLVDLLVGDASLEQVLQRDEPTGAFVIASGSAARDPSDLLGSK
AVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETVFVIQWGKTGREVVKLALEKLTETQGVPRGIVLSRVDTAKI
RLYGYGDAAYYDRTVREYYTRGSA
>gnl|bykdb|A0A381Y0U7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=733 residues).
MDKIPSTEQSLPSTEQSSDKLHILDYWRIIRVRFVVILLVFLITAVTTTVVTFLLPPTYMSLSRISVEKETSDIAPLLGM
QSGPTAFDPYFIQTEFEKIQSQKVLDKVVTKCNLTESLVLGKTLNEREARKILEKSIDVRQYRNTSIIELRAYDRKPTKA
QEIAQALASEYQDHRSSLHKVAVQKGIDSLKSRMGEMNTEISDMQSNVDKFRTDLGISDAAGEESYSIIEPEIVRRYEVE
LIAAKGVHTTQSSLLDGLKAQSAEELRASILTAHPDAQLDALTREFHTGQQTLANQSIDLGDQHPRIKGLKKVVATLEEQ
IDNRIKGILAGLELRVNSSMAQVEQLKRDVEDAKKRESDMREKGREYFNAKRELANTTRIRDTILLRVMQEEVDLELGSK
ESSVEIIDEADLPIKAVRPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERALGAAVLGVIPQNVGSLLEEGD
ESPHAEAYRVLRTNILFAGRKSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRILIVDSDLRRPSMHRYLKVSNNIG
LTNYLLGQVAIDEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDM
CVLVVQYRKYPQLMTQRAKGMVTKVGGELVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEESADETQDGEKEAKLVA
NADIGGEDEKPKY
>gnl|bykdb|A0A381Z3K5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=725 residues).
MDKTPSTDQSSDRLHIMDYWRIIRVRFVVILLVFLITAVTTTVVTFLIPPTYMSLSRISIEKDTSDIAPLLGMQSGPMAF
DPYFIQTEFEKIQSQKVLDKVVAKCSLTESLVLGEVLNDRAARKILEKSIDVRQYRNTSIIELRAYDRKQKKAQEIANAL
AEEYQSHRTDLHKERVTKGINALNKRMEEINEDITGMQSKVDRLRTDLGISDAAGDESYSLIEPEIVRRYQAELITAKGV
YTTQATLLAGLKDQSVDELRASIMTAHPDAQLDSLIREFLTGQQALANQSIDLGDQHPRIKGLKKVVAILEGQIDARIQG
VLAGLELRVKSSKAQVDQLQQDVSGAKTKESEMREKGREYFDAKRALANTTRIRDTILLRVMQEEVDLELPKESTVEIID
EADLPIKAVRPNIPLNISLGVVVGLVLGVGLAFFIEYLDTSVKTIDDVERALGAAVLGVIPQNVGSLLEEGDESPHAEAY
RVLRTNILFAGRKSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRILIVDSDLRRPSMHRYLKVSNNIGLTNYLLGQ
VAIDEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQYR
KYPQLMTQRAKGMVTKVGGELVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEESADETQDGEKEAKLVANADIGGED
EKPKY
>gnl|bykdb|A0A3B0V744 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=784 residues).
HDYPLNFGVKIMVQFNQNIGNNPPALEEENHDIDWIKLRLILRKGIPWFITIFVLLILVAALYLRYTKPMYQSNSEIKLD
QEDQSNVLGLPQYEQSSNMGLLSSEMEIIQSRLFFNKVVETVNLNPQYFTYGNILDDEKYLNPPFKVSYKILNASIYNIP
IDVIVINQKTFQLNYTVREKEYSLNARFEDSVKTELINLKIELNESWAIEDGSRFYFRINSREVLINYVESNLSVEPLNF
QANTFQISFTDHNLNKAHALVSAIDTLYYNYSLQEKTKANRNKIDYLDKQLEETEKKLDNFETYFEDFTIDNKTVDLNED
VRRTVDAINGLDSQRIKIDNKLSELELLQAKLSKTPYENLTPKVNVYPNYLNRAFDEFNLLKNDLQKLGLSYKENTYTFK
SRQKEVELMRADILAEVNDYKQDLQKQKSNLVTTKQQLRRQLISLPSKNTEYNKSKRFYSVYEEMYLSLMQSKNEFEIAI
AGSITKIKILSPASLSNTPIYPVPLFAYATAVILSIVLSFLFAGVMYLAHNKIQSLHEIEFLTTATTLGAVPKHNLNGKV
AKIIVDKHPKSAVSEALRSIRTNIEFMIPDKDSKVLSVTSTIGSEGKTFISTNLGALLAMAGKKTVIVDLDLRKPKIHLA
FEQKENANGVSSILIGKGKIEECIQNSTIQNLDFITAGAIPPNPSELILRKEFGEMIENLKLKYEVVILDTPPVGLVTDG
LLAMQKADLPLYVIKADFSKRSFVQNVNRVLATGQFNNLSIILNATTTSETGYGYGKKSAYYET
>gnl|bykdb|A0A3B0VME9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=775 residues).
