BYKdb

Dataset for cluster cd of phylum all

[Download (right click)] [Edit] [Sequences] [Repertoires]

500 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      ------------------------------------------------------------
B7BDT8      ------------------------------------------------------------
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      --------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFG
A3K8W7      MNMMDSRKFRRKRKPLTTETPSPQEDASKDMAPVPPL----------ETREERLARRARE
G7EJX6      ------------------MLLSPEEQAAQQMLSLVAVFNAKL--SIEPVRSTQLVKISFE
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      ------------------------------------------------------------
B7BDT8      ------------------------------------------------------------
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      LTQ--------YAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTI
A3K8W7      EGEGQTRPDPDAARQARAREAARIAAAAARQKAEAESKAQADAQRRAEEQAHDEAEAEAQ
G7EJX6      SSD------------------PKLAALVANTVGEVYIESQMRAKMGITQQASNWLNTRLS
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      --------------------------------MTILDFVRTTRANLVLLILGIIIGALLG
B7BDT8      ------------------------------------------------NQIAVSTSAFIS
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
F4SM97      -------------------------------------MQESFSVTDQGKDTGILTLTLRG
G5Q4J0      -------------------------MSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTG
G5LQM6      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
G5SDT8      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
F3CAY9      NRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIED
A3K8W7      RQAEEQARAKAEAEAQRQAEEQAHAEAEAEAQRRAEEQARAEAEAEAQRQA---------
G7EJX6      QLRIQLDTSEQKLQAYREAQKLVDIEGIAGLVTQELEQMSQQLVVARNEKN---------
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      --------------------------------MSFFKKQSSVGKYGLSVETMAKG-----
I0UTA5      VGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAVAKIIQEKN
B7BDT8      DRLGVIEQELGNVDENISSYKSEHLLPDVQAAASMYMEQSSATNAQILALNTQLSMARYI
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
F4SM97      EDPKHLEQVLDSISDNYLAQNIARQAAQDAKSLEFLNAQLPKIRSDLDLAEDKLNQYRRQ
G5Q4J0      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5LQM6      EDRDKIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5SDT8      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
F3CAY9      QDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTS
A3K8W7      -EEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAE
G7EJX6      -NLQSINRVISEYGNNNLELLGSMPEITSHKVVQDVKREVILVERKVSELSEVYGPKHPK
B7B947      --------------------------------SSSKNPVVQDLNNSLIAMKQTI------
D3LB10      ---------------------------------MFSKKN---------------------
S9QRP1      ----------------------------MAERRKFQRRKRRLSEDVAPETPIAE------
G8AU96      ---------------------------------MNLRRGVGELKLRIRDEVGKI------
A3W0H7      --------------------------MKLKRHEEYMRRR---------------------
Q0FMP0      --------------------------MTMVERRKFRRRNRNPIDDGPEEPPIEP------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      PNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQA-----------------------
B7BDT8      RNYLTNSTSKNQLLPANSGIESPGIEQQIANYNTAQLRRNDLVANSSERNPLVIDMDQSL
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------M-----------------------
Q04DV8      ------------------------------------M-----------------------
F4SM97      KDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQL-----------------------
G5Q4J0      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKL-----------------------
G5LQM6      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKL-----------------------
G5SDT8      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKL-----------------------
F3CAY9      ARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERL-----------------------
A3K8W7      ------------AQRQAEEQARAKAEAEAQRQAEEQA-----------------------
G7EJX6      ------------IISAKAELATVKTNLNKQIKG---L-----------------------
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      -------QVLANSALHATAEYIKNIEGNNGGSGNAANSNGGNNATPNTENGNTAGASASA
B7BDT8      ENMRHAIITSIDNHITTLNTQIRSLQQSERQTTARIAANPTQGKYLLSVERQQKVKEALY
G9WIQ9      -----------MPSKRKA------------------------------------------
A0NKF6      -------FSKKNP-----------------------------------------------
Q04DV8      -------FSKKNP-----------------------------------------------
F4SM97      -------YTKEHPTYKALMEKRKTLQDEKSKLNQRVTAMPKTQQEILRLSRDVNSGQAVY
G5Q4J0      -------FTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVY
G5LQM6      -------FTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVY
G5SDT8      -------FTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVY
F3CAY9      -------YTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTY
A3K8W7      -------RAKAEAEAQRQAEEQARAEAE-AEAQRQAEEQARTDAETEGRRRKLAEARQAA
G7EJX6      -------ITGIEKELNRITRTVSALEADLAKIRAEYQNITRKETQYNQLKREVETNRSIF
B7B947      -------IRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELY
D3LB10      ------------------------------------------------------------
S9QRP1      -------PRPEDRIDPAEPRRPEQDLRADVEPAHRERA----QATMRRIADARRASEARL
G8AU96      -------QKGLDADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLY
A3W0H7      --------AARRAEMEAEAEEDAAVLHPNLDWPDDEDSVLATVPELLNLPEPEPEPEPEP
Q0FMP0      -------LESRDRRLERRRAEDKAALAEETAHAAEEAA------------RRSAEEQARQ
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      NTAVSGNAANNI-------RVIPLDNASIN-PPLVSPNYTRNTLIGAVAGLVLVYVVIFL
B7BDT8      LFLLQKREENELSQAFTAYNTRVITPPSGS-MIPTAPVKKNIALVAFALGLLIPVVIIFI
G9WIQ9      -----KKASAVDLRSSRYG-----------------------------------------
A0NKF6      -----QKLSAKVLRSSRYG-----------------------------------------
Q04DV8      -----QKLSANDLRSSRYG-----------------------------------------
F4SM97      MQLLNRQQELNIAKSSAIGNVRIIDNAVSQ-PKPVKPKKILVLAVGFVLGLIVSLSLVFS
G5Q4J0      MQLLNKQQELKITEASTVGDVRIVDPAITQ-PGVLKPKKALIILGSIILGLMLSIVGVLL
G5LQM6      MQLLNKQQELKITEASTVGDVRIVDPAITQ-PGVLKPKKALIILGSIILGLMLSIVGVLL
G5SDT8      MQLLNKQQELKITEASTVGDVRIVDPAITQ-PGVLKPKKALIILGSIILGLMLSIVGVLL
F3CAY9      TLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFV
A3K8W7      K--LRRAEEARRAAEADADDADDEDEDGTA-EQADTPVARPAPAMPTLALTPEQRSPAAD
G7EJX6      NTFLSRSKETEVTSDFTSAAARFTDRAYAP-NKPSKPNKKLIVVLAFVASFGFAIVMSFV
B7B947      LYLLNKREENELTQRMTESNARIIDPAAGS-NAPVAPKAMMILLASVVLGCAIPAGILWL
D3LB10      ------------------------------------------------------------
S9QRP1      KAQQAHEAEKARAAEAAKAAEEDAARAAEA-AREAEAERKADAARTAAAEQAAEVARQKN
G8AU96      RSLAERYEQTMALKNTGALDAHLSAPALPP-IRPAFPQLRMSLGVGLVGSTALAVALVLL
A3W0H7      EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP-EPEPEPEPEP-------------------
Q0FMP0      RAAEEARLQEQREAEAREEARRQTTAKREE-IRKRLRVHDG-------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ----------------------------------------------------------MN
I5ASF8      ----------------------------------------------------------MM
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ----------------------------------------------------------MK
F9UQ54      ----------------------------------------------------------MK
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      -----------------------------------------------------------M
Q4A120      ----------------------------------------------------------MA
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ----------------------------------------------------------ML
C6CSC8      ------------------------------------------------------------
D6Y034      ----------------------------------------------------------MA
Q8EME8      ----------------------------------------------------------MA
F3Y922      ----------------------------------------------------------MS
G4L594      ----------------------------------------------------------MK
C9B454      ----------------------------------------------------------MA
Q3XYS6      ----------------------------------------------------------MA
C9ALZ9      ----------------------------------------------------------MA
C9BUG7      ----------------------------------------------------------MA
D4RJF4      ----------------------------------------------------------MA
C8ZXT9      ----------------------------------------------------------MA
C9A6V5      ------------------------------------------------------------
C9CHY8      ----------------------------------------------------------MP
Q814Z0      ----------------------------------------------------------MA
B9IRQ6      ----------------------------------------------------------MA
A0RL70      ----------------------------------------------------------MA
Q6HB09      ----------------------------------------------------------MA
B7HFH1      ----------------------------------------------------------MV
B7IQS8      ----------------------------------------------------------MA
B3ZRD6      ----------------------------------------------------------MA
B5UQ73      ----------------------------------------------------------MA
G9QCG3      ----------------------------------------------------------MA
Q3EV64      ----------------------------------------------------------MA
B7HXB4      ----------------------------------------------------------MA
Q72XH8      ----------------------------------------------------------MA
Q5WBB4      ----------------------------------------------------------MA
B1YMM5      ------------------------------------------------------------
D7WMM8      ----------------------------------------------------------MF
A7Z921      ----------------------------------------------------------MG
I2CAF2      ----------------------------------------------------------MG
A7Z9K0      ----------------------------------------------------------ML
I2CB16      ----------------------------------------------------------ML
I2HW53      ----------------------------------------------------------ML
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ----------------------------------------------------------ML
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      --------------MAVVAALLLGVLAAGAYLMLRQRFVGTVSDPGEIEWTTGLPVIATV
F2I4B7      ------------------------------------------------------------
Q74BQ8      -------MSRIEQALEKAAMLRG----------TTDRGQAVAPRQMEDLQPLERAELPPL
F0JCB8      -------MSRIEDALKKASEKRDENRRREPETVPSVEPVAAPVMEAASPVDASLDFSPLQ
Q314L3      -------MSRIEQALARARKDKEHNAEDTPPR-PAGGGGAPSGVPHTPAEDSGGPAGPLP
B5EA81      -------MSRIEEAMEKAARMRN-GMEPPPPE-SVREPAGASALPPQTPQPVGSPALPPQ
C6DZX5      -------MSRIEEAMEKAARMRQ-GMEPPPPG-AAPQSAGNSALPPQTPQPVVSPALPPQ
A1ARV8      -------MSRIEKAMERAAQVRN--------------SAGVMRQPQETAARSGMVHTAPL
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ---------------------------------------------------------MVV
F0SX22      ---------------------------------------------------------MRG
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      -----------------------------------------------------------M
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------MSSVAIQSRRSSRLKSLYLCLSLP
C1J9I3      -----------------------------------------------------MMQLSFS
B1MZT1      -----------------------------------------------------MAFFKKN
Q03W95      -----------------------------------------------------MSFFNKG
B1R3V1      ------------------------------------------------------------
I5B296      ----------------MGKIFKALEKAGNKVTAEKESELRDDTALVCDNPDSQVYKQSDE
D4YF13      -------------------------------------------------------MFNFK
E6U7N4      ------------------------------------------------------------
C0QCJ2      ----------------MGKIFKALEKSKEIDMGDSAVVENDSREDDLQDDTAGEENSRGD
F2I6Z7      -----------------------------------------------------MFNFKQR
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ----------------MSRIESILEKAAKMRQDKTPG----------ESRVLVEQREVPR
B9M2X6      ----------------MSRIEEALEKAAKMRGTDGKAAL--------GKVPGSPLAVAHG
A5G424      ----------------MSRIEEALEKAARLRSS--------------ERSNVTVGKTVAT
E8WSZ5      ----------------MSRIEMAMEKAARLRENGGQTPAQDQAQARPDTATAAAAPRARE
C7LPS3      --------------------MSRIEEALAKAA---------------GMQSGLHSKGNRA
C3WFM9      ------------------------------------------------------------
D4YHG7      -------------------------------------------------------MFKNK
A4J8V0      ------------------------------------------------------------
A8U9F4      -------------------------------------------------------MFNKK
F4BSD9      -------------------------------------------------------MFNKK
F7V792      ------------------------------------------------------MEYRNQ
F6IR93      -----------------------------------------------------MGLKRLK
G0M0F9      -----------------------------------------------------MGLKRLK
F6ITB4      -------------------------------------------------------MFKRK