MNNQTEPIDNAGEDRQTMVPAGDTHLPSTRVHEIMPPVEEEINLRDYLDVILRRRWVIILTLLVTFSLVAVFTFSSTPLF
LAQGTLKASPRVASITSFKGIAQGMDESFMQSKEFIATQVKLLKNEGLLIKLIKKMDLQDNILFVGKKDNDTGHGILGGV
KEAFASLKNMIRPRLDSDPANKMNRKVQENITLDNNLGKIKNSLTITPVRGTQLIKISFQSPHSGLAADIVNNLMKEFIQ
VNAEQKLAAFHSSGVFLDKQVNASKIKLEKSEQELNGYARRTGIISLNSKLNLVMGQLEAVNDALAQAVTARISKESLYL
QTKKNGGENMPQVLNNPLLQNLKKQYSDLRSQYEVLSTVFKDQYPKVKKLKAQMKDLRNRYAQEQQLILDSIRLAYEEAL
EKEKRLTTKAEAQKKLAIELNSRATQYKILRREVATNREVYSSLLSRSKEIEASAGSDNGNIMIVSMARPPLYPYKPKVA
RNLLLGIVLGSFAGVGLAFVLEYLDDTIKNPDEFPQRYHIPVLGLIPFKDAGKTDDEFDEIALTFYNEPKAPLSEAIRTA
MVAINLSTAATPPKTVLITSVLPDAGKSTLASNLSLSLLASSAKVLLIDTDLRKPGLHKIFGQKDNSIGLSSFLAGTADI
DEVIMKTEFPNLFFIPSGPIPPSPAELLASSTMRAFIAAAAREYDYLILDAPPFHGFAEILILSNMVDGVILTTQLNRTP
RDGVEYFRKAVTNVGGRILGTLVNKVPTGKTGSRYYGGYKYYKYYSYDYEYGRDA
>gnl|bykdb|A0A3B1AK25 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=737 residues).
MQENKAQQPLEEDEIDLREYWRVIMRHKSSIFGLAFLAAILSALVVFAMKPIYSSTVTLLIEPGSANVVSIEDVYGDSDT
STYYKTQHEILESRLLITKVIAKLNLQENPEFLPDESEPLISIDWRAWIKELLPDNTIPEEPGIDEYEAFNAELIKDFSA
RLSVAPVRKSQLVKISFEANNRKLAAQVANTLANTYIESDMEARLEMTSTASNWLTERLVTLKSNLQQSENELQAYREKE
ELLEAGGVSTLSTRQLQDLNEKLVLATQQRATAEISLKQIKSLAGESPDKLGAIPAVLNDDLVGSLKHSESDMQREVSAL
AKRYGPMHPEMIQAKANLAKATQNVNRRIRSVTNGVEKEYQIAMAAESSLKRSLQRAKGEMQNINRKGYKLGVLEREVES
NRQLYKLFLNRFKETKETSGLEQVRARIVDPAEPSIKPIKPKKQLIVLIATLISGFLGILLAFLFEHLDNTIKKASDLED
RLHLPVLGLLPKLDLKKHKTASPLSYAKGNKQSFFSESIRTIRTAMLLSGLDDPYKVILVTSSVPGEGKSAVATTLAESM
GELHKVLLIDADMRRPTIAKTWDFDPRSPGLSEFIAESAQLSECVYQIQDSNVHIMPSGTVPPNPLALLSSNRFTTALDH
LGKNFDHIIIDSAPCLAVSDALVLSRCASGVILVVKADATPYPVAQDAIKRLHQSNARIIGGVLNNVSKSKKGGYGNYGK
YSYYDGCYYGSYGYTND
>gnl|bykdb|A0A3B1C250 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=1032 residues).
MPGYNKDENSGGYVEPYQNSSDADGDEINLSEYWYTIKRNKWGILGLAFVATLIGVLTAFSMKPIYRASVTILIEPEQPK
FVSVIPMESGSNINYFYATQYKIIRSRSVAESVIDKLNLAEKEGFADLVSKKKTGFIEEYLPASWFPEKREATEEEKKRR
LIAYFSSNLRVVGYKNSQIAIINYEAYNPQLAADIANAVAAAYIETGMESRLMMAKQATSWLTEKLSLLRTKLEESEKTL
QRYQAREGVVDTKSQKSIINRKLVSITEELIKAQTRRAEAEIRYMEIKNVKNERGYESIRAVLRHPLIQKLKEEESRMAR
RVSELSKRYGKKHPKMIAAISDYKEARRTVRKEVKRVVDGIRRDFEAAVANEKELRRLSNTTEKDARRIKGKEFEMAKLE
REVSANRQLHDLFLTRFKETNMGENANVTNVRIIDRAEPPMRPHKPKKSRIVGLALFIGIFLGVILAFVQEHLDKTFRNT
DDVERFLTLPVLGSVPTVKKGGDDAFGPEWHSLANPRSPFAESVNHIRTSVMFSNIDNPPKIIMITSAMPSEGKSTLATN
MALAYSNLGKTLLIDADLRKHSLTEFLDSNSNGLGLTDLVSGQNTFQDCIRRLKLSKNLYILTSGATPPNPLEFLSSRRL
ANTFNQVKKAFDTIIIDTPPILLFSDAMVVGQLVDCCILSIRSDQTTHNMAQDAVKRLTSSQLKPLGVVLSYANTKGGKS
YGGYYGDYYGDYYGAEFDEDEDDFITKKSNKSRRGKRKGRSLATVGGIALALTIIAYFLWNPDKSLLSALPTLDIGIGST
AEEPKGEALSKPWSPQTGAKGDPSVKPEPAQKNSRTMKPNKPKAKPTAKKQPIAKFSTPRSGSAKPKPIPAILTLPAADG
KSLQGKRVEIVASSTTGDTRVTGGGFGSSTAAGDMSKWIGEGWEKMNTEGIEAACPVWEAGLRSSTAESVVLIVGRYSGL
TKAKVPLELLGEELPIFAVCAKYRGKNAYYVLAAPSPANLKKTQKIIRSRLNIKSVKGNYPQKLVRIIDRGR
>gnl|bykdb|A0A3B1C7A9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=747 residues).
MDNEFDNNIQEETHSIKDYFNLIRINIIPILLIGLTGLAVSVIYAFTARDIYTASTALKIQKPQAGGILSSPLLPEISDF
GNDRFIANEIEILKSRRLRDIIASALIDSFNTVNNPDSFYVLLDHSFDLEDNGVKLKSKYDLMEMLDKVKIEQKRGLDIV
EISVESPVPYEAQMIANCYAQSYEKLNLKYTRQQLSKVVAFLQKQRTKKYQELLVVEEKMKKFQVEGRIIALDDQAKALI
DILSTFEAQRDATSLELSQAEENIKQYKEEMNKQNSSISKYIENYATEPRMRALQEEIARLEMERDVAMSDTTMSATRKE
LLVNKNRTIRDLRKQLNEQLKIYKESIYAASPAELKELSLKLLTEEVRYKSLQATYQNLNKIIDNYESKFNELPNRTIGF
ARYQRELNAYEKLYLLIEEKYQEALISEQSTPGNVLIIDEAQRPVKPSKPNRKLIVVIGLILGFGFGVGFAFVRDYFDNT
VKTPEDIEKENINVLTWIPKIEGVETNKEFEFIIHEKSDSIYSEAFRVLRTRIQFSKLNNGGVKVIHITSSTPQEGKTTI
AINVAGSFAQTNKRTIIVDCDLRKPRVHTVFKEQRFPGFTDYFLGHTDLESVIHKSKLPNLDFITCGTIPPNPSEILGSQ
QMVDLLARLKTKYDLIVLDSPPIIAVTDSEILSRIADTTILVAASGETEIELLKKSAELLQHDSDSFIGVVLNKFTFKSG
YGSYYKYYYYYSNNKDAKKKKFFSKKT
>gnl|bykdb|A0A3B1CUQ0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=772 residues).