G0M1X9      -------------------------------------------------------MFKRK
G0LYN9      -------------------------------------------------------MFKRK
D7VC13      -------------------------------------------------------MFKRK
F9UMZ6      -------------------------------------------------------MFKRK
G7QCG1      ----------------MSRIEEALGKAAERQA---------------GMPRPEARLFFRQ
I2Q341      ----------------MSRIEEALGKAAERQA---------------GMPRPEARLFFRQ
H8YYB9      ----------------MERIKQALERARAERA---------------AAQLADVPVLSTQ
I5AV01      ------------------------------------------------------------
B0GAL3      ---------------------------MMQEN---------------EKQARTTYTNAQA
G1WUK2      -----------------MDQERRSQREMMQEN---------------EKQAKTTYTNAQA
E0RZL3      ------------------------------------------------------------
F0K0J7      -----------------------------------------------------MAFGRKK
Q1G8E4      -----------------------------------------------------MAFGRKK
D6S4X4      -----------------------------------------------------MALFRKK
D0DJH0      -----------------------------------------------------MALFRKK
C7XKF3      -----------------------------------------------------MALFRKK
E3R264      -----------------------------------------------------MALFRKK
D5GZJ8      -----------------------------------------------------MSLFRKK
C2EPK5      -----------------------------------------------------MSLFRRK
A4ZGZ8      -----------------------------------------------------MSLFKKK
A8YX89      -----------------------------------------------------MSLFKKK
F0NWJ7      -----------------------------------------------------MSLFKKK
E4SMV5      -----------------------------------------------------MPLFKKK
F0TGY2      -----------------------------------------------------MPLFKKK
Q5FIC7      -----------------------------------------------------MPLFKKK
F2M2M6      -----------------------------------------------------MPLFKKK
G7M0Q3      ------------------------------------------------------------
G7M1R9      -----------------------------------------------------------M
A6M2L9      ---------------------------------------------------------MKR
G7M566      ---------------------------------------------------MSVLEAIKH
E0NHP4      -------------------------------------------------------MFFKK
H1LCW3      -----------------------------------------------------MNIFHRK
C2JZS1      -----------------------------------------------------MTLKFKK
Q58Z10      -----------------------------------------------------MNFSLEK
G2KUP1      ---------------------------------------------------MIMSLFRKN
G8PE06      -----------------------------------------------------MSIFNRK
Q03GL8      -------------------------------------------------------MFKKK
E9SAU1      -----------------------------------------------------MASIKKN
Q38VG5      -----------------------------------------------------MGLFRKE
F0HVF1      -----------------------------------------------------MALFGRK
G6F8G9      ------------------------------------------------------------
C2EWM3      -----------------------------------------------------MSLFKKK
F8DRU2      -----------------------------------------------------MSLFHRT
B3XL23      -----------------------------------------------------MSLFHRT
F8KGP1      -----------------------------------------------------MSLFHRT
H4GK03      -----------------------------------------------------MGLFSRK
B2GF33      -----------------------------------------------------MGLFKHR
C0WW26      -----------------------------------------------------MGLFKHH
D0DSJ4      -----------------------------------------------------MGLFKHR
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      --------------------------------------------------MVCTVQEKKQ
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      RRSVDQRIRTRDDAVKATG-----------------------------------------
B7BDT8      RENMNSKVR-GRKDLESLS-----------------------------------------
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
F4SM97      RIFLRRGIE-SPEQLEEIG-----------------------------------------
G5Q4J0      RSLFNRGIE-SPQVLEEHG-----------------------------------------
G5LQM6      RSLFNRGIE-SPQALEEHG-----------------------------------------
G5SDT8      RSLFNRGIE-SPQALEEHG-----------------------------------------
F3CAY9      RQAFYRGIE-SAEVIESLG-----------------------------------------
A3K8W7      QTPLPQSTRLQTDTAWR-------------------------------------------
G7EJX6      FDALNDTAKTKNDVEGKLA-----------------------------------------
B7B947      LMVSDTKVRSRKDVEGVLS-----------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      AAREAEAAQEAARAAEQADQEAAVAHDPEPDADGAAPAAPTQAEAPVAKNSARGTTTADP
G8AU96      LERLSSGLRTPTQV-------------ERATGVPCLGMVPSLPRNEAT------------
A3W0H7      -EPEPEPEPEPEPE-------------PEPVVASDVAPEPTPAPPPLL------------
Q0FMP0      -DKVTAPATASAPV-------------EAETAPAQAPRSPARKPTP-L------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ----------------------------------------MVNYSRYTNDPAL-EAYRLL
C2CI44      ----------------------------------------MSKKNSYYSASMYDEAIRSV
C7RGH6      ----------------------------------------MTSRNNYYSASMYDEAIRSV
C0CK73      -MQAK-----------------------------------IVLPNEELEYGAA-EAIKTL
Q1WTC8      MQKFE-----------------------------------LRLDDIDFQSQ---ESFKTL
E8JWI5      MPILE-----------------------------------LAKKKKISISRVE-EYYNAL
F3AHH0      MINVE-----------------------------------IKVPKLGY--NSA-ESYKSL
F7K0U1      MREIV-----------------------------------LNGLEKDF--RSN-EAYKNL
C4Z672      MQEFS-----------------------------------VKKSYLDF--RTR-EAYKML
P0C0T9      MTRLE-----------------------------------IVDSKLRQAKKTE-EYFNAI
Q04663      MTRLE-----------------------------------IVDSKLRQAKKTE-EYFNAI
Q67AY4      MTRLE-----------------------------------IVDSKLRQAKKTE-EYFNAI
Q3K0T0      MTRLE-----------------------------------IVDSKLRQAKKTE-EYFNAI
C5NWJ8      MAQIN-----------------------------------LLTNQKIVDPKNE-EYYNAL
F3A499      MAQIN-----------------------------------LLTNQKIVDPKND-EYYNAI
Q4JZ55      MGKLE-----------------------------------LTRKYYQLYNETK-EYFNAL
G5JTD5      MGYLE-----------------------------------LSSKQEKTIDKAE-EYYNSI
G3G7C1      MATLE-----------------------------------IARTKKELVNKTE-EYFNAI
G3G7J9      MATLE-----------------------------------IARTKKELVNKTE-EYFNAI
G3G7G6      MATLE-----------------------------------IARTKREIVNKTE-EYFNAI
G8DUB0      MATLE-----------------------------------IARTKKELVNKTE-EYLNAI
G3G7I8      MATLE-----------------------------------IARTKREIVNKTE-EYFNAI
G3G7J4      MATLE-----------------------------------IARTKREIVNKTE-EYFNAI
G7SG34      MATLE-----------------------------------IARTKKELVNKTE-EYFNAI
G8DTZ0      MATLE-----------------------------------IARTKKELVNKTE-EYFNAI
G8DU07      MATLE-----------------------------------IARTKKELVNKTE-EYFNAI
A4VTU3      MAMLE-----------------------------------IARTKREGVNKTE-EYFNAI
G8DU31      MAMLE-----------------------------------IARTKREIVNKTE-EYFNAI
D5AGQ5      MAMLE-----------------------------------IARTKREGVNKTE-EYFNAI
Q9X4U7      MAMLE-----------------------------------IARTKREGVNKTE-EYFNAI
A3CQY2      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
E8KLY9      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F0FHA8      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F0I4H5      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F0IAY3      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F0IJI2      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F0IS53      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F2C9N0      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F2CH53      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F3SM32      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F3UDW7      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F3UNJ4      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
F0FQQ5      MATLE-----------------------------------LVRKKRNLVKLTE-EYYNAL
D6R2T8      MAVLE-----------------------------------LVRKRRDLVKLTE-EYYNAL
F3UUQ2      MAVLE-----------------------------------LVRKRRDLVKLTE-EYYNAL
E6IZC2      MPSLE-----------------------------------LAKNKEKTIKKTE-EYYNAL
G6A745      MPRLE-----------------------------------LAKNKEKALKKSE-EYYNAL
A8AZR3      MPILE-----------------------------------LSNNKKQSIQKTE-EYYNAL
F9HJP6      MPVLE-----------------------------------LSTKKKNSIQRTE-EYYNAL
Q4JYT9      MPTLA-----------------------------------IEQKRLDFAKKAE-ENYNAL
Q4JZY1      MPTLA-----------------------------------IEQKRLDFAKKAE-ENYNAL
E1LQJ7      MPTLE-----------------------------------IAQKHLNFAKKAE-EHYNAL
F9HC65      MPTLE-----------------------------------ISKKRLDFAKKAE-EHYNAL
E1LPE7      MAKLE-----------------------------------LSQQKLNSVKKAE-EYYNAL
F9MJW5      MAKLE-----------------------------------LSQQKLNSVKKAE-EYYNAL
E8KDN2      MAKLE-----------------------------------LSVKRQAFVKKAE-EYYNAL
E8K322      MAKLE-----------------------------------LSEQRLHSVKKAE-EYYNAL
F9PEU4      MAKLE-----------------------------------LSEQRLHSVKKAE-EYYNAL
F9PZP7      MAKLE-----------------------------------LSQQRLNSVKKAE-EYYNAL
C1CBD1      MPTLE-----------------------------------IVQKKLEFIKKTE-EYYNAL
Q7WVX0      MPTLE-----------------------------------IVQKKLEFIKKTE-EYYNAL
P96475      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNTL
Q9AHD2      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K2Q7      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K0T5      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K0E1      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q9AH95      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K1M4      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4JZ18      MPTLE-----------------------------------IAQKKLEFIKKAE-EHYNAL
Q54520      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4JYH5      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K0V2      MPTLE-----------------------------------IAQKKLEFVKKAE-EYYNAL
A5M4L1      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
B2ILP5      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
C1CCB9      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K1S7      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
P72512      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4JZ84      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K0X5      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K0Z6      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K195      MPTLE-----------------------------------IAQKKLEFIKKAE-EHYNAL
Q4K0A0      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K0K2      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K1F9      MPTLE-----------------------------------IAQKKLEFIKKAE-EYYNAL
Q4K045      MPTLE-----------------------------------ISQAKLDFVKKVE-ENYNAL
G6C7Z1      MPTLE-----------------------------------ISQAKLDLVKKAE-EYYNAL
D2ERX8      MPTLE-----------------------------------ISQAKLDLVKKAE-EYYNAL
F9LZC4      MPTLE-----------------------------------ISQAKLDLVKKAE-EYYNAL
F9P1W8      MPTLE-----------------------------------ISQAKLDLVKKAE-EYYNAL
I0J9C9      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
A6YIA8      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
Q4K005      MPTLE-----------------------------------ISQAKLDFVKKAE-ENYNAL
Q4JZL7      MPTLE-----------------------------------ISHAKLDSVKKAE-EYYNAL
E5F5C5      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
Q4JZG7      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
Q4JZK1      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
A5LJS0      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
Q9AHB7      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
Q4K1B7      MPTLE-----------------------------------ISQAKLDSVKKAE-EYYNAL
Q4JYK8      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
Q4K0M3      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
Q9AHA4      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNSL
Q9X9A1      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNSL
Q9ZII6      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNSL
Q8KWQ0      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
Q4JZW7      MPTLE-----------------------------------ISQAKLDFVKKAE-ENYNAL
Q4JYX9      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
Q4K0R7      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
Q4K1K6      MPTLE-----------------------------------ISQAKLDFVKKAE-EYYNAL
Q4JZS3      MPTLE-----------------------------------ISQAKLDFVKKAE-ENYNAL
Q4K0I2      MPTLE-----------------------------------ISQAKLELAKKTE-EYYNAL
Q4K254      MPTLE-----------------------------------ISQAKLEPVKKAE-EYYNAL
Q4K237      MPTLE-----------------------------------ISQVKLELAKKAE-EYYNAL
B1I967      MPTLE-----------------------------------ISQAKLELVKKAE-EYYNAL
G6J8A4      MPTLE-----------------------------------ISQAKLELVKKAE-EYYNAL
Q9ZFT8      MPTLE-----------------------------------ISQAKLELVKKAE-EYYNAL
D6ZQI8      MPTLE-----------------------------------ISQAKLELVKKAE-EYYNAL
Q4K2A8      MPTLE-----------------------------------ISQVKLELAKKAE-EYYNAL
Q8VU31      MPTLE-----------------------------------ISQVKLELAKKAE-EYYNAL
Q4K2E1      MPTLK-----------------------------------ITQKKLEIVKKAE-EYYNAL
Q4K2F7      MPTLE-----------------------------------ITQKKLEIVKKAE-EYYNAL
A5YTV7      MPTLE-----------------------------------ISQKKLDLARKAE-EYYNAL
F9Q345      -----------------------------------------------MARKAE-EYYNAL
Q6L5R0      MPTLE-----------------------------------IAQKKLDLARKAE-EYYNAL
A5YTT9      MPTLE-----------------------------------IAHKKLDQARKAE-EYYNAL
E6KKS0      MPTLE-----------------------------------IAHKKLDQARKAE-EYYNAL
F2QF90      MPTLE-----------------------------------IAHKKLDQARKAE-EYYNAL
E0Q2S8      MPTLE-----------------------------------IVQKKLDLARKAE-EYYNAL
A1ILY1      MPTLE-----------------------------------IAQKKLDLARKAE-EYYNAL
Q6L5T0      MPTLE-----------------------------------IAQKKLDLARKAE-EYYNAL
E9FEC5      MPTLE-----------------------------------IVQKKLDLARKAE-EYYNAL
E0PPH9      MPTLE-----------------------------------IVQKKLDLARKAE-EYYNAL
F5VSG9      MPTLE-----------------------------------IVQKKLDLARKAE-EYYNAL
E3CBS0      MNTLE-----------------------------------ISKNKLQEIHKAE-EYFNAL
F9M366      MNTLE-----------------------------------ISKNKLQEIHKAE-EYFNAL
E8K786      MNTLE-----------------------------------ISKNKLQEVRKAE-EYFNAL
F8DFF4      MNTLE-----------------------------------ISKNKLQEIHKAE-EYFNAL
I1ZPH7      MNTLE-----------------------------------ISKNKLQEIHKAE-EYFNAL
E7S8W3      MATLE-----------------------------------IVKSKLAAMTQAE-EYFNAL
D0RXH2      MATLE-----------------------------------IIKNKLAEMHQAE-EYFNAL
Q83YR5      MATLE-----------------------------------IIKNKLAEMHQAE-EYFNAL
Q8GP54      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
F8HDC3      MPLLK-----------------------------------LVKSKADFAKKTE-EYYNAI
F8LJ75      MPLLK-----------------------------------LVKSKADFAKKTE-EYYNAI
E9DM17      MPLLK-----------------------------------LVNSKVNFAKQTE-EYYNAI
I0QIK6      MPLLK-----------------------------------LVKSKVNFAKQTE-EYYNAI
E8KUY8      MPLLK-----------------------------------LVKSKVQFAKQTE-EYYNAI
Q7X553      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNTI
Q8GP92      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
Q7X561      MPLLK-----------------------------------LVKSKVNFAKQTE-EYYNAI
Q7X549      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
G6ERT1      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNTI
O87931      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNTI
Q8GPF6      MPLLK-----------------------------------LVKSKVNFAKQTE-ENYNAI
Q7X555      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
Q7X557      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
Q7X563      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
Q8GMA5      MPLLK-----------------------------------LVKSKVNFAKQTE-EYYNAI
Q8GPA8      MPLLK-----------------------------------LVKSKVNFAKQTE-EYYNAI
Q55205      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
C2LSE6      MPLLK-----------------------------------LVKSKVNFAKQTE-EYYNAI
Q7X559      MPLLK-----------------------------------LVKSKVNFFKQTE-EYYNAI
F8LXJ4      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
Q1WCR1      MPLLK-----------------------------------LVKSKVDFAKKTE-EYYNAI
Q8GPC3      MPLLK-----------------------------------LVKSKVNFFKQTE-EYYNAI
E8JMT9      MPQLE-----------------------------------LVRAKAQMVKSME-EYYNSI
F5X0J9      MPQLE-----------------------------------LVRAKAQMIKSME-EYYNSI
H2A602      MPQLE-----------------------------------LVRAKAQMVKSME-EYYNSI
E0PD83      MPQLE-----------------------------------LVRSKAQMVKSME-EYYNSI
F5X652      MPQLE-----------------------------------LVRAKAQMVKSME-EYYNSI
G5KD11      MSHLE-----------------------------------LVRSKQELYNTAE-EYYNTI
B9DUJ4      MAQLE-----------------------------------LVRSKQELYTRAE-EYYNSI
G5KAJ2      MAQLD-----------------------------------LIRSKRDLFLAAE-EYYNSI
F1Z124      MARLE-----------------------------------LVKSKKELYDIAE-EYYNSI
Q2KM74      MSQLN-----------------------------------LVRSKREHYQHAE-EYYNSI
C6LDI8      ---MQ-----------------------------------IAFEKLRTMDSVSREAYKAL
D4J4T6      --MNS-----------------------------------INLTRIDDGEAVS-EYYKQL
D4LTH2      MDE-------------------------------------LKLVFPDLPYAVE-EAMNRL
D4LG06      MNK-------------------------------------LKVVFPDLPYAVE-EAMNRL
A7VF42      MKK-------------------------------------LSIDFNEMPYAIE-EAMNRL
A8SQS8      MKK-------------------------------------LNVEFQELPYAVE-EAMNRL
D5HFS4      MKK-------------------------------------LNIEFQELPYAVE-EAMNRL
C9LAS1      MEQKV-----------------------------------VLTDIRKKDYFYE-EAIKTL
F3AH92      TELKV-----------------------------------VMKDPKRSDYFYE-EALKTL
I5ASF8      LTNYV-----------------------------------KLIDSEEGDCFYR-EEIKKL
E7GL81      MGKEI-----------------------------------SLMRDQKEDYQYE-EAIKTL
G5F9E2      MGKEI-----------------------------------SLMRDQKEDYQYE-EAIKTL
E7GL57      MDNEV-----------------------------------FLKRTAIEDYQYN-EAMKTL
G5F9A9      MDNEV-----------------------------------FLKRTAIEDYQYN-EAMKTL
E7GL40      MHDEIVIEDLISPDERGMGEL-------------------VLKGFEVNDYQYE-EAMKTL
G5F9H2      MHDEIVIEDLISPDERGMGEL-------------------VLKGFEVNDYQYE-EAMKTL
A8RK85      MDEIL-----------------------------------HLKNTGRKDYFYE-EAIKTL
G5HTB2      MDQIL-----------------------------------NLKNTGEKNYHFE-ESIKTL
G5HNC5      MGQTL-----------------------------------SLKNTGRKDYHYE-EAVKTL
C0CZV9      MRQTV-----------------------------------ALNRSMKDDYHYN-EAVKTL
A8RSK9      MSQFV-----------------------------------TLNRIMKDDYHYN-EAIKTL
C5EN03      MKQII-----------------------------------TLNREMKDDYHYN-EAIKTL
G5HG45      MKQII-----------------------------------TLNRDMKDDYHYN-EAIKTL
D9ST44      --------------MNNNRLI-------------------TVEHPNSQIS----EAYRTL
G2Z8Q3      ------------MPKERSKLL-------------------IKHQKGSKTA----EQFRMI
C8W5K2      --------------MFSNKLI-------------------TINNPKSPIA----EAYRIL
A5V0I3      --------MNHTNGYADSPLI-------------------ALRDPRSPAA----EAYRTL
F5LM71      ----------MSPSNKQRPII-------------------AHSNPMSPIS----ETYRTL
D7VBW4      LRRRVAN------MHTGIQLT-------------------TLTAPMSVVT----EQVKTI
F9UQ54      LRRRVAN------MHTGIQLT-------------------TLTAPMSVVT----EQVKTI
H6LKR8      --------------MNLASLI-------------------TLNDPTSHVT----ESYKLL
E0I7B5      ----------MSRQNSQANLI-------------------TISNPKSPIS----EAYRTL
D7UYE4      KKKETGM-------RRGLSLI-------------------AHNKPKSIVS----EKFRGI
Q4A120      KKIDTEI-------T---TLI-------------------THKKPKAVVS----EKFRGI
D9SVC7      ---------------MFKSLI-------------------TYRDPDSITS----EIYRTL
C8VYQ6      --------------MAVEKLI-------------------TLHSPKSPIA----EAYRIL
D9S1J9      ------------MEEMDAQLF-------------------VMDDPKSVVS----EAFRVL
C0GGR5      MKKKKRKTNTHATDNYLDKLI-------------------TSKNAKSPVS----EAFRTI
B1HR41      FKRKTKK------IPMARKLV-------------------TVSDMMSIPS----EQYRTI
C6CSC8      ----------MSQSENKRRLI-------------------SVANPRSPVS----ETYRTL
D6Y034      FRNPFAKKVEDHLTEKQRSLI-------------------THFSPKSPIS----EQFRAI
Q8EME8      RKKLSNV------NNKMRHLI-------------------TKINPRSPIS----EQYRTI
F3Y922      EKNSLKK-----QRTKPISLI-------------------TMSDPASPIS----EQYKTI
G4L594      RKNERKG-----TQTHAVSLV-------------------SLIDPSSPVA----EQYRTI
C9B454      RTQKQKA-----AQTNAVSLI-------------------TLTNPSSPIA----EQYRTI
Q3XYS6      RTQKQKV-----IQTHAVSLI-------------------TLTNPSSPIS----EQYRTI
C9ALZ9      RTQKQKA-----AQTHAVSLV-------------------TLTNPSSPIA----EQYRTI
C9BUG7      RTQKQKA-----AQTHAVSLV-------------------TLTNPSSPIA----EQYRTI
D4RJF4      RTQKQKA-----AQTHAVSLI-------------------TLTNPSSPIA----EQYRTI
C8ZXT9      KQQERKG-----TQTHAVSLI-------------------TLVDPSSPIS----EQYRTI
C9A6V5      -------------------MI-------------------TLIDPSSPIS----EQYRTI
C9CHY8      KKQERTG-----TETHAVSLI-------------------TLVDPSSPIA----EQYRTI
Q814Z0      LNLFKKK----KSHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
B9IRQ6      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
A0RL70      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
Q6HB09      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
B7HFH1      LNLFKKK----QNYRQRRQLI-------------------AHQQPKSPIS----EQYRNI
B7IQS8      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
B3ZRD6      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
B5UQ73      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
G9QCG3      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
Q3EV64      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
B7HXB4      LNLFKKK----KNHRQRRQLI-------------------AHQQPKSPIS----EQYRNI
Q72XH8      LNLFKKK----KNHRQRRQLI-------------------THQQPKSPIS----EQYRNI
Q5WBB4      RLTRAKK----KPVQKKRQLI-------------------ADVNRRSPIT----EQYRTI
B1YMM5      MAKKNKM------NKDARNLI-------------------TVTQPKSPVA----EQYRTI
D7WMM8      WKKKKKK----KLVKMARKLV-------------------TIANGHSFIS----EQFRTI
A7Z921      FRKKKSR--------RGLAQI-------------------SVLHHKSLVA----EQYRTI
I2CAF2      FRKKKSR--------RGLAQI-------------------SVLHHKSLVA----EQYRTI
A7Z9K0      TRKKDKP--------GKRSVI-------------------AMSEPKSINS----EQYRTI
I2CB16      TRKKDKP--------GKRSVI-------------------AMTEPKSINS----EQYRTI
I2HW53      TRKKDKP--------GKRSVI-------------------AMSEPKSINS----EQYRTI
G9QKR4      MARKTKK------IDNKRKLI-------------------AKLNPKSPIS----EQYRTI
D5DBK3      MARKRKENKNDKVLTLKRRLL-------------------AHNSPKDPVA----EQYRTI
D5DY81      MARKKKDQKNDKMLTLKRRLL-------------------AHNSPKDPVA----EQYRTI
Q2BFS5      FKNKPKA----SVNDSRRKLV-------------------AAYNTKSPIA----EQYRTV
A4ITF3      MAAKKRK----KFQKAERNLI-------------------TFDDPKSPIS----EQYRTI
C5D961      MARRDRK----KIQKIERSLI-------------------TMEDPKSPIS----EQYRTI
G8MZ93      MARKPAT----SIRKAERRLI-------------------TVDNPKSPIA----EQYRTI
F0G6H5      PRGESPRLAGADARNRPHASA-------------------ASRGGLADP--AI-ESLRNF
F2I4B7      ----------------------------------------MVVDNPTSA--MA-EQFRTI
Q74BQ8      PAEP------LEGIRHDNPLL-------------------ATLNDPHSY--VS-EEYRKL
F0JCB8      SDCLD--------RARQQRML-------------------VAMNEPISL--AA-EEFRKL
Q314L3      APRVA-----AARQVRLSPKL-------------------VTATAMQSG--LS-EEYRKL
B5EA81      PPQIPAVSPQYGRLAPQNPFL-------------------VNLHDPHSP--AA-EEYRKL
C6DZX5      PPQISPVSPQYGRLAPQNPFL-------------------VNLHDPHSP--AA-EEYRKL
A1ARV8      PDMV------VNKVMSDDPLL-------------------VSLNDPASP--VA-EEYRKL
C6CW37      ---------MSMRRSTSDNRL-------------------VVLLNPSSP--VA-EAYRTL
G9RSY9      -----------------------------------------------TPFQYQ-EAYKSL
B9Y884      -------------MLRVGEEL-------------------ITILDPESS--AS-EAYRTL
A5Z5P9      ---------------MNKIKM-------------------DLTKELPYA--VE-ESINRL
Q1AUN8      RTSLRRRAREEQRKGDLSGRL-------------------ITLHDPSDP--AS-EAYRTL
F0SX22      IKRLLNKGRNKTPDIVRDKLN-------------------ILNSDSAFS--TI-EEYKAL
B6W7H4      -----------------MAKK-------------------HGYYNTTSV--FD-EAIRSV
F0GT81      -----------------MSKK-------------------GNKYYTASL--YD-EAIRSL
B1R3X6      -------------------MF-------------------LVDKDPKSI--AA-ESYRVL
Q8XN76      -------------------MF-------------------LVDKDPKSI--AA-ESYRVL
B1BNK1      -------------------MF-------------------LVDKDPKSI--AA-ESYRVL
B1V0N7      -------------------MF-------------------LVDKEPKSI--AA-ESYRVL
Q0SVR8      -------------------ML-------------------ILEKNPKSV--AA-ESYRTL
B1BNH3      -------------------ML-------------------ILESNSQSV--AA-ESYRTL
Q8XN46      -------------------ML-------------------ILESNSQSV--AA-ESYRTL
B1V1Z4      -------------------ML-------------------ILESNSQSV--AA-ESYRTL
G5GFW0      ---------MDIRGQNGTVKL-------------------RPPNKEDYF--YN-EAIKAL
C2EFR6      EIMVKVRANGERGCEWMQKFE-------------------LRLDDIDFQ--SQ-ESFKTL
F3ATF5      -------------MAEQKVIM-------------------TDPRQEDYF--YQ-EAIKTL
D4M2S0      -------------MAIQRVML-------------------TDSRKEDVF--YE-EAIKTL
F4BS19      -----MFKKRLKEKKYEDKNL-------------------ITLIDPSSI--IS-EEFRTL
D4CG08      -----------MGKMMKVVNI-------------------HTDENRDFR--FE-EAIKTL
D4MP30      -----------MGKMMKVVNI-------------------HTDENRDFR--FE-EAIKTL
C6LCS5      ---------------MANINI-------------------DTMTKLSFR--VS-EAYKSL
B0P2G2      ---------------MKKLVM-------------------DLPEINDYR--MV-EGLNQL
D4MW29      ---------------MKKLVM-------------------DLPEINDYR--MV-EGLNQL
E5VMX8      ---------------MKKLVM-------------------DLPEINDYR--MV-EGLNQL
D4JMC2      ---------------METVVI-------------------NQIKDQSYT--MK-ESLRAL