MSQLEHTDDVEEREIHLNDYIEVLLRKKWIVISCFVVIVLATGIGTYLATPIYEATTSILIDDSKGGGQALFTELAGLPQ
TSEIPSQIELIKSRTIAEEVVRKLKYDQRVFDISGDLDPRVTNLQIPQKFIDEEIKVEFTDSKGNFTVTKEGESLGRGIV
GTPFKSDSGLYFDLKEVNPYKGASFKIKRSRFYEAVEDLQKKVTVSPVRNTNIVYIKVQDSDPRMAAAIANSIVKRYIQH
DISKRSKEATYMIKFVKKQIEPTQKKLENALESLAAHKRNSRVVYLKEGTKKLIENIGALEQEKTNLDIKEQQVRYLYDE
VQKNITDTSTLNLSVLEDTVVQSMISSLAMLENNRKSLLSEYTARHPQVVALSAEINEIKKRINASILNTLDSLRTKKES
FSKEIGRLRAELKVLPEEEKTLAGLVLNKEVLSNINAFLFQKLNEATITQASTISSIQVVDPAIVPKKPIKPQKKRNILL
AVVVGLMSGVGFAFFFDYLDNSIKTPRDVEERLGLPVFGHIPLVQAEETKKPLSGGNSNSGLITINSTKSITAESFRSLR
TNLQFAVPEKRGRVFHFTSTMQGEGKTTITANLGVTLALMGSRTLIIDLDLRKPRIHHIFDINREPGITHLLAGKSDFKE
IIRPTATEHLYVIPAGIIPPNPSELLSQQDLRDFLDKTRKEFDYILIDSPPVLPVTDSLLLGRLADASFIIIKLGETSFP
AVEQAVKQLRSVDVNVAGAIINKIKPSAGYGYYHNYYHYYYGDESPEEKKNT
>gnl|bykdb|A0A3B1DSR1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=765 residues).
MNTQNNLSEFDQTGLTESSGFEIDLLSLASRHWKLLLLGLIVGLVLGELYYRKAGPEYDATARILVEKKVSVQLKDGDAK
IYGDRAEHIKLIMSPLIVNIAIENQNLDKLPSLLGEENPAGEILDTLVVKRTAGRDRSFSNVLDLSYRNRYKEDAKTILS
AIIEAYQEYLTRNQNKNQKKSLELITQANDELEVKLNKKKEEYQKFRDNAPLYWNAAPGVKGVGSSVTNVHRDRFLKLEE
KRREVVTRQAETKARIISLEEAVAARQSPKKLERMVRIFLSYQTGRGGQSAATQLNPDLVTLESRLVPLVLRERSLLREF
GKDHSDVIGIREQINALRDIYRQKGIDISESGITDEGIEEGAVKIDFVALYIQSLKQLLVELKQRKLTFDELIALESQES
KKLSRYLMEDQTHSDEIERLKTIWQIAVDQLNRTTLSKNHSGYSMEKMAPVRAELSFKRHLKFLGGGVVGGMLVLFGFIY
LRAFLDTTVHTVNDIRDNFNLPILGAIPEFAPIATKELKQIDSHKIAPELYYFHKPGSIEAESFRSVRTALYVIAASDKA
QVIQVTSPLSGDGKTTLIGNLAVAMANSGKSVLLIDADMRHRSVHLLFGLRHNIGVSDVLTGEIEFLNAVQKTGFKNLSA
LTAGEEPENPAELLASPTFKKMLSEAKSQFDFILIDTPPLLAVSDPCIVAPQTDGLLLILRLKKDSRADITRAAELLDTH
NIDVLGAIVNGVEISPDEQTYGNYYSSEQQEETKNNLAEAMVSQS
>gnl|bykdb|A0A644WNK5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=858 residues).
MSQQEELQNTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAVPQYESQVSVLVEPIQRSSSFESLL
DVSASTTKIATEVELITSRKNIEYALGTLDLSSYHNSDGIDYRSKEVLGNVKERIVVSTVKDTNIVRIAVTDANPAFARD
FANALAASYDSLLTGIAKNSKTAQREFIESQIPINDRELSKAGDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLEPLK
LQLKESEVFIDSYNASLKQAGIDGVLTLEQIKNDSVIISKLADLSAWKTELTMYESLSNPARNTATLAPSTTLDSSSRTY
VISSAISQVTKELLNRVAALTRKYANEANTQAIVQALTTEVGIQVLQKRGAVFVEELSQLPVLERRLSELQRDVQIYEAI
GLKLREMLEEVKLTEAAVTGNVTVVDAANLPLNPVSPNKLLIIAVAMLLGAAIGLLLTLGIETLDVSIQSEQQIQKIVGK
DVPILGWIPMMKVSDNDKYPTLSVYNDPLSFESERFKLVANMLYNKTDKKVFSITSCAMAEGKSTIIGNVALALAQMGSK
VLVIDGDLRLPSMERYFRLKHREIGLVDFVTKKTRLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGLSYLEN
LYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLYDLVSNLRTANAPLIGFVFNGVIPGTTSSYGYGYGRGY
GYGYSAYRYGYAQGQSGSRKKSKSHSRRRSTSWYRKRYKQDLRNRGKISSEQFDPILAFGEHAEYRTLEAWAQEHATTHS
TAFTEARTSVFADLPPSNVESKPASPQQKPKAVLPTVELDGLGAIEKDPDAVGKKQEE
>gnl|bykdb|A0A644ZI62 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][bioreactor metagenome] (length=485 residues).
MELTLLDYLSLLRKYWRSIAAITLVAISLAATYCLLVQPTYTSKASLFFSVNSANSASDLNAGSSYAESQVQSFAKVART
DIVLQPVIDKLGLATTPGQLAEQVTVTVPTKTATLDLAVVTNSPDSAAQLADAISEQLVTTTIDQLSPPSPDGTKSVTAT
IITSAELPVIPTTPNTMRNLALGAMLGLLMGAGLAIVRDMLNLSIHSERDIERVTEIPVIGVVPEDDDAVRNPLVLHADP
HSQRAEAYRSLRTNLQFLGLDRGKRSIVVTSSVPGEGKTTTAINTASTLAAAGERVLLIDADLRRPKVARYLSVEGGVGL
TTVLIGEAQLGDVVQPCGVNDLHVVAAGALPPNPAELLGLPQMQQLLAEASRRYDTVIIDAPPLLPVTDAAVLSRITDGT
LVVVGSSIARRPELAKALEALERVDTRILGLLLTRARGHDAGHYRYDYSYQPTTRGQGPVIEQISDAHEPPARAARRSDS
WAVVG
>gnl|bykdb|J9FGR8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][gut metagenome] (length=786 residues).
MTDQKKLAQNAANEFAWVTDLWGMFAPRWIWFLASVLLFMSGAVLYLMSTPAVYTRTASILIKDDSKSGSSSNAMSEFSD
LGIFKNNTNIQNELLTLKSPELIAEVVSRLQLNETYTVRQQLKRVDLYKHTPCLLIGAAQTDASFSCTLQPVSAEQCQLT
EWSVNGDETDETYTVAFGDSVATSFGTFILTKTPAFTEQWVGRSIRFAKTNPQACADVYAESLVAALSNKEASVITLTIN
NPSIAKAEDFLNTLIEVYNEKWVQDRNQIAISTSKFISDRLGVIERELGHVDENISNYKSEHLMPDVQAASNLYMSQTVE
YKKQLQELNNQLSTAQYIRRELTGKQLSQLLPANSGIASTTLAGQIEEYNKLVLDRNRLVANSSEKNPLVVDMTETLRAL
KNTLIQTVDNLIRSLNTEMASIRRQSEAATSQLASNPGQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
INAPRGSMAPTAPQRSKILLIAFVLGLALPAAVIYLMENMDNRVRGRKDLELLTVPLVGEIPFTGDKKKKKDASQHTILV
KEGSRDMLNEAFRVMRSNLDFMSGDTTQSQVFITTSFNPGSGKSFLTINMGMSFVLKGKKVMLIDGDMRHGSLSAYAGSP
KKGLSNYLSGQAATWQEVTVDHPHNPNLKLIPVGTVPPNPTELLENGKLARLVDALKAEFDYIFIDCPPVDIIADTQIIA
QVADRTLFVVRAGLLDRSMLPVLQGMYDDKRFQGMAMILNGTESSRGRYSYRYGYYYGHGNYYSQQ
>gnl|bykdb|S0DG33 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][termite gut metagenome] (length=778 residues).