D6E0V4      ---------------METVVI-------------------NQIKDQSYT--MK-ESLRAL
D6E330      ---------------MELVKF-------------------GKLKEQSYT--MK-ESLRAL
C4Z8M5      ---------------MELVKF-------------------GKLKEQSYT--MK-ESLRAL
D4JI67      ---------------MELVKF-------------------GKLKEQSYT--MK-ESLRAL
D3AC80      ---------------MQKVLL-------------------RKHEKLDFR--AN-EAFKTL
G5IFS3      ---------------MEQIRF-------------------RKREQLDFR--AT-EAFKAL
D4RX67      ---------------MQKISI-------------------SKIGKLDYR--TN-EAFKRL
A6BIG7      ------------MEDMADIVL-------------------KKVIK-DYR--SS-EAYKTL
C0C0F8      ------------MMEMQEIYL-------------------KNMTK-DYR--SN-EAYKTL
Q97EP8      -----------MLVV---------------------------KDKPKSP--IS-EAYRTL
Q97ER5      -----------MLVV---------------------------KDKPKSP--IA-EAYRTL
D2RIR2      -----------MEEIKLIV-----------------------ENDPKSP--IA-ETYRAI
G0VNK6      -----------MAEIDFIT-----------------------HYDSRSP--VS-EAYRAI
I0GRR2      -----------MANIDLIV-----------------------HNDAKSP--IS-EAYRAI
A0PZ02      -----------MLIV---------------------------EKEPKSI--AA-EAYRTL
B1B736      -----------MLIV---------------------------EKEPKSI--AA-EAYRTL
F6BI62      -----------MIDVNNNVFK-------------------NNVVNSKTT--VS-EAFRSL
Q8RBS5      -----------MVMARNLI-----------------------LSDPKSP--FA-EAFRAL
G2MWC2      -----------MVAARNLI-----------------------VADPKSP--FA-EAFRAL
B0K4N1      -----------MVVARNPI-----------------------VADPKSP--FA-EAFRAL
B0KAR5      -----------MVVARNPI-----------------------VADPKSP--FA-EAFRAL
E8UV29      -----------MVVARNPI-----------------------VADPKSP--FA-EAFRAL
C7ISF7      -----------MVIARNPI-----------------------VADPKSP--FA-EAFRAL
F7K9V1      ---------------MQTVTF-------------------NSIEKLDFR--TK-ESYKTL
F7K8E9      ---------------MQTITF-------------------SAIEKLDFR--TK-ESYKTL
F7KL96      ---------------MQTVTF-------------------NAIEKLDFR--TK-ESYKTL
C9AAE5      -----------MRSMKENYSI------------------------------IS-EQVKLI
H7F6C8      -----------MSNTKRNKRR----------------------KDSYSP--TS-EQFKLI
H7F5T6      --------MKKTDKKDLKNRL-------------------VALHEPSSP--QA-EYFRTI
E6PYQ3      QFQSIGMSWHPDHPAKNGIAL-------------------ITLLAPRSA--SA-EAYRLL
C1J9I3      KLFHRHQED--QETQKNGVML-------------------VAFAEPKHV--VS-EQFRTV
B1MZT1      KALG-DGLS--AETMTKGARL-------------------IAAAEPKNP--VS-EQFRTL
Q03W95      RAVGKDGLS--VETMTKGARL-------------------ITAAEPKNP--VS-EQFRTL
B1R3V1      -----------MWESKGGKWML------------------ILESNSQSV--AA-ESYRTL
I5B296      VTQ--------SGSRRTDSAL-------------------VTASDPHSP--VS-EQFRLL
D4YF13      SKKKQQKL---ENEQKLGSPL-------------------VTYFEPMSA--IA-EQYKTI
E6U7N4      --------MANKHRVLSHDVL-------------------LSSGNVPFQ--FV-ESYKTL
C0QCJ2      ESPETGAH---VQEDPQTIELPQSLDKSL-----------VTHLKPHSS--EA-EQFRIL
F2I6Z7      KIDKK------NKEQRRGVSL-------------------ITAADPNHV--IS-EQFRTI
C2MBF8      ------------MIDQASRTF-------------------VVGRHRRSL--VS-EAFTVI
D3AE78      ---------------MQKVEF-------------------KKLPRLDFR--AN-EAFKTL
Q39U17      AVIEPEVFQPDTRIAVDNPYL-------------------VTISEPRSP--VT-EEYRKL
B9M2X6      SVHAYQQPMPNERLKVKNPLV-------------------VSVTAPQTS--VA-EEYRKL
A5G424      AVHVPPLPSSPAAAKIENPFI-------------------VTVNDPHTP--AA-EEYRKL
E8WSZ5      AERVPPVVPAGQALSPQNPFL-------------------VTILDPHSQ--AA-EEYRKL
C7LPS3      GVSGIARAPMGESTSVGGVRLAEETM--------------VVINAPLSP--MA-EEYRKL
C3WFM9      ---------------MSKRKI-------------------FFIQEDNME--AT-EAFRTV
D4YHG7      RKHFDKM----NAEQRRGASL-------------------ITVTQPNDV--IS-ESFRQI
A4J8V0      --------------MMLNNRL-------------------VVLENPKSP--VA-EAYRIA
A8U9F4      KK---------QLDTSERPSL-------------------VTLTRPSSV--IA-EQFRTI
F4BSD9      EK---------KLDNNERPSL-------------------VTLTRPSSV--IA-EQFRTI
F7V792      EGFERKSGSGENIIPKHSLEI-------------------EGIQELSYA--LE-EAINRL
F6IR93      RK---------TTAETSGVQL-------------------TTITAPMSV--VT-EQIKTI
G0M0F9      RK---------TTAETSGVQL-------------------TTITAPMSV--VT-EQIKTI
F6ITB4      EQ---------STTTTAPINL-------------------TAINEPMSV--IT-EQIKTI
G0M1X9      EQ---------NTTTTAPINL-------------------TAINEPMSV--IT-EQIKTI
G0LYN9      GQ---------NITTTAPINL-------------------TTINEPKSV--IT-EQIKTI
D7VC13      EK---------NIATTAPINL-------------------TTINEPMSV--IT-EQIKTI
F9UMZ6      EQ---------NITTTAPINL-------------------TTINEPMSV--IT-EQIKTI
G7QCG1      EATLPPPSQAIDPARLSEEKL-------------------VVLKSPASP--EA-EEFRKL
I2Q341      DAPLPQPSQAIDPARLSEEKL-------------------VVLKSPASP--EA-EEFRKL
H8YYB9      KVIAQEQE---TKPAGPGVQVSYTETRSLSLDPEQLRAKRVLLNEVRSP--IV-DAYNVL
I5AV01      ----------------MDVIK-------------------IKQPDQDYF--TR-EAYKTL
B0GAL3      KAAMSRRD---NKASKLRVEL-------------------TDPRKSNYF--YE-EALKTL
G1WUK2      KAAMSRRD---NKASKLRVEL-------------------TDPRKSNYF--YE-EALKTL
E0RZL3      --------------MQNAKLH-------------------FSQSENNYQ--IK-EAYKTL
F0K0J7      -----HLN---NDTMKNGVKL-------------------ITLANPQSV--IS-EQFRNI
Q1G8E4      -----HLN---NDTMKNGVKL-------------------ITLANPQSV--IS-EQFRNI
D6S4X4      -----RGT---DETMHYGAKL-------------------ITVAKPQSQ--TT-EQFRTV
D0DJH0      -----RGT---DDTIKNGAQL-------------------ITVADPRSA--IS-EQFRTI
C7XKF3      -----RGT---DDTIKHGAKL-------------------ITVADPRSA--VS-EQFRTI
E3R264      -----RGT---DDTIKHGAKL-------------------ITVADPRSA--VS-EQFRTI
D5GZJ8      -----RGT---DDTIKHGAQL-------------------ITVADPRSA--VA-EQFRTI
C2EPK5      -----RGT---NETIEKGAKL-------------------ITVAKPKGP--VS-EQFRTI
A4ZGZ8      -----RGT---DETIKKGAKL-------------------ITVADPKSP--VT-EQFRTI
A8YX89      -----RGT---DETIKKGAKL-------------------ITVADPKSP--VT-EQFRTI
F0NWJ7      -----RGT---DETIKKGAKL-------------------ITVADPKSP--VT-EQFRTI
E4SMV5      -----RGT---DDTIKNGAKL-------------------ITVAKPKSP--IA-EQFRTV
F0TGY2      -----RGT---DDTIKNGAKL-------------------ITVAKPKSP--IA-EQFRTV
Q5FIC7      -----RGT---DETIKHGAKL-------------------ITVAKPKSP--IA-EQFRTV
F2M2M6      -----RGT---DDTIKNGAKL-------------------ITVAKPKSP--IA-EQFRTV
G7M0Q3      ---MKIRN---KKNKNKKNIF-------------------SVEDKPKSV--VS-EAYKTL
G7M1R9      FKARKLEK---AVASQQYRGF-------------------VVEKKPKSI--VS-EAYRTL
A6M2L9      YK--LEKT---VVDNRIHAGF-------------------IVEDKPKSI--VA-EAYRTL
G7M566      YKKGKDNN---TIDDRIHAGF-------------------IVEEKPKSV--VS-EAYRTL
E0NHP4      ---KPKLD---NESLKNGVGL-------------------ITYNDPTST--IA-EQFRTV
H1LCW3      ---RKKLS---TDTLRNGVKL-------------------ITDVDPKDI--VS-EQFRTV
C2JZS1      LFSHNHVD---QETQKNGVFL-------------------VTFAEPKHV--VS-EQFRTV
Q58Z10      ILHRHKED---QETQKNGVML-------------------VTFAEPKHV--VS-EQFRTV
G2KUP1      ----KKLD---DNTMKNGAPL-------------------IVEYKPISP--IA-EQFRTV
G8PE06      ----RKLD---DESLKNGVGL-------------------IAYTEPASV--IA-EQFRTI
Q03GL8      ----QKLD---NESLKNGVGL-------------------VTFTDPTST--IA-EQFRTV
E9SAU1      ----QSSN---TRTRRRTLMD-------------------KSVAFP-----VT-EAYKNL
Q38VG5      ----KKLD---QDSMKEGVGL-------------------ITLTSPTSV--IA-EQFRTI
F0HVF1      ----NHLD---NETIKNGVKL-------------------ITLANPQSV--IS-EQFRNI
G6F8G9      --------------MKNGVKL-------------------ITLANPQSV--IS-EQFRNI
C2EWM3      ----TNAS---NETIRYGAKL-------------------ITVKDPKNV--IS-EQFRTI
F8DRU2      ----QQQS---TDTMNNGAKL-------------------ITVAHPKSP--IS-EQFRTI
B3XL23      ----QQQS---TDTMDNGAKL-------------------ITVAHPKSP--IS-EQFRTI
F8KGP1      ----QQQS---TDTMDNGAKL-------------------ITVAHPKSP--IS-EQFRTI
H4GK03      ----KIQS---VDTMVNGANL-------------------VTLTKPQSL--VA-EQFRTI
B2GF33      ----YTES---TDTMDNGAML-------------------ITLADPKSG--PA-EQFRTI
C0WW26      ----YTES---IDTMDNGAML-------------------ITLADPKSG--PA-EQFRTI
D0DSJ4      ----YTES---TDTMDNGAML-------------------ITLANPKSG--PA-EQFRTI
C0ZHV8      ------MSMRRQKPDDRYQKL-------------------IAHWEPLSP--LV-EGYRTL
F8FCE2      ----------MPQRSSKNNVI-------------------ITEANPQSP--IS-ESYRTL
H6NE43      ----------MPQRSSKNNVI-------------------ITEANPQSP--IS-ESYRTL
I0BSG4      ----------MPQRSSKNNVI-------------------ITEANPQSP--IS-ESYRTL
Q83VF9      -------MAKNKRSIDNNLYL-------------------ITSVNPQSP--IS-EQYRTI
G8P3D7      -------MAKNKRSIDNNRYI-------------------ITSVNPQSP--IS-EQYRTI
O06030      -------MAKNKRSIDNNHYI-------------------ITSVNPQSP--IS-EQYRTI
G9M880      -------MAKNKRSIDNNRYI-------------------ITSVNPQSP--IS-EQYRTI
G6FD42      -------MAKNKRSIDNNRYI-------------------ITSVNPQSP--IS-EQYRTI
F9VC44      -------MAKNKRSIDNNRYI-------------------ITSVNPQSP--IS-EQYRTI
A9QSJ4      -------MAKNKRSIDNNRYI-------------------ITSVNPQSP--IS-EQYRTI
Q3ZK50      -------MAKNKRSIDNNRYI-------------------ITSVNPQSP--IS-EQYRTI
E3GPC6      ----------------MKDSI-------------------ITYKSPKDP--IS-EAFRNM
G0V447      ------------------MKP-------------------ILLKNPKSP--IS-EAYRTL
H7F1R7      ------------MLKLSERKL-------------------ITYANPSSP--IA-EQFKTL
E3H7M5      ---------------MRRRKL-------------------VFFDRDKEH--IA-EAIRIL
E6UHY4      ----MANTKKIPGGNRNRRRT-------------------LMDKNVAFP--VT-EAYKNL
D9QTC6      --MIKMDKERRERIQSRDVEL-------------------ITNYSSKSP--LA-EAYRTL
D9SR41      ----------------MLKSL-------------------VTHLDPKSV--IS-ETYRTL
E3HB18      ---------------MTERKL-------------------YFKLDGQSP--VA-ESLRVL
P95696      ----------MSKKENTTTTL-------------------FVYEKPKST--IS-EKFRGI
Q2G1K7      ----------MSKKENTTTTL-------------------FVYEKPKST--IS-EKFRGI
A8YPQ5      ----------MTNTRRSTSSL-------------------IVHEQPKSP--IS-EKFRGI
Q2FUV2      ----------MTNTRRSTSSL-------------------IVHEQPKSP--IS-EKFRGI
P39851      ----------MAKKKSTISPL-------------------YVHDKPKST--IS-EKFRGI
C5QNG4      --------MMAEKRKKLEQPL-------------------FVNDKPKSI--IS-EKFRGI
Q4L9H7      -----MPKKNKEKRKKLSHPL-------------------YVHDKPKSV--AS-ERFRGI
A7NQ71      MNTTNDARAMNQTNGYAESPL-------------------IALRDPRSP--AA-EAYRTL
E4Q5T5      --------------MNAVKEV-------------------IALYNPRSP--IT-ESYRML
E4SDX4      --------------MNAVKEV-------------------IALYNPRSP--IT-ESYRML
E4S7Y6      --------------MSIVKEV-------------------IAYYNPRSP--IT-ESYRML
C6CS80      ----------MSRSDLKLRPV-------------------VADANPTSP--IS-EAYRTL
E6LD64      -----MAKNNKRGTETKPVSL-------------------ITLIDKSSP--IS-EQYRTI
F0EKB9      ---MMAKKQERTGTQTHAVSL-------------------ITLIDPSSP--IS-EQYRTI
H7F571      ----------MGERTSGGKNL-------------------ITIVNPNGP--IS-EQFKTL
F5LE48      ----------MLASTNNSKVL-------------------IADVNPKSQ--IS-EAYRVL
E7RDR3      ------MARKKKVLQETARKL-------------------IAFTTPRSV--VT-EQFRTL
E7RG08      ------MVKKKNKPEVKNRKL-------------------IAFTNPKSR--VS-EQFRTL
G2FWX4      ----------------MAYSL-------------------ITLEESKSP--IS-EAYRTL
G2FM59      ----------------MAYSL-------------------ITLEQTKSP--IS-EAYRML
G7WJV1      ----------------MVYSL-------------------ITFEKTKSP--IS-EAYRTL
H5XZD4      ----------------MVYSL-------------------ITFEQTKSP--IS-EAYRSL
H5XZG7      ----------------MSHSL-------------------ITHEQTKSP--IS-EAYRTL
G7W773      ------------------MTL-------------------ITHEQTKSP--IS-EAYRTL
G2FWT8      ----------------MAYSL-------------------ITLEQSKSP--IS-EAYRTL
I4DBG8      ----------------MKHSL-------------------ITLEQSKSP--VS-EAFRTL
C0EBA6      ----------MSINHKKHTHL-------------------DVVLGKTSPFAIT-EAYKTM
Q9K6R0      ----MLGKGSKQKNGSKQREL-------------------ITHIKKNSP--IS-EQYRTI
I2HVL2      ----MRRLGFRKKKSRRGLAQ-------------------ISVLHHKSL--VA-EQYRTI
D4G1R2      ------------------------------------------------------------
G4EQZ7      -------MIFRKKKARRGLAQ-------------------ISVLHNKSV--VA-EQYRTI
P71051      -------MIFRKKKARRGLAQ-------------------ISVLHNKSV--VA-EQYRTI
E0U2Z3      -------MFFRKKKARRGLAQ-------------------ISVLHNKSI--VA-EQYRTI
G4P114      -------MVFRKKKARRGLAQ-------------------ISVLHNKSI--VA-EQYRTI
A9VRC3      --MALNSLFKKKQNHRQRRQL-------------------IAHQQPKSP--IS-EQYRNI
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      KERLRRLAPKKTKLLNTRRKL-------------------IAKLNPKSP--IS-EQFRTI
P96716      ---MALRKNR---GSRMQRNV-------------------IAMTEPKSL--NS-EQYRTI
G4EQF3      ----------------MQRNV-------------------IAMTEPKSL--NS-EQYRTI
D4G2E1      ----------------MRRNV-------------------IAMTEPKSL--NS-EQYRTI
I0F9R6      ----------------MRRNV-------------------IAMTEPKSL--NS-EQYRTI
E0TTZ6      ---MALRKTR---GSWMRRTV-------------------IAMTEPKSL--NS-EQYRTI
G4P1M7      ---MALRKSS---GSWIRRNV-------------------IAMTEPKSL--NS-EQYRTI
A8FHL9      ---MIFKRKK---REKRDLSC-------------------ISVLNPHSV--IA-EQFRTI
Q5KUM5      --MKPLARKPATSIRKAERRL-------------------ITVDNPKSP--IA-EQYRTI
D3FZP4      ---MLKRNQSVSTRTQQQRKV-------------------VSHSNPKSP--IA-EQYRTL
I0JRK4      ---MALSKKK-KNQQTSVRSI-------------------IANDNPKSP--IA-EQYRTI
I3EBB3      ---MVLKNKK-KALLQHKRKL-------------------ITKLNPKSP--IS-EQYRTI
E3CP62      ------------------------------------MPLLKLVKSKVQFAKQTEEYYNAI
C2KHF1      ------------------------------------ARLITAAEPK----NHVSEQFRTL
I0UTA5      SSILGVLPTSDDLTE---------------------ENIVTGSSND----HIAQESIRQL