MDDYPMNSLYPAASTERGQLSASGMLTLMRDHIWEIVVTTVVVLTLAVAYLLIATPIYSADVLIRVDPPEPNALGLALQD
QEALPPPAPAPVTEMAVMKSRSVLEPVIDKFRFDVSVTPHKVPILGDIAEKFATPGEPSAPWLGLKSFAWGGERVQIGTL
EVPIELEEEKLTLIALQDGAYELRGPADQLLVKGVVGTTAQDNGVSILVKELDARPGTKFEVIRWNALDAVKRFGDLVKV
GDKVKDSGLLQVEYADANPDKATAVANALGEQYLASAIASRQLNDTNTLAFINGELPRLLADLRKSEDALKHFRSTSQSM
QPTSEAQAYLQGGLDLDKQIAGLQLQRTQLLERYRPDSRWVQSVDTQLAQLKDAKAQFNGHFNGMPSSERESVDLLRAQK
VAETIYLGMVQKAEQLQVRRASTTGGAHIVDAAIRPHRPVKPRPELVLGGGLILGLISGVVLVFMRRYVMTGVTDPRYVE
RRMSVPVFGEILFSQQQVLLDRSFAARKSLPGLGGRSNLPFQRSAPDIDMRTGASAMSAAASYSGDNSRILAARFPHDTS
VEALRAVRTAVTRDLAHARNNILMVIGPTPSAGKSFVAANLAILHAEIGSRVVLIDADMRRGHLASLFDESNRGGLSEVL
SERMALRNALRTTGVDGLTFLSCGLRPENPAALLMKPRFKDVLERLAGQFDLVIIDTPPFLAVTDASIIANEAGASLLVL
RSGMQSEEEIADTVKKMERAEGRISGAVFNGIPLRRSTRNYGYETNYASDVGDLEATR
>gnl|bykdb|T0ZG59 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=676 residues).
IALILTLLATPIFRADTTLQINRDTVNVVQVQGFQPVESLNDQTFYQTQYDLLKSHSLARRVVVAMDLQHDAAFQGLLRP
SPLARLLGFLHGASARKPSQTDQLRADADALLHMVSVQPVLNSKLVDVSVDTPDPRLSAQIANVYADQFIRSNLDRRMAA
SGYAKQYLQDRLQQLKLRLEDSDKELVAFAQKHQIVNISDRQSLVGQQLEQLNVALAQAEQDRYKAEAKWRQLQGAPADQ
IAQVLGDPVIEKLQQAYAEDQAKYQDQLRIYKPAFPAMLQLHAKLDEIHRQIAARTALVSGAAQSAYGAAKARETLLRQR
VADLRQQVLNLEQRSIRYNILKREVDTNRQLYDAILQRYKEIGVAGGVGINNISVVDRAEPPMVRYRPRLKLNLTIGLLL
GLFAGIAAALVLDHLDDTVHIATDAEQKLGLAVLGIIPLARAGTPEQAMQDPRSALAEAYRSARTALQFATADGVPRSLL
ITSTRPGEGKSTTALALAQSFAQMGRRVLLVDADMRNPAQHNLGTVDNSRGLSNVLAGALTWREAVVGGENGPALLACGP
LPPNPAELLAGPRLATLLAEAQAEYDLVILDSPPVLGLADAPVLGHCAAGTLLVIEAGGARIDHIRDALKRLRAARARVV
GAAITKLDARHGAYGYGYNSYDYGDAYGGKTSRRNA
© 1998-2020Legal notice