B7BDT8      VPFVGEIPLVGSGKKKKKTANTA-------------KEIVIHQGKR----DIVNEAFRVL
G9WIQ9      ------------------------------------VPLITLDDPQ----DVVSEQFRVL
A0NKF6      ------------------------------------VPLVTVQDPQ----NVVAEQFRVL
Q04DV8      ------------------------------------VPLVTVQDPQ----NVVAEQFRVL
F4SM97      INVYASIPVAENSV-----KKASQIKRFKQKAEKEYTTFLFIENPA----DLAIESIRGL
G5Q4J0      ISVYASIPLSEWQKARDSVKTIKGIKRYKQ------SQLLAVGNPT----DLAIEAIRSL
G5LQM6      ISVYASIPLSEWQKARDSVKTIKGIKRYKQ------SQLLAVGNPT----DLAIEAIRSL
G5SDT8      ISVYASIPLSEWQKARDSVKTIKGIKRYKQ------SQLLAVGNPT----DLAIEAIRSL
F3CAY9      MPVYASLPHSRQQE-----RLEKRDQDSKD------SRLLSIAAPG----ELAIESLRSL
A3K8W7      -----DLPVARFEL-----SQLNRHRVVTA------DRL-----------DPAHATFDVL
G7EJX6      QRMLGLLPHVKLPK-----NSVFPIHAYLD------ENY-----------RRFAESVRTF
B7B947      VPFLGEIPMRDKKDK---------------------NEVVVHENGR----DSVSEAFRIV
D3LB10      PQKLSANDLRSSRYG---------------------VPLITVQDPQ----DVVAGQFRVL
S9QRP1      WDALRSISVDERQLD---------------------RNRVITAGRH----DPAHTAFDVL
G8AU96      W----NLPLHPDS-R---------------------RAREIGAFRE---------AIQTV
A3W0H7      WPALRRVVLDPKHLA---------------------MHRLISATRE----DPAHVAFDVL
Q0FMP0      WHRLQEFTVNPRHLE---------------------RHRIITAERQ----DPAHAAFDVL
                                                                        

E9TE88      -----------MMQ-AQNNVLMM-TGVSPS-IGKTFVCANLAAVIS-QT-NKRVLLIDCD
B8D0N2      RANLEF---V-AKK-NEARTVLI-TSTGPGAEGKSTISVNLAFAFA-EI-GKRVMLVDAD
C2CI44      RTNIQF---S-SLD-KKNKIIAV-TSTKPS-EGKSTVIYKLAKSFA-DN-GERVILIDCD
C7RGH6      RTNIQF---S-SLD-KKNKVISI-TSTKPA-EGKSTVIYKLAKSFA-DN-GDKVILLDCD
C0CK73      RTNIMY---S-----EDVKAIML-TSTMPS-EGKSTVSLELARSFA-AL-GKNTVLMDCD
Q1WTC8      RFNVEF---S-G---EKNQVFYI-TSTYPN-EGKSTVSLELALAFS-DN-GKKALLIDAD
E8JWI5      RTNIQL---S-G---EDIKVIAV-SSTFPG-EGKTTTSTNLALTFA-KA-GHKTLLIDAD
F3AHH0      RANLQF---C-G---DDKKVLAI-TSCTPN-EGKSSVTLNLAVSLA-ES-GKKVLLLDAD
F7K0U1      RTNIEF---S-G---EENKVLVF-TSCTPN-EGKSTVSLSVASSLA-ES-GKKVLFIDAD
C4Z672      RTNIEF---S-G---DNNKVIFI-TSTTPG-EGKSTVSFELAMSFA-QN-GMKTLLIDAD
P0C0T9      RTNIQF---S-G---KENKILAI-TSVREG-EGKSTTSTSLALSLA-QA-GFKTLLIDAD
Q04663      RTNIQF---S-G---KENKILAI-TSVREG-EGKSTTSTSLALSLA-QA-GFKTLLIDAD
Q67AY4      RTNIQF---S-G---KENKILAI-TSVREG-EGKSTTSTSLALSLA-QA-GFKTLLIDAD
Q3K0T0      RTNIQF---S-G---KENKILAI-TSVREG-EGKSTTSTSLALSLA-QA-GFKTLLIDAD
C5NWJ8      RTNIQF---L-G---KDKKVIAI-TSTSEN-EGKSTVSTNLAISLA-KL-GLKTILVDAD
F3A499      RTNIQF---L-G---KDKKVIVI-TSTSEN-EGKSTVSTNLAISLA-KL-GLKTILVDAD
Q4JZ55      QTNIQL---S-G---DGLKVISV-TSTVKN-EGKSTISVGLSMSLA-LS-GYKVLLLDVD
G5JTD5      RANIQF---S-G---SDIKVIAL-TSVQPK-EGKSTTTMSLAVSFA-RA-GYRTLLIDAD
G3G7C1      RTNIQL---S-G---EDIKVVGI-TSVQLN-EGKSTIAASLAIAYA-RS-GYKTVLVDAD
G3G7J9      RTNIQL---S-G---EDIKVVGI-TSVQLN-KGKSTIAASLAIAYA-RS-GYKTVLVDAD
G3G7G6      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSRTAASLAIAYA-RS-GYKTVLVDAD
G8DUB0      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
G3G7I8      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
G3G7J4      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
G7SG34      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLALAYA-RS-GYKTVLVDAD
G8DTZ0      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
G8DU07      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLALAYA-RS-GYKTVLVDAD
A4VTU3      RTNIQL---S-G---ADIKVVGI-TSVKSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
G8DU31      RTNIQL---S-G---ADIKVVGI-TSVQSN-EGKSTTAASLAIAYA-RS-DYKTVLVDAD
D5AGQ5      RTNIQL---S-G---ADIKVVGI-TSVKSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
Q9X4U7      RTNIQL---S-G---ADIKVVGI-TSVKSN-EGKSTTAASLAIAYA-RS-GYKTVLVDAD
A3CQY2      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
E8KLY9      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F0FHA8      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F0I4H5      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F0IAY3      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F0IJI2      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F0IS53      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F2C9N0      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F2CH53      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F3SM32      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F3UDW7      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F3UNJ4      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
F0FQQ5      STNVQL---S-G---ANIKMVEI-SSVTAN-EGKSTTSVNLAAAFA-RA-GHKTLMIDAD
D6R2T8      STNVQL---S-G---ANIKVVEV-TSVMPN-EGKSTTSTNLAIAFA-RS-GYKTLLIDSD
F3UUQ2      STNVQL---S-G---ANIKVVEV-TSVMPN-EGKSTTSTNLAIAFA-RS-GYKTLLIDSD
E6IZC2      RTNIQL---S-G---DNIKVIAV-TSVQSG-EGKSTTSTNLAIAFA-RS-GYNTLLIDAD
G6A745      RTNIQL---S-G---ENIKVIAV-TSVQSG-EGKSTTSTNLAIAFA-RS-GYNTLLIDAD
A8AZR3      RTNIQL---S-G---EDIKIVAV-TSVQPN-EGKSTTSTNLAIAFA-RA-GYTTLLIDAD
F9HJP6      RTNIQL---S-G---ENIKIVSL-TSVHPN-EGKSTTSTNLAIAFA-RA-GYKTLLIDAD
Q4JYT9      RTNIQL---S-G---DNLRVLSI-SSVKPG-EGKSTTSINIAWAFA-RA-GYKALLVDAD
Q4JZY1      RTNIQL---S-G---DNLKVLSI-SSVKPG-EGKSVTSMNIAWAFA-RA-GYKALLVDAD
E1LQJ7      RTNIQL---S-G---DNLKVLSI-SSVKSG-EGKSTTSINIAWAFA-RA-GYKTLLVDAD
F9HC65      RTNIQL---S-G---DNLKVLAI-SSVKPG-EGKSTTATNIAWAFA-RA-GYKTLLVDAD
E1LPE7      RTNVQL---S-G---NDLKVIVV-TSVDSS-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
F9MJW5      RTNVQL---S-G---NDLKVIVV-TSVDSS-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
E8KDN2      RTNIQL---S-G---DKLKVIAI-SSVRPG-EGKSTTSINIAWAFA-RA-GYKTLLVDAD
E8K322      RTNIQL---S-G---DGLKVIAL-SSVRPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
F9PEU4      RTNIQL---S-G---DGLKVIAL-SSVRPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
F9PZP7      RTNIQL---S-G---DGLKVIAL-SSVRPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
C1CBD1      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSINIAWSFA-RA-GYKTLLIDGD
Q7WVX0      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSINIAWSFA-RA-GYKTLLIDGD
P96475      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIAMSFA-RA-GYKTLLFDGD
Q9AHD2      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSINIAWSFA-RA-GYKTLLIDGD
Q4K2Q7      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLLDGD
Q4K0T5      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4K0E1      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIAWSFA-RA-GYKTLLIDGD
Q9AH95      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSINIAWSFA-RA-GYKTLLIDGD
Q4K1M4      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4JZ18      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q54520      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4JYH5      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVSIARSFA-RA-GYKTLLIDGD
Q4K0V2      CTNIQL---S-G---DKLKVISV-TSVNPE-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
A5M4L1      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
B2ILP5      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
C1CCB9      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4K1S7      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
P72512      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4JZ84      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4K0X5      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4K0Z6      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4K195      CTNIQL---S-G---DKLKVISV-TSVSPG-EGKTTTSVNIAWSFA-RA-GYKTLLIDGD
Q4K0A0      CTNIQL---S-G---DKLKVISV-TSVNPG-EGKTTTSVNIARSFA-RA-GYKTLLIDGD
Q4K0K2      CTNIQL---S-G---DKLKVISV-TSVSPG-EGKTTTSVNIAWSFA-RA-GYKTLLIDGD
Q4K1F9      CTNIQL---S-G---DKLKVISV-TSVSPG-EGKTTTSVNIAWSFA-RA-GYKTLLIDGD
Q4K045      CTNLQL---S-G---DDLKVFSI-TSVKLG-EGKSMTSTSIAWTFA-RA-GYKTLLIDGD
G6C7Z1      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
D2ERX8      CTNLQL---S-G---DDLKVFSI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
F9LZC4      CTNLQL---S-G---DDLKVFSI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
F9P1W8      CTNLQL---S-G---DDLKVFSI-TSVNPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
I0J9C9      CTNLQL---S-G---DDLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-HA-GYKTLLIDGD
A6YIA8      CTNLQL---S-G---DGLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4K005      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKSMTSTNIAWAFA-HA-GYKTLLIDGD
Q4JZL7      CTNLQL---S-G---DGLKVFSI-TSVKIG-EGKSTTSANIAWAFA-RA-GYKTLLIDGD
E5F5C5      CTNLQL---S-G---DGLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4JZG7      CTNLQL---S-G---DGLKVFSI-TSVKIG-EGKSTTSANIAWAFA-RA-GYKTLLIDGD
Q4JZK1      CTNLQL---S-G---DGLKVFSI-TSVKIG-EGKSTTSANIAWAFA-RA-GYKTLLIDGD
A5LJS0      CTNLQL---S-G---DGLKVFSI-TSVKIG-EGKSTNSTNIAWAFA-RA-GYKTLLIDGD
Q9AHB7      CTNLQL---S-G---DGLKVFSI-TSVKIG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4K1B7      CTNLQL---S-G---DGLKVFSI-TSVKIG-EGKSTTSANIAWAFA-RA-GYKTLLIDGD
Q4JYK8      CTNLQL---S-G---DDLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4K0M3      CTNLQL---S-G---DDLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-HA-GYKTLLIDGD
Q9AHA4      CMNLQL---S-G---DGLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q9X9A1      CMNLQL---S-G---GGLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q9ZII6      CTNLQL---S-G---DGLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q8KWQ0      CTNLQL---S-G---DGLKVFSI-TSVKLG-EGKSTTSINIAWAFA-RA-GYKTLLIDGD
Q4JZW7      CTNLQL---S-G---DDLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-HA-GYKTLLIDGD
Q4JYX9      CTNLQL---S-G---DNLRVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4K0R7      CTNLQL---S-G---DNLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4K1K6      CTNLQL---S-G---DGLKVFSI-TSVKLG-EGKSTTSTNIAWAFA-RA-GYKTLLIDGD
Q4JZS3      CTNLQL---S-G---DDLKVFSI-TSVKQG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
Q4K0I2      CTNPQL---S-G---DDLKVFSI-SSVKAG-EGKTTTSTNIAWAFA-HA-GYKTLLIDAD
Q4K254      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKTTTSINIAWAFA-RA-GYKTLLIDAD
Q4K237      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKTTTSTNIAWAFA-RA-GYKTLLIDAD
B1I967      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKTTTSTNIAWAFA-RA-GYKTLLIDAD
G6J8A4      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKTTTSTNIAWAFA-RA-GYKTLLIDAD
Q9ZFT8      CTNLQL---S-G---DDLKVFSI-TSVKAG-EGKTTTSTNIAWAFA-RA-GYKTLLIDAD
D6ZQI8      CTNLQL---S-G---DDLKVFSI-TSVKVG-EGKTTTSTNIAWAFA-RA-GYKTLLIDAD
Q4K2A8      CTNLQL---S-G---DDLKVFSI-TSVKPG-EGKTTTSTNIAWAFA-RA-GYKTLLIDAD
Q8VU31      CTNLQL---S-G---DDLKVFSI-TSVKPG-EGKTTTSTNIARAFA-RA-GYKTLLIDAD
Q4K2E1      RTNIQL---S-G---DNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-HA-GYKTLLIDAD
Q4K2F7      RTNIQL---S-G---DNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-HA-GYKTLLIDAD
A5YTV7      RTNIQL---S-G---NNLKVIAI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
F9Q345      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
Q6L5R0      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
A5YTT9      RTNIQL---S-G---NNLQVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
E6KKS0      RTNIQL---S-G---NNLQVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
F2QF90      RTNIQL---S-G---NNLQVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
E0Q2S8      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
A1ILY1      RTNIQL---S-G---NNLKVIAI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
Q6L5T0      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
E9FEC5      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
E0PPH9      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
F5VSG9      RTNIQL---S-G---NNLKVISI-TSVKPG-EGKSTTSTNIAWAFA-RA-GYKTLLIDAD
E3CBS0      ATNIQL---S-G---VNLKVIAV-SSVQEN-EGKSTTSTNLAVAFA-RA-GYKTLLVDCD
F9M366      ATNIQL---S-G---VNLKVIAV-SSVKEN-EGKSTTSTNLAVAFA-RA-GYKTLLVDCD
E8K786      ATNIQL---S-G---VDLKVIAI-SSVQEN-EGKSTTSTNLAVAFA-RA-GYKTLLVDCD
F8DFF4      ATNIQL---S-G---VDLKVIAV-SSVQEN-EGKSTTSTNLAVAFA-RA-GYKTLLVDCD
I1ZPH7      ATNIQL---S-G---VDLKVIAV-SSVQEN-EGKSTTSTNLAVAFA-RA-GYKTLLVDCD
E7S8W3      STNIQL---S-G---TNIKVVAI-SSVQPN-EGKSTISTNLATAFA-RA-GYRTLLIDAD
D0RXH2      STNIQL---S-G---SDIKVVAV-SSVQPN-EGKSTISINLSLAFA-RA-GYRTLLIDAD
Q83YR5      STNIQL---S-G---SDIKVVAV-SSVQPN-EGKSTISINLSLAFA-RA-GYRTLLIDAD
Q8GP54      RTNIQF---S-G---AQIKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
F8HDC3      RTNIQF---S-G---ANFKVIAV-SSVQPG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
F8LJ75      RTNIQF---S-G---ANFKVIAV-SSVQPG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
E9DM17      RTNIQF---S-G---AQMKVIAV-SSVEAG-EGKSTTSVNIAISFA-SV-GLRTLLIDAD
I0QIK6      RTNIQF---S-G---AQMKVIAV-SSVEAG-EGKSTTSVNIAISFA-SV-GLRTLLIDAD
E8KUY8      RTNIQF---S-G---AQMKVISI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLFIDAD
Q7X553      RTNIQF---S-G---AQMKVIAI-SSVEAR-EGKSTTSVNLAISFA-SV-GLPTLLIDAD
Q8GP92      RTNIQF---S-G---AQMKVIAI-SSVEVG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q7X561      RTNIQF---S-G---AQIKVIAI-SSVEAG-EGKSPTSLNLAISFA-SV-GLRTLLIDAD
Q7X549      RTNIQF---S-G---AQMKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
G6ERT1      RTNIQF---S-G---AQMKVIAI-SSVEAR-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
O87931      RTNIQF---S-G---AQMKVIAI-SSVEAR-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q8GPF6      RTNIQF---S-G---AQIKVIAI-SSVEVG-EGKTTTSVNLAISFA-SI-GIRTLLIDAD
Q7X555      RTNIQF---S-G---AQIKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q7X557      RTNIQF---S-G---AQIKVIAI-SSVEVG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q7X563      RTNIQF---S-G---AQIKVIAV-SSVEAG-EGKSAISVNLAISFA-SV-GLRTLLIDAD
Q8GMA5      RTNIQF---S-G---AQIKVIAI-SSVEAG-EGKSTTSLNLAISFA-SV-GLRTLLIDAD
Q8GPA8      RTNIQF---S-G---AQIKVIAI-SSVEAG-EGKSTTSLNLAISFA-SV-GLRTLLIDAD
Q55205      RTNIQF---S-G---AQIKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
C2LSE6      RTNIQF---S-G---TQMKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q7X559      RTNIQF---S-G---AQMKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
F8LXJ4      RTNIQF---S-G---AQMKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q1WCR1      RTNIQF---S-G---AQMKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
Q8GPC3      RTNIQF---S-G---AQMKVIAI-SSVEAG-EGKSTTSVNLAISFA-SV-GLRTLLIDAD
E8JMT9      RTNIQF---S-G---RDLKVITL-TSAQPG-EGKSTTSVNLAISFA-HA-GFRTLLIDAD
F5X0J9      RTNIQF---S-G---RDLKVITL-TSAQPG-EGKSTTSVNLAISFA-RA-GFRTLLIDAD
H2A602      RTNIQF---S-G---RDLKVITL-TSAQSG-EGKSTTSVNLAISFA-RA-GFRTLLIDAD
E0PD83      RTNVQF---S-G---RDLKVITL-TSAQAG-EGKSTTSVNLAISFA-RA-GFRTLLIDAD
F5X652      RTNVQF---S-G---RDLKVITL-TSAQAG-EGKSTTSVNLAISFA-RA-GFRTLLIDAD
G5KD11      RTNIQF---S-G---RDLKVIVL-TSVQPN-EGKSTTSVNLAISLA-KA-GLKTLLIDAD
B9DUJ4      RTNIQF---S-G---RDLRVIVL-TSVQPN-EGKSTTSVNLAVSFA-KA-GLKTLLIDAD
G5KAJ2      RTNIQF---S-G---RDLRVIVL-TSVQPG-EGKSTSSINLAVSFA-NA-GFKTLLIDAD
F1Z124      RTNIQF---S-G---RDLKVITL-TSVQPG-EGKSTTSANIAISFA-KA-GLKTLLIDAD
Q2KM74      RTNIQF---S-G---RDYKAIVL-TSVQPG-EGKSTTSINLAISFA-KA-GFKTLLIDAD
C6LDI8      RTNITF---C-G---EDIKAIAI-TSSMPN-EGKSTVAFSLAQAFA-ED-NKQVLLIDAD
D4J4T6      RTNIYF---C-G---QDKQCIAF-TSSFPN-EGKSTVVFNLCKALA-ED-GKRVILLDAD
D4LTH2      RINVKF---C-G---KNTKKIML-TSCLPN-EGKSTVAVYLWKMLA-EA-GFPSVLVDVD
D4LG06      RINVKF---C-G---KNTKKILL-TSCMPN-EGKSTVSSYLWKMLA-EA-GFSTVMVDVD
A7VF42      RINIKF---C-G---KNTKKLLI-TSSLPN-EGKSTISINLWKMMA-EA-GFPTVFLDVD
A8SQS8      RINIKF---C-G---KNTKKILI-TSSMPN-EGKSSIAINLWKMLA-EA-GFPTVLVDVD
D5HFS4      RINIKF---C-G---KNTRKILI-TSSMPN-EGKSSVAINLWKMLA-EA-GFPAVLVDVD
C9LAS1      RTNIQF---T-G---KNVKTIMF-TSCFPN-EGKSDVTFQLCQEIG-NM-GKRVLLIDAD
F3AH92      RTNIQF---S-N---KEVKVILL-TSCYPN-EGKSDIAFNLSKEMG-SI-GKKVLLLDAD
I5ASF8      RANIVF---T-G---RKYKKIMF-TSCFQG-EGKSDTVFHLAVDMT-KL-GKRVLLIDAD
E7GL81      RTNIQF---S-G---TNLQVIML-TSAVPN-EGKSEISFSLASSLA-QI-DNRVLLIDAD
G5F9E2      RTNIQF---S-G---TNLQVIML-TSAVPN-EGKSEISFSLASSLA-QI-DNRVLLIDAD
E7GL57      RTNIQF---S-G---TGIQVVML-TSSVPG-EGKSETTFHLAASLA-QL-DKKVLLIDAD
G5F9A9      RTNIQF---S-G---TGIQVVML-TSSVPG-EGKSETTFHLAASLA-QL-DKKVLLIDAD
E7GL40      RTNIQF---S-G---SNIHAVMF-TSSAPN-EGKSETTFQLAASMV-QL-GKKVLLIDAD
G5F9H2      RTNIQF---S-G---SNIHAVMF-TSSAPN-EGKSETTFQLAASMA-QL-GKKVLLIDAD
A8RK85      RTNIQF---C-G---SGLKTIMF-TSSMPD-EGKSETAFALASSFG-NI-GKKVLLVDAD
G5HTB2      RTNMQF---C-G---SSLKTIMF-TSSLPN-EGKSEITFSVAASLG-SI-GKKVLMIDAD
G5HNC5      RTNIQF---C-G---NNLKTIMF-TSSLPS-EGKSDTTFAVAASFG-SI-GKKVLLIDGD
C0CZV9      RTNIQF---C-G---SGIRVIMM-TSALPD-EGKSDMAFALASSLA-QI-GKRVLLIDAD
A8RSK9      RTNIQF---C-G---NGIKTIML-TSSLPD-EGKSDITFAMASSLA-QI-GKRVVMIDAD
C5EN03      RTNIQF---C-G---SGIRTIML-TSSLPD-EGKSDITFAMASSLA-QI-GKKVVMIDAD
G5HG45      RTNIQF---C-G---NGIRTIML-TSSLPD-EGKSDITFAMAASLA-QI-GKKVVMIDAD
D9ST44      RTNIQF---S-SLD-KNVKTIVV-TSSVAG-EGKSTTCANLGVVMA-EN-GYNTILIDCD
G2Z8Q3      RTNIEF---I-SKQ-RMLKIMMI-TSTKPQ-EGKSTIIANLADVMG-RQ-ELKVLIIDAD
C8W5K2      RTNIHF---S-VLN-KPLKTLLI-TSAGCG-EGKTLTVANLGVAFA-QA-GEKAVLLDCD
A5V0I3      RTNIQF---S-SLD-KPLQTLLA-TSTAPD-EGKSTTLANLAVTIA-QA-EQRVILVDCD
F5LM71      RTNIQY---S-GVD-GEIRTLMV-TSASPW-EGKSTTIDNLAVVYA-QT-DKKVLLIDAD
D7VBW4      RTNLNY---A-MVG-KPLKTLMI-TSAIQG-EGKSTVGSNLAVEYA-KK-GLQVLLVDAD
F9UQ54      RTNLNY---A-MVG-KPLKTLMI-TSAIQG-EGKSTVSSNLAVEYA-KK-GLQVLLVDAD
H6LKR8      RTNLNF---I-NLE-NKYQVLLF-TSAAKE-EGKTTTIANLAITLA-QS-GKRVLLIDAD
E0I7B5      RTNIQF---S-SVD-EPIKVIMI-ASAQAG-EGKTTTVTNLAITYA-ME-GKRVLLIDAD
D7UYE4      RTNIMF---S-TAD-SEVKTVVV-TSEKPS-SGKSTISANLAITYA-QA-GFKTLLIDGD
Q4A120      RSNILF---S-TAD-AEIQTLLI-ASDKPS-SGKSTVSANIAVTYA-QA-GFKTLLIDGD
D9SVC7      KTKLQF---V-NID-NDIRTLLV-TSASKA-EGKSTTTANLAITVA-QS-GRKVLIIDSD
C8VYQ6      RTNIQF---S-SLD-KPIKSLLV-TSAGPN-EGKSLTVANLAVAFA-QA-GLKVLIIDCD
D9S1J9      RTNLQF---S-SID-RPLKKVVV-TSSIPQ-EGKSTVIANLAVSIA-SA-GSRVLLVDAD
C0GGR5      RTNIEF---S-DID-KDKKTLLT-TSATQG-EGKSVVTANLGVTMA-MA-GKRVLILDAD
B1HR41      RANIKF---S-QPN-QDVKTILV-TSSIAG-EGKSTNAANIGVVFS-QE-GKRVLIIDAD
C6CSC8      RTNIEF---A-AID-SALQVIMV-SSAGPG-EGKSTTIANLAVTFS-QS-DRKVVLIDAD
D6Y034      RTNIQF---A-SPD-ISLKRLLV-TSTSPG-EGKSTTAANLAIVLA-QQ-ENRVLLIDGD
Q8EME8      RTNLQF---A-SVD-SDLRSILL-TSAGPS-EGKSMTTANLAIVYA-QQ-GKRVLLVDAD
F3Y922      RTNIQY---A-MVD-KTLQTLAI-TSSNAS-EGKSTSTINLAIVFA-NS-NKKVLLVDAD
G4L594      RTNIQF---ASSAD-QQVKTIVV-TSSGPS-EGKSLSSANLAAVFA-QT-GQKVLLVDAD
C9B454      RTNIQF---ASAAG-QQIKTIVV-TSSGPG-EGKSTIAANIAVVFA-KS-GQRVLLVDAD
Q3XYS6      RTNIQF---ASAAG-QQIKTIVV-TSSGPG-EGKSTTAANIAVVFA-KS-GQRVLLVDAD
C9ALZ9      RTNIQF---ASAAG-QQIKTIVV-TSSGPG-EGKSTTAANIAVVFA-KS-GQRVLLVDAD
C9BUG7      RTNIQF---ASAAG-QQIKTIVV-TSSGPG-EGKSTTAANIAVVFA-KS-GQRVLLVDAD
D4RJF4      RTNIQF---ASAAG-QQIKTIVV-TSSGPG-EGKSTTSANIAVVFA-KS-GQRVLLVDAD
C8ZXT9      RTNIQF---ASSAD-QQIKTLVV-TSSGPG-EGKSTTSANLAVVFA-KS-GQRVLLVDAD
C9A6V5      RTNIQF---ASSAD-KQIKTIVV-TSSGPG-EGKSTTSANLAVVFA-KS-GQRVLLVDAD
C9CHY8      RTNIQF---ASSAD-KQIKTIVV-TSSGPA-EGKSTTSANLAVVFA-KS-GQRVLLVDAD
Q814Z0      RTNIEF---A-AID-MNLHSLLV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
B9IRQ6      RTNIEF---A-AVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
A0RL70      RTNVEF---A-AVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
Q6HB09      RTNVEF---A-AVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
B7HFH1      RTNIEF---A-AVD-TNLHSLMI-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
B7IQS8      RTNIEF---A-AID-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
B3ZRD6      RTNIEF---A-AVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
B5UQ73      RTNIEF---A-AID-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
G9QCG3      RTNIEF---A-AID-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
Q3EV64      RTNIEF---A-AVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
B7HXB4      RTNVEF---A-SVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
Q72XH8      RTNIEF---A-AVD-KNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
Q5WBB4      RTNIEY---S-AVD-TEIKSLLV-TSAGPG-EGKSTTASNLAVVIA-QN-GQTVLLIDAD
B1YMM5      RTNIEF---M-AVD-REIQVILV-TSATQG-EGKSTTSSNLAVAYA-QQ-GKKVLIIDTD
D7WMM8      RTNITF---S-MPD-REIKTILV-TSATPG-EGKSTNAANIGVVFA-QE-GKRVVIVDAD
A7Z921      RTNIEF---S-SVQ-THLRSILV-TSSVPG-EGKSFSAANLAAVFA-QQ-EKKVLLVDAD
I2CAF2      RTNIEF---S-SVQ-THLRSILV-TSSVPG-EGKSFSAANLAAVFA-QQ-EKKVLLVDAD
A7Z9K0      RTNIEF---S-SVD-TEVKSLLI-TSAGPE-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
I2CB16      RTNIEF---S-SVD-TEVKSLLI-TSAGPE-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
I2HW53      RTNIEF---S-SVD-TEVKSLLI-TSAGPE-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
G9QKR4      RTNIQF---A-SAD-GELRSFMV-TSASQG-EGKSTTAANLAIVFA-QQ-GKRVLLVDSD
D5DBK3      RTNIQF---S-DAD-EEIKALLV-TSSGSA-EGKSTTASNLATVYA-QQ-GLKVLLIDAD
D5DY81      RTNIQF---S-GAD-EDIKSLVL-TSSGPS-EGKSTTAANLATVYA-QQ-GLNVLLIDGD
Q2BFS5      RTNIQF---S-SVD-QDVRSILV-TSSGPG-EGKSTTVANLAVVFA-QQ-NKRVLLVDAD
A4ITF3      RTNIQF---S-FID-EPLRSLMV-TSSAPS-EGKSTTAANLAVVFA-QQ-GKKTLLVDAD
C5D961      RTNVQF---S-FVD-KTMRSIMI-TSAGPG-EGKSTTTVNLAIVFA-QQ-GKKVLLIDAD
G8MZ93      RTNIQF---S-FID-APLRSLIV-TSTGPG-EGKSTTAANLAVVFA-QQ-GKKTLLIDAD
F0G6H5      RTTLQL---S-LPD-APNRIVLI-SGPTTG-VGKSYIASNLAALAA-AA-SQRVLLIDAD
F2I4B7      RTNIQF---S-MLD-KELKTFNV-TSPGPA-SGKSFLSANIAAAFA-SD-DKRVLLLDAD
Q74BQ8      KSAIVA---G-TSV-GEFRNTIMITSTLGG-EGKSITALNLAITLA-QEYDNTVLLIDAD
F0JCB8      KQSLVR---K-TKR-EGFQNTILVTSGTVG-EGKSVTAVNLAISLA-QEFDHTVLLVDAD
Q314L3      KERLVK---L-TKR-SGFQNMLMVTSALSR-EGKSLTSANLAISLA-QEFDHTVLLIDAD
B5EA81      KSALVK---M-TTG-DVFRNCLMVTSSIPS-EGKSLTALNLALSLA-QELDHTVLLVDAD
C6DZX5      KSALVK---M-TTG-DVFRNCLMVTSSIPS-EGKSLTALNLAISLA-QELDHTVLLVDAD
A1ARV8      KAILVK---M-TSV-HPFKNVLMVTSAIPN-EGKSLTSLNLAISLA-QEYDHTVLLLDAD
C6CW37      RTNIQY---S-SVD-APIQLLMA-ASAQSG-EGKSTVISNLAVAYA-LE-GKRVLLIDTD
G9RSY9      RTNLNF---M-AMG-KACKKLIF-TSAIPG-EGKSSVALNLAVSLA-ET-GSRVLVIDCD
B9Y884      RTNILM---R-NFD-RDMKVINI-ISTTAQ-EGKTTCVLNLAMVYA-QL-QKKVLVIDLD
A5Z5P9      RINVSF---L-G---NEIKKIMV-VSTMPN-EGKSFVTLQMWKQMA-SA-GIKSVFVDGD
Q1AUN8      RTGLLY---A-VVD-APPRVISL-TSPGPT-EGKSTVCANLGVVLA-QA-NKRTLLIDGD
F0SX22      RTNITF---C-LPS-GQCKIIGI-TSAEAE-EGKSITCINLALAFA-ET-KARVLIIDCD
B6W7H4      RTNIQF---S-DID-NKKRVIAM-TSSKPS-EGKTTVLYSIAKSFA-EN-GNSVVLLDFD
F0GT81      RTNIQF---S-SLD-NKNKVIAI-TSTKPS-EGKSTVIYNLAKSFA-QN-GERVILLDCD
B1R3X6      RTSLEY---S-SID-KELKSIVI-TSSEPG-EGKSTVAGNLASIIA-QN-DKKVIIIDCD
Q8XN76      RTSLEY---S-SID-KELKSIVV-TSSEPG-EGKSTVAGNLASIIA-QN-NKKVIIIDCD
B1BNK1      RTSLEY---S-SID-KELKSIVV-TSSEPG-EGKSTVARNLASIIA-QN-NKKVIIIDCD
B1V0N7      RTSLEY---S-SID-KDLKSIVV-TSSEPG-EGKSTVAGNLASIIA-QN-NKKVIIIDCD
Q0SVR8      RTNIQY---S-SFD-NPVKSIVI-TSSEPG-EGKSTTSANLALSFA-QD-GKKVILIDCD
B1BNH3      RTNIQY---S-SFD-NPVKSIVI-TSSEPG-EGKSTTSANLALSFA-QD-GKRVIIIDCD
Q8XN46      RTNIQY---S-SFD-NPVKSIVI-TSSEPG-EGKSTTSANLALSFA-QD-GKRVIIIDCD
B1V1Z4      RTNIQY---S-SFD-NPVKSIVI-TSSEPG-EGKSTTSANLALSFA-QD-GKRVIIIDCD
G5GFW0      RTNIQF---C-G---NNIHVIMI-TSSIPG-EGKTMTSFALARSFS-QI-GRKTLFIDAD
C2EFR6      RFNVEF---S-G---EKNQVFYI-TSTYPN-EGKSTVSLELALAFS-DN-GKKALLIDAD
F3ATF5      RTNIQF---A-G---MDVKTILF-TSCYPN-EGKSDITFQLSQEIG-KL-GKKVLLLDAD
D4M2S0      RTNMQF---S-G---VETKSIVL-TSCYPN-EGKSDVAFQLAVEIG-KM-GKRVLIIDAD
F4BS19      RTNIQF---S-MID-KELKTLMV-TSSKQG-EGKSTIAANLAVVFA-SQ-GKKVLLVDAD
D4CG08      RTNIQF---S-G---PDIKTVMF-TSAVPG-EGKSQITISEAMSLA-GL-GKKVLVVDAD
D4MP30      RTNIQF---S-G---PDIKTVMF-TSAVPG-EGKSQITVSEAMSLA-GL-GKKVLVVDAD
C6LCS5      RTNITF---C-G---KDCRVIAI-TSCTPN-EGKSNVSLNLAASLA-ET-GKKVLFIDAD
B0P2G2      KTNLAF---C-G---KDIKVITM-TSSVPN-EGKSSVSLSLSRTLA-ES-GKKILMVDAD
D4MW29      KTNLAF---C-G---KDIKVITM-TSSVPN-EGKSSVSLSLSRTLA-ES-GKKILMVDAD
E5VMX8      KTNLAF---C-G---KDIKVITM-TSSVLN-EGKSSVSLSLSRTLA-ES-GKKILMVDAD
D4JMC2      KTSISF---S-G---KGVKSILF-TSSVPN-EGKTTVVMDLARSMA-DS-KKSVLIVDTD
D6E0V4      KTSISF---S-G---KGVKSILF-TSSVPN-EGKTTVVMDLARSMA-DS-KKSVLIVDTD
D6E330      KTNIQF---C-G---DDIRTLLV-TSSVPN-EGKSTVALDLARSLT-ES-GNRVLFIDTD
C4Z8M5      KTNIQF---C-G---DDIRTLLV-TSSVPN-EGKSTVALDLARSLT-ES-GNRVLFIDTD
D4JI67      KTNIQF---C-G---DDIRTLLV-TSSVPN-EGKSTVALDLARSLT-ES-GNRVLFIDTD
D3AC80      RTNILF---S-G---HDTRVITL-TSSTPN-EGKSSLSFQLAISFA-EA-DNRVLFIDAD
G5IFS3      RTNILF---C-G---DNIKVIGL-TSSTPD-EGKTSVSVQLATSFA-EA-GKRVLLIDAD
D4RX67      RTNILF---S-G---SDVKCIAI-TSCLPG-DGKSTVSMNLAKSFA-EM-GKKTIFIDSD
A6BIG7      RTNIEF---S-G---ADKKVIVF-TSCIPN-EGKSTVTMGLAEALA-EG-EKRVLFIDAD
C0C0F8      RTNVEF---S-G---ADNKVIVF-TSCTPN-EGKSTVSLSLAQSLA-EG-GKRVLFVDAD
Q97EP8      RSNIQF---S-SFD-KDMQLILI-TSSGPG-EGKSTTSCNLALAMA-EA-GNSVLLLDCD
Q97ER5      RSNIQF---S-SFD-KDMQLILV-TSSGPG-EGKSTTSCNLALAMA-EA-GNSVLLMDCD
D2RIR2      RTNLQF---A-GAG-QDLKYICF-TSSVPG-EGKSTTISNMALTLA-QD-GKKVLLVDCD
G0VNK6      RTNLQF---A-GAG-KQLKTLVF-TSAIPG-EGKSTTVANLAIAMG-QD-DKKILLIDCD
I0GRR2      RTNLQF---A-GAG-KMIKFISF-TSATPG-EGKSTTISNVAIAMA-QD-GKRVLLIDAD
A0PZ02      RTNIQY---S-SFD-KELKTIIV-TSSGPS-EGKSTTSGNLALSMA-QS-DRKVLLIDCD
B1B736      RTNIQY---S-SFD-KELKTIIV-TSSGPS-EGKSTTSGNLALSMA-QS-DKKVLLIDCD
F6BI62      RTNLQF---T-SVD-KKVKSILI-TSSLPN-EGKSTIIKNLAYALA-MT-GVKVIVVDCD
Q8RBS5      RTNLQF---T-GID-KKVKSILI-TSSLPN-EGKSTVVKNLAYSVA-LT-GNKVVVIDGD
G2MWC2      RTNLQF---T-SVD-KKVKSILI-TSSLPN-EGKSTVVKNLAYSVA-LT-GSKVIVIDAD
B0K4N1      RTNLQF---T-SVD-RKVKSILI-TSSLPN-EGKSTIVKNLSYSVA-LT-GSKVIVIDAD
B0KAR5      RTNLQF---T-SVD-RKVKSILI-TSSLPN-EGKSTIVKNLSYSVA-LT-GSKVIVIDAD
E8UV29      RTNLQF---T-SVD-RKVKSILI-TSSLPN-EGKSTIVKNLSYSVA-LT-GSKVIVIDAD
C7ISF7      RTNLQF---T-SVD-RKVKSILI-TSSLPN-EGKSTIVKNLSYSVA-LT-GSKAIVIDAD
F7K9V1      RTNLEF---S-G---KDRKVISI-TSSTPN-EGKTSVSFQLALSIA-EG-GKKVVLVDAD
F7K8E9      RTNLEF---S-G---KDRRVISI-TSSTPN-EGKTSVSFQLAMSIA-EG-GKKVILVDAD
F7KL96      RTNLEF---S-G---KDRRVISV-TSSTPN-EGKTSVSFQLAISIA-EG-GKKVILVDAD
C9AAE5      RENVEY---L-CQQ-QEAQTILI-TSGESG-TGKSTVSANLAVAYA-QK-GNRTLLIDAD
H7F6C8      RTGIDF---S-GID-EKKQVILI-TSPESG-TGKSTVSSHLAVAYA-EK-GARTLLIDAD
H7F5T6      KTNIEM---M-NID-SKVKSLLI-TSPTQD-SGKTMISVNLASTYA-ND-GVKTLLIDLD
E6PYQ3      RTSISL---M-PVS-QKHRVIAL-TSGGPG-EGKSTTTLNLAVVLA-TQ-SKRVLLIDAD
C1J9I3      RTNIEF---A-GAALDRCQVVMF-TSSAMS-EGKSTVSANVAVTWA-QA-GKKVLLIDAD
B1MZT1      RTNIDF---A-SVAKGNVKTLLV-SSALPS-EGKSTITANLAVVYA-QQ-GKRVLLVDAD
Q03W95      RTNIEF---A-SVAKGEIKTLLI-SSALPS-EGKSTVTANLAVAYA-QQ-GKKVLLVDSD
B1R3V1      RTNIQY---S-SFD-NPVKSIVI-TSSEPG-EGKSTTSANLALSFA-QD-GKRVIIIDCD
I5B296      KNNILF---P-EKG-TPPKTIMV-TSASPH-EGKSFVAANLAVSIA-QSIDEYVLLMDCD
D4YF13      RTNIEF---A-QIG-SSVKSIAV-TSSISM-EGKSTTTVNLAYTYA-QT-GKKVLIVDTD
E6U7N4      RTNLDF---I-PID-EPCKKFLI-TSSIPE-EGKSTVSINLAITLA-ES-QKRVLLIDLD
C0QCJ2      KTTILF---P-KTG-IPPRTIMV-TSTAPG-EGKSFVASNIAISIA-KSIDEHVLLIDCD
F2I6Z7      RTNIQF---A-IDA-YHLKTLMF-TSSGPW-EGKSTIAANVATTMA-HLDGVRVLMIDCD
C2MBF8      RSNISF---L-APDNGAPVKRILVTSAIPG-SGKTFTSSNLALSLA-QS-GKRVLLIDCD
D3AE78      RTNITF---C-G---DAQRVILF-TSTIPN-EGKTSVVFQLARSFA-ED-GKRVLLLDAD
Q39U17      KSIILK---L-TNS-GQFKNTIMVTSAVSG-EGKTITSINLAVALA-QEFDHTVLLVDAD
B9M2X6      KSLLVK---L-TNG-DRFRNTLMVTSAFAS-EGKSITAINLAVSLA-QEFDHTVLLVDAD
A5G424      KSILVK---L-TKG-EHFQNTLMVTSSVGS-EGKSLTALNLAVSLA-QEYDHTVLLVDAD
E8WSZ5      KSMLVK---L-TDG-ENFKNAVMVTSSVPN-EGKSLTALNLAVSLA-QGLDHTVLLIDAD
C7LPS3      KEALVK---M-TKR-ERFDNLIAVTSSTAG-EGKSMTAVNLAASLA-GEYDHTVLLVDAD
C3WFM9      RTNLAF---Q-NDK-EIGRKIMV-TSSIPG-EGKSTLAGNYGASLA-IA-GKKVLLIDCD
D4YHG7      RTNIQF---S-MVD-HDFKSIMF-TSSGVW-EGKSTVTANTAAVMA-QQ-GLRVLLVDAD
A4J8V0      RTNIQF---A-AVD-KELKTLLI-TSSGPA-EGKSTTAANLGIAFA-QS-GKSVIIVDAD
A8U9F4      RTNIQF---S-MVD-KNLKTLVI-TSAGPG-AGKSTISANLAVTFA-MQ-GKKVLIVDAD
F4BSD9      RTNIQF---S-MVD-KNLKTLVI-TSAGPG-AGKSTISANLAVTFA-MQ-GKKVLIVDAD
F7V792      RINVSF---M-G---KKVRKIMV-TSTFPN-EGKSFIAQQLWRRMA-EA-GIDSVLVDAD
F6IR93      RTNLNY---A-MVG-KPLKTLMV-TSAIQG-EGKSTVAGNLAIEYA-KK-GLQVLLVDAD
G0M0F9      RTNLNY---A-MVG-KPLKTLMV-TSAIQG-EGKSTVAGNLAIEYA-KK-GLQVLLVDAD
F6ITB4      RTNINF---A-ASD-RKLRTLMV-TSAMLG-EGKSTVSGNLAVEYA-KE-GMQVLLVDAD
G0M1X9      RTNINF---A-ASD-RKLRTLMV-TSAMLG-EGKSTVSGNLAVEYA-KE-GMQVLLVDAD
G0LYN9      RTNINF---A-ATD-KNLRTLMV-TSAMLG-EGKSTVSCNLAVEYA-KE-GMQVLLVDAD
D7VC13      RTNINF---T-ATD-HKLRTLMV-TSAMLG-EGKSKVSGNLAVEYA-KE-GMQVLLVDAD
F9UMZ6      RTNINF---A-ATD-HKLRTLMV-TSAMLG-EGKSTVSGNLAVEYA-KE-GMQVLLVDAD
G7QCG1      KEALVK---A-IRDPDNFNNIILVTSAHHG-EGKSLLVVNLAISLA-QEFDHTVLVVDAD
I2Q341      KEALVK---A-IRDPDGFNNVILVTSAHHG-EGKSLLVVNLAISLA-QEFDHTVLVVDAD
H8YYB9      RTRILQ---R-LRA-NAWNAVAI-TSPRPG-CGKTLTSINLAISLA-REVNQTVLLVDLD
I5AV01      RANFLF---S-G---PEKKVIDV-TSCSEN-EGKSTVSMQLAISLA-QS-GKRTLLIDAD
B0GAL3      RTNIQF---A-GAD---IKTILV-TSCFPN-EGKSDVVFQLAKEMG-MA-GKKTVLLDAD
G1WUK2      RTNIQF---A-GAD---IKTILV-TSCFPN-EGKSDVAFQLAREMG-MA-GKKTVFLDAD
E0RZL3      RSNIEF---S-G---QNVKVVSV-TSCTPG-EGKTTVAMALARAFA-EA-GKKTVLVDAD
F0K0J7      RTNINF---M-NVD-REVKTIVF-TSAMAS-AGKSTVSANVAITMA-QA-GKKTILVDAD
Q1G8E4      RTNINF---M-NVD-REVKTIVF-TSAMAS-AGKSTVSANVAITMA-QA-GKKTILVDAD
D6S4X4      RTNINF---K-AID-HDINTLAF-TSAAIS-EGKSTVAANVAITYA-QS-GKKTLLIDGD
D0DJH0      RTNSNF---M-SVD-KEIHTLAF-TSANIS-EGKSTVTANVAITYA-QA-GRKTLLIDGD
C7XKF3      RTNINF---M-AVD-EEISTLAF-TSANIS-EGKSTVTANVAITYA-QA-GRKTLLIDAD
E3R264      RTNINF---M-AVD-EEISTLAF-TSANIS-EGKSTVTANVAITYA-QA-GRKTLLIDAD
D5GZJ8      RTNINF---M-AVD-EEINTLAF-TSANIS-EGKSTVTANVAITYA-QA-GRKTLLIDAD
C2EPK5      RTNINF---M-AVD-HDIKSVAF-TSANIS-EGKSTIAANVAITYA-QA-GRKTLLIDGD
A4ZGZ8      RTNINF---M-AVD-HDIKSVAF-TSASIS-EGKSTVAANVAVTYA-QA-GHKVLLIDAD
A8YX89      RTNINF---M-AVD-HDIKSVAF-TSASIS-EGKSTVAANVAVTYA-QA-GHKVLLIDAD
F0NWJ7      RTNINF---M-AVD-HNIKSVAF-TSANIS-EGKSTVAANVAVTYA-QA-GRKVLLIDAD
E4SMV5      RTNINF---M-AVD-HDIKSLAF-TSANIS-EGKSTVAANVAVTYA-QA-GRKVLLVDAD
F0TGY2      RTNINF---M-AVD-HDIKSLAF-TSANIS-EGKSTVAANVAVTYA-QA-GRKVLLVDAD
Q5FIC7      RTNINF---M-AVD-HDIKSLAF-TSANIS-EGKSTVAANVAVTYA-QA-GRKVLLVDAD
F2M2M6      RTNINF---M-AVD-HDIKSLAF-TSANIS-EGKSTVAANVAVTYA-QA-GRKVLLVDAD
G7M0Q3      RTNIQY---S-SFD-NEIKSLVI-TSAEMA-EGKSTVAENIALTFA-QG-EKRVLLIDCD
G7M1R9      RTNIQY---S-SFD-KQIRTIVV-TSAEAA-EGKSTVSGNLALSFA-QN-EKKVIIVDCD
A6M2L9      RTNIQY---S-SFD-KEIRTIAV-TSAEMA-EGKSTVAGNIAASFA-QN-EKKVILVDCD
G7M566      RTNIQY---S-SFD-KEIRTIAV-TSAEMA-EGKSTVAGNIALTFA-QS-DKKVILVDCD
E0NHP4      RTNIQF---S-SVD-KQLKSIVF-TSSAPS-EGKSTVSNNVAVTWA-DQ-GKSVLIVDAD
H1LCW3      RTNINF---S-AVN-QKLKTIIF-TSSAVS-EGKSTVSANLAVIWA-QQ-GQKTLFIDSD
C2JZS1      RTNIEF---A-GAALDKCQVIMF-TSSAMS-EGKSTVSANVAVTWA-QA-GKKVLLVDAD
Q58Z10      RTNIEF---A-GAALDQCQVVMF-TSSAMS-EGKSKVSANVAVTWA-QA-GKKVLLIDAD
G2KUP1      RTNIKF---S-IVA-NQNKVVSI-TSANPS-EGKSVFISNLACTFA-EQ-GEKTILIDAD
G8PE06      RTNIKF---S-AID-QKLKTIVF-TSSAPS-EGKSTVSNNVAVTWA-VQ-GRKILLVDAD
Q03GL8      RTNIQF---S-SVD-KALKSIVF-TSSAPS-EGKSTVSNNVAVTWA-DQ-GKRVLIVDAD
E9SAU1      RTNLSF---A-LST-KKNHIIAI-SSALAA-EGKSTVAANIAITLA-QN-NNSVLLIDGD
Q38VG5      RTNIQF---S-SID-QKLRSIVF-TSSGPS-QGKSTISANVAVTWA-DQ-GVNVLLVDAD
F0HVF1      RTNINF---M-NVD-KEVKTIAF-TSAMAS-AGKSTVSANVSITMA-QA-GKKTILIDAD
G6F8G9      RTNINF---M-NVD-KEVKTIVF-TSAMAS-AGKSTVSANVAITMA-QA-GKKTILVDAD
C2EWM3      RTNISF---M-GID-HPIKTLAF-TSANIS-EGKSTVTDNIAVVWA-NA-GKRVLLIDAD
F8DRU2      RTNINF---M-AID-KPIKTLAM-TSANVS-EGKSTVTDNVAVVWA-QT-GQRVLLIDSD
B3XL23      RTNINF---M-AID-KPIKTLAM-TSANVS-EGKSTVTDNVAVVWA-QT-GQKVLLIDSD
F8KGP1      RTNINF---M-AID-KPIKSLAL-TSANVS-EGKSTVTDNVAVVWA-QT-GQKVLLIDSD
H4GK03      KTNITF---M-GVD-HPIKALAF-TSSNIS-EGKSTVTANVGVTWA-QD-NKRVLMVDAD
B2GF33      RTNIHF---M-SVD-RPLKTVAF-TSSGIS-EGKSTVTANVAIAWA-QE-GKRVLLIDAD
C0WW26      RTNIHF---M-SVD-RPLKTVAF-TSSGIS-EGKSTVMANVAIAWA-QE-GKQVLLIDAD
D0DSJ4      RTNIHF---M-SVD-RPLKTVAF-TSSGIS-EGKSTVTDNVAIAWA-QE-GKRVLLIDAD
C0ZHV8      RLNIQF---S-MGD-KLMQTILV-TSPGAS-EGKTITAANLSLMMA-KD-HKKTVLLDFD
F8FCE2      RTNIDF---S-LVD-NDNKVIMV-TSTQQA-EGKTTTAVNMAVAYA-QT-EKKVLIVDAD
H6NE43      RTNIDF---S-LVD-NDNKVIMV-TSTQQA-EGKTTTAVNMAVAYA-QT-EKKVLIVDAD
I0BSG4      RTNIDF---S-LVD-NDNKVIMV-TSTQQA-EGKTTTAVNMAVAYA-QT-EKKVLIVDAD
Q83VF9      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-AGKSTVSANIAVAFA-QQ-GKKVLLIDGD
G8P3D7      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-AGKSTESANLAVAFA-QQ-GKKVLLIDGD
O06030      RTTIDF---K-MAD-QGIKSFLV-TSSETD-EGKTTVSANIAVAFA-QQ-GKKVLLIDGD
G9M880      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-AGKSTSSANIAVAFA-QQ-GKKVLLIDSD
G6FD42      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-AGKSTASANIAVAFA-QQ-GKKVLLIDGD
F9VC44      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-AGKSTASANLAVAFA-QQ-GKKVLLIDGD
A9QSJ4      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-TGKSTESANLAVAFA-QQ-GKKVLLIDGD
Q3ZK50      RTTIDF---K-MAD-QGIKSFLV-TSSEAA-AGKSNGSANLAVAFA-QQ-GKKVLLIDGD
E3GPC6      RTNITF---A-DID-EELRVLTI-TSTGKG-EGKSTIIANYAVALA-QS-KKKVLLIDCD
G0V447      RTNVQF---S-SVD-KNLKVILV-TSSGPS-EGKTTTAVNLALSFA-EL-NKKVLVIDCD
H7F1R7      RAGIHF---S-SAD-HKYKTILI-TSTEPE-SGKSTVSANLAVVYA-QH-GQKTLLIDAD
E3H7M5      RTNLYF---T-ES--KDRKVVLV-TSSIPK-EGKSTIAANYALSVA-IS-GEKVILVDCD
E6UHY4      RTNISF---A-LST-KKNKIFAI-SSALAS-EGKSTVAANIAITLA-QN-NNHVLLIDGD
D9QTC6      RTNIEF---L-SPD-DPLETMVI-TSSVPQ-EGKSITIANLAVSMA-EN-GQQVIVIDAD
D9SR41      RTNIQY---A-NID-GDLRSIII-TSSSPS-EGKSTTVANLAIATA-QT-GKKILIIDAD
E3HB18      RTNIHF------IDEKEKKTVVV-TSAIPK-EGKSFIAANYAMSEA-MV-GKKVLLLDCD
P95696      RSNIMF---S-KAN-GEVKRLLV-TSEKPG-AGKSTVVSNVAITYA-QA-GYKTLVIDGD
Q2G1K7      RSNIMF---S-KAN-GEVKRLLV-TSEKPG-AGKSTVVSNVAITYA-QA-GYKTLVIDGD
A8YPQ5      RSNIMF---A-NPD-SAVQSIVI-TSEAPG-AGKSTIAANLAVAYA-QA-GYKTLIVDGD
Q2FUV2      RSNIMF---A-NPD-SAVQSIVI-TSEAPG-AGKSTIAANLAVAYA-QA-GYKTLIVDGD
P39851      RSNIMF---S-NAE-NEIKSLLI-TSEKSA-SGKSILSANIAVTYA-QA-GYKTLIIDGD
C5QNG4      RSNIMF---S-RAK-DEIVSIIV-TSEKPA-AGKSIVSANIATTYA-QA-GYRTLIIDGD
Q4L9H7      RSNIMF---S-GV--EEANSIIV-TSEKPA-AGKSIVSANIAITYA-QA-GYKTLIIDGD
A7NQ71      RTNIQF---S-SLD-KPLHTLLA-TSTAPD-EGKSTTLANLAVTIA-QA-EQRVILVDCD
E4Q5T5      RTNIQY---S-SLD-KPIKTIVI-TSTGPS-EGKTITCANLAVVMA-QA-GSKVLVIDAD
E4SDX4      RTNIQY---S-SLD-KPIKTIVV-TSTGPS-EGKTVTCANLAVVMA-QA-GSKVLVIDAD
E4S7Y6      RTNIQY---S-SLD-KPIKSLVI-TSSGPS-EGKTITTANLAVVMA-QA-GSKVLVIDAD
C6CS80      RTNLQY---A-ETD-RPLQLLMV-TSAGPE-EGKSTTILNLAVTYA-QM-ERRTILVDAD
E6LD64      RTNIQF---A-STVDHEIKTIVV-TSSGAG-EGKSTTAANLAVVFA-NA-GQRVLLVDAD
F0EKB9      RTNIQF---A-SSADKQIKTIVV-TSSGPG-EGKSTTSANLAVVFA-KS-GQRVLLVDAD
H7F571      RTGIHF---S-SVD-TNYKTIMV-TSPEPG-SGKSTISANLAVCYA-KQ-GIRTLLIDAD
F5LE48      RTNIQY---S-SID-KEITTILV-TSAQPA-EGKSTTVSNLAITYA-QE-EKNVLLIDAD
E7RDR3      RTNINF---S-SPD-SEIRTMVV-TSAAPS-EGKSTTAANLAVVFA-QE-GKKVLLIDGD
E7RG08      RTNIHF---T-VPG-GKVRSLVV-TSASHL-EGKSTTSSNLAIVFA-QE-GKRVLLIDAD
G2FWX4      RTNIQF---R-SVN-SENNKIMI-TSAGRR-EGKSFTVANLAVSMA-QD-GKSVLVVDAD
G2FM59      RTNVQF---T-SVD-LDTQKIMI-TSSGPR-EGKSHTVANLAVSMA-QS-GKSVLIIDAD
G7WJV1      RTNVQF---T-NVD-SNTQKIVV-TSSGPG-EGKSHTVANLAVSMA-QS-GKSVLIIDAD
H5XZD4      RTNVQF---T-SVD-SDTQKIVV-TSSGPR-EGKSHTVANLAVSIA-QS-GKSVLIIDAD
H5XZG7      RTNVQF---T-SVD-SKTKKIMI-TSSGPR-EGKSTTAANLAVSIA-QS-GKSVLLIDAD
G7W773      RTNVQF---T-SID-TKTKRIMV-TSSGPR-EGKSTTVANLAVSMA-QS-GKSVLVIDAD
G2FWT8      RTNVQF---T-SVD-SETKKIMI-TSSGPR-EGKSSTVANLAVSIA-QA-GKSVIVVDAD
I4DBG8      RTNVQF---T-SVD-SQTKKIMV-TSAGPQ-EGKSSTVANLAVSIA-QT-GKTVLVVDAD
C0EBA6      RTNLSF---A-LAD-AKNKRVVI-TSSLPN-EGKSTTATNIAITLA-QT-GKKTLLIDAD
Q9K6R0      RTNIEF---A-AVD-RELKTIVV-TSSGPG-EGKSTTSANLAVVMA-QN-GHNVLFVDAD
I2HVL2      RTNIEF---S-SVQ-THLRSILV-TSSVPG-EGKSFSAANLAAVFA-QQ-EKKVLLVDAD
D4G1R2      ---------------------------MPG-EGKSFSAANLAAVFAQQQ-EKKVLLVDAD
G4EQZ7      RTNIEF---S-SVQ-TNLRSILV-TSSVPG-EGKSFSAANLAAVFAQQQ-EKKVLLVDAD
P71051      RTNIEF---S-SVQ-TNLRSILV-TSSVPG-EGKSFSAANLAAVFAQQQ-EKKVLLVDAD
E0U2Z3      RTNIEF---S-SVQ-TNLRSILV-TSSVPG-EGKSFSAANLAAVFAQQQ-EKKVLLVDAD
G4P114      RTNIEF---S-SVQ-TNLRSILV-TSSVPG-EGKSFSAANLAAVFAQQQ-EKKVLLVDAD
A9VRC3      RTNVEF---A-SVD-TNLHSLMV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2RG49      ---------------MNLHSLLV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2T8T6      ---------------MNLHSLLV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2MTG3      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2SSX8      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2YZB2      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C3GBJ8      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2SBU4      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2NQN6      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C3GRR0      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2PN22      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2Y452      ---------------------MV-TSANPS-EGKTTTTANIAVVFA-QQ-GKKVLLIDAD
C2WVG6      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C3EBC0      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2XJH9      ---------------------MF-TSANPS-EGKTTTTANIAVVFA-QQ-GKKVLLIDAD
C2P8H3      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2ULR6      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C2V4M2      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
C3H979      ---------------------MV-TSANPS-EGKTTTTANMAVVFA-QQ-GKKVLLIDAD
G2TR25      RTNISF---S-SVD-NDLQLLMV-TSSGPG-EGKSTIVGNLAVVFA-QQ-GKRVLLVDAD
P96716      RTNIEF---A-SVD-RQMKSVMI-TSACPG-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
G4EQF3      RTNIEF---A-SVD-RQMKSVMI-TSACPG-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
D4G2E1      RTNIEF---A-SVD-RQMKSVMI-TSACPG-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
I0F9R6      RTNIEF---A-SVD-RQMKSVMI-TSACPG-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
E0TTZ6      RTNIEF---A-SVD-RQMKTVMI-TSACPG-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
G4P1M7      RTNIEF---A-SVD-RQMKSVMI-TSACPG-EGKSTTAANLAVVFA-QQ-GKKVLLIDAD
A8FHL9      RTNIEF---T-SIQ-TRLKSILV-TSSLPK-EGKSFTAANLAAVFA-QQ-KKRVLLMDAD
Q5KUM5      RTNIQF---S-FID-APLRSLIV-TSTGPG-EGKSTTAANLAVVFA-QQ-GKKTLLIDAD
D3FZP4      RTNIQF---A-NMDGEEMRSILV-TSAGPG-EGKSTTIANLAIVLA-QQ-GKRVLLLDAD
I0JRK4      RTNLQF---A-SVD-KELETMIV-TSAGPS-EGKSLTTANVAVVFA-QQ-GKKVLLVDAD
I3EBB3      RTNIQF---S-SID-KEIRSLIV-TSPGPG-EGKTTTIANLAVVFA-QQ-GKTVLLIDAD
E3CP62      RTNIQF-------SGAQMKVISI-SSVEAG-EGKSTTSVNLAISFA-SVGL-RTLFIDAD
C2KHF1      RTNIEF---A-AVSRGEIKTLLI-SSALPS-EGKSTVSSNLAIVYA-QQGK-KVLLVDAD
I0UTA5      RTNLRF---V-NIDEPP-RSFLV-TSAVPS-EGKSTVSLSLARSMA-ESGQ-AVILIDAD
B7BDT8      RTNLEFILDA-KEDKDKASVTLI-TSFNPG-SGKTFLTMNTAATFA-MKGK-RVLVVDGD
G9WIQ9      RANIDF---A-AATINHFQTILF-TSSEMS-DGKSTVAQNLAVTWA-QTGK-RVLLVDAD
A0NKF6      RANIDF---A-AASLKNFKTVLF-TSAEMS-DGKSTAAQNLAVTWA-QTGK-RVLLLDAD
Q04DV8      RANIDF---A-AASLKNFKTVLF-TSAEMS-DGKSTAAQNLAITWA-QTGK-RVLLLDAD
F4SM97      RTSLHF---A-MMEARN-NILMI-SGASPN-AGKTFVSSNLAAIIA-QTGK-KVLFIDTD
G5Q4J0      RTSLHF---A-MMQAQN-NVLML-TGVSPS-IGKTFVCANLAAVIS-QTHK-RVLLIDCD
G5LQM6      RTSLHF---A-MMQAQN-NVLML-TGVSPS-IGKTFVCANLAAVIS-QTHK-RVLLIDCD
G5SDT8      RTSLHF---A-MMQAQN-NVLML-TGVSPS-IGKTFVCANLAAVIS-QTHK-RVLLIDCD
F3CAY9      RTSLHF---A-MLEARN-NVLMI-SSPTPG-AGKSFVSSNLATIIA-QTGR-RVLLIDAD
A3K8W7      RTRLMH---T-LSERGW-KRVAV-TSPGKG-CGKTFTVANLAISLS-RQENTRTLVMDFD
G7EJX6      RTSLLL---T-QLERDL-KVIAV-TSSSPG-EGKTTTSANLAMSLA-QMG--KVLIIDGD
B7B947      RTNMDF---M-RVKEKNMQVVMF-TSFNPG-AGKTFVSINLAMSFA-LT-HKKVVLVDLD
D3LB10      RANIDF---A-AASLKNFKTVLF-TSAEMS-DGKSTVAQNLAVAWA-QN-GKRVLLLDAD
S9QRP1      RTRLLQ---A-LAEHGWTRV-AI-TSPTKD-CGKTFTAANLAISLS-RQENCRTLLLDCD
G8AU96      RTMACM---P-RKRGTPPKVLLV-TSSIPK-EGKSVLAANLARSLA-GL-GLNTLLIDAD
A3W0H7      RTKLLA---A-LRANGWHRV-AI-TSPSPD-CGKSFVAANLAISLS-RQSSVRTVLMDMD
Q0FMP0      RTRLLQ---A-LAERGWTRV-AI-TSPTKD-CGKTFTAANLAISLS-RQQNCRTMLIDCD
                                            **:                   :..* *

E9TE88      MRKG-YT--HELLGTN--------NV-NGLSEILI-GQ-----GDITTAAKPT-SI-AKF
B8D0N2      LRKP-RL--HKILSIN--------PD-PGLSDILK-GQ-T---T-PTEVTRKYLNP-HEI
C2CI44      LRSP-SL--YEIAGIN-----D---N-VGVTNYLT-GK-V---SIQRAINKDR-DQ-ANL
C7RGH6      LRSP-SI--SEIAGIN-----D---N-VGITNYLT-GK-V---NIQRAINKDR-EQ-SNL
C0CK73      MRKS-YL--VRRLGIQ-----E--KI-QGVSEYLS-KQ-------SMKIVYRT-SD-PNL
Q1WTC8      LRKS-VS--RQLIRTG-----S--IE-MGLSDYLV-GR-A---Q-FDDVIAQS-NI-ENF
E8JWI5      IRNSKML--GGVFKSG-----E--KV-SGLTEYLA-RN-T---D-LSQGLCET-DE-ENL
F3AHH0      LRKS-ML--LGRTKIK-----G--TA-KGMTHFLS-GQ-V---E-IKDVLCST-NI-ENM
F7K0U1      LRKS-VL--AGRHRVQ-----G--EL-KGLSHFLS-GR-A---K-VEDVVCKT-QI-EGL
C4Z672      TRKS-VM--KNRWRKG-----K--IK-YGLTHYLS-GK-N---E-LTDVISVS-DE-PNF
P0C0T9      TRNS-VM--SGTFKAT-----G--TI-KGLTNYLS-GN-A---D-LGDIICET-NV-PRL
Q04663      TRNS-VM--SGTFKAT-----G--TI-KGLTNYLS-GN-A---D-LGDIICET-NV-PRL
Q67AY4      TRNS-VM--SGTFKAT-----G--TI-KGLTNYLS-GN-A---D-LGDIICET-NV-PRL
Q3K0T0      TRNS-VM--SGTFKAT-----G--TI-KGLTNYLS-GN-A---D-LGDIICET-NV-PRL
C5NWJ8      TRKS-VM--AGRFKFK-----H--KI-SGLTNYLS-GV-S---P-IEDVIYET-DV-EHL
F3A499      TRKS-VM--AGRFKFK-----H--KI-SGLTNYLS-GV-S---P-IEDVIYET-DV-EHL
Q4JZ55      LRNS-VM--SGMFHSR-----E--RI-TGLTEYLS-GK-A---G-MADSMQET-TL-DNL
G5JTD5      TRNS-VM--MGSFKPD-----G--PV-KGLTDFLS-GN-A---D-LQTTISRT-NI-PNL
G3G7C1      IRNS-VM--SGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSRGLCET-NI-PNL
G3G7J9      IRNS-VM--SGFFEPI-----T--KI-TGLTDYLA-GT-T---D-LSRGLCET-NI-PNL
G3G7G6      IRNS-VM--SGFFKPV-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G8DUB0      IRNS-VM--SGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G3G7I8      IRNS-VM--SGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G3G7J4      IRNS-VM--PGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G7SG34      IRNS-VM--SGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G8DTZ0      IRNS-VM--SGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G8DU07      IRNS-VM--SGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
A4VTU3      IRNS-VM--PGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
G8DU31      IRNS-VM--PGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
D5AGQ5      IRNS-VM--PGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
Q9X4U7      IRNS-VM--PGFFKPI-----T--KI-TGLTDYLA-GT-T---D-LSQGLCDT-DI-PNL
A3CQY2      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
E8KLY9      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-ENL
F0FHA8      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
F0I4H5      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
F0IAY3      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-ENL
F0IJI2      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-ENL
F0IS53      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
F2C9N0      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
F2CH53      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-ENL
F3SM32      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
F3UDW7      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-ENL
F3UNJ4      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
F0FQQ5      IRNS-VM--SGVFSSQ-----R--KV-SGLTDYLS-GQ-A---A-LHEVINDT-DL-DNL
D6R2T8      IRNS-VM--SGVFKSH-----G--KV-LGLTDFLS-GQ-S---D-VKAILNTT-DI-ANL
F3UUQ2      IRNS-VM--SGVFKSH-----G--KV-LGLTDFLS-GQ-S---D-VKAILNTT-DI-ANL
E6IZC2      IRNS-VM--SGIFKTR-----D--KI-TGLTDYLA-GA-T---D-LSNGLCET-NI-DNL
G6A745      IRNS-VM--SGVFKTR-----D--KI-TGLTDYLA-GA-A---D-LSNGLCDT-NV-ENL
A8AZR3      IRNS-IM--SGVFKSK-----E--KI-TGLTDYLV-GK-N---D-LSQGLCET-DV-PNL
F9HJP6      IRNS-VM--SGVFKSS-----A--KI-TGLTDYLS-GK-T---D-LSQGLCET-DV-KNL
Q4JYT9      IRNS-IM--SGVFKSR-----E--KI-TGLTDFLA-GT-T---D-LSHGLCDT-NI-ENL
Q4JZY1      IRNS-IM--SGVFKSR-----E--KI-TGLTDFLA-GT-T---D-LSHGLCDT-NI-ENL
E1LQJ7      IRNS-VM--SGVFKSR-----E--KI-TGLTDFLA-GT-T---D-LSHGLCDT-NI-ENL
F9HC65      IRNS-VM--SGVFKSR-----E--KI-TGLTDFLA-GT-T---D-LSNGLCDT-NI-DNL
E1LPE7      IRNS-VM--SGVFKSR-----E--RI-TGLTDYLA-GT-Q---D-LSNGLCET-NV-DNL
F9MJW5      IRNS-VM--SGVFKSR-----E--RI-TGLTDYLA-GT-Q---D-LSNGLCET-NV-DNL
E8KDN2      IRNS-VM--SGDFMSR-----E--KI-TGLTDYLS-GT-K---D-LSQGLCET-NV-ENL
E8K322      IRNS-VM--SGVFKSR-----E--KI-TGLTDYLS-GT-K---D-LSHGLCET-NV-ENL
F9PEU4      IRNS-VM--SGVFKSR-----E--KI-TGLTDYLS-GT-K---D-LSHGLCET-NV-ENL
F9PZP7      IRNS-VM--SGVFKSR-----E--KI-TGLTDYLS-GT-K---D-LSHGLCET-NV-ENL
C1CBD1      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSHGLCDT-NI-ENL
Q7WVX0      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSHGLCDT-NI-ENL
P96475      IRNS-VM--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q9AHD2      TRNS-VM--LGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K2Q7      TRNS-VI--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NT-ENL
Q4K0T5      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K0E1      TRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q9AH95      TRQS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K1M4      TRNS-VM--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4JZ18      TRNS-VM--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q54520      TRNS-VM--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4JYH5      IRNS-VM--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K0V2      TRNS-VM--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
A5M4L1      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSYGLCDT-NI-ENL
B2ILP5      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSYGLCDT-NI-ENL
C1CCB9      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSYGLCDT-NI-ENL
Q4K1S7      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSYGLCDT-NI-ENL
P72512      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSYGLCDT-NI-ENL
Q4JZ84      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K0X5      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSRGLCDT-NI-ENL
Q4K0Z6      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K195      TRNS-VI--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K0A0      TRNS-VI--SGVFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K0K2      TRNS-VI--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K1F9      IRNS-VI--SGFFKSR-----E--KI-TGLTEFLS-GT-A---D-LSHGLCDT-NI-ENL
Q4K045      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
G6C7Z1      IRNS-VM--SGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
D2ERX8      IRNS-VM--SGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
F9LZC4      IRNS-VM--SGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
F9P1W8      IRNS-VM--SGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-TI-ENL
I0J9C9      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
A6YIA8      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K005      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JZL7      IRNS-VM--LGVFKAR-----N--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
E5F5C5      IRNS-VM--LGVFKAR-----N--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JZG7      IRNS-VM--LGVFKAR-----N--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JZK1      IRNS-VM--LGVFKAR-----N--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
A5LJS0      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q9AHB7      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K1B7      IRNS-VM--LGVFKAR-----N--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JYK8      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K0M3      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
Q9AHA4      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q9X9A1      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q9ZII6      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q8KWQ0      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JZW7      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JYX9      IRNS-VM--SGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K0R7      IRNS-VM--SGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K1K6      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4JZS3      IRNS-VM--LGVFKAR-----D--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K0I2      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
Q4K254      MRNS-VM--SGVFKPR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K237      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
B1I967      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
G6J8A4      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q9ZFT8      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
D6ZQI8      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K2A8      MRNS-VM--SGVFKPR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q8VU31      MRNS-VM--SGVFKSR-----E--RI-TGLTEFLS-GT-T---D-LSQGLCDT-NI-ENL
Q4K2E1      IRNS-VM--SGVFRSS-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
Q4K2F7      IRNS-VM--SGVFRSS-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
A5YTV7      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
F9Q345      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
Q6L5R0      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
A5YTT9      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCET-NV-ENL
E6KKS0      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCET-NV-ENL
F2QF90      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCET-NV-ENL
E0Q2S8      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
A1ILY1      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCET-NV-ENL
Q6L5T0      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCET-NV-ENL
E9FEC5      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
E0PPH9      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
F5VSG9      IRNS-VM--SGVFKSR-----E--KI-TGLTEFLS-GT-T---D-LSQGLCDT-NV-ENL
E3CBS0      IRNS-VM--TGVFRSR-----D--KI-QGLTDFLS-GR-S---Q-LNQILYPT-DF-PNL
F9M366      IRNS-VM--TGVFRSR-----D--KI-QGLTDFLS-GR-S---Q-LNQILYPT-DF-PNL
E8K786      IRNS-VM--TGVFRSR-----D--KI-QGLTDFLS-GR-S---Q-LDQILYAT-DF-PNL
F8DFF4      IRNS-VM--TGVFRSR-----E--KI-QGLTDFLS-GQ-S---Q-LDQVLYTT-EF-PNL
I1ZPH7      IRNS-VM--TGVFRSR-----E--KI-QGLTDFLS-GQ-S---Q-LDQVLYTT-EF-PNL
E7S8W3      IRNS-VM--TGVFKSQ-----G--RV-AGLTEVLS-GK-S---E-ISQAIATT-DY-PKL
D0RXH2      IRNS-VM--TGVFKSQ-----R--KV-EGLTEVLS-GN-A---D-ISRALADT-DY-PNL
Q83YR5      IRNS-VM--TGVFKSQ-----R--KV-EGLTEVLS-GN-A---D-ISRALADT-DY-PNL
Q8GP54      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---DLLNETICQT-DI-SGL
F8HDC3      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---S-LGEVICET-DV-PGL
F8LJ75      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---S-LGEVICET-DV-PGL
E9DM17      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---T-LEETVCRT-DI-ASL
I0QIK6      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---T-LEETVCRT-DI-AGL
E8KUY8      TRNS-VL--SGTFKSN-----A--PY-KGLSNFLS-GN-A---D-LNETICQT-NI-SGL
Q7X553      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---V-LNETICQT-DI-SGL
Q8GP92      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q7X561      TRNS-VF--SGTFKTN-----E--PY-KGLSNFLS-GN-A---D-LNDRICQP-YI-SGL
Q7X549      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-G---D-LNETICQT-DI-SGL
G6ERT1      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
O87931      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q8GPF6      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q7X555      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLY-RN-A---D-LNETICQT-DI-SGL
Q7X557      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q7X563      LRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q8GMA5      TRNS-VF--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q8GPA8      TRNS-VF--SGTFKTN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q55205      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
C2LSE6      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q7X559      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-NI-SGL
F8LXJ4      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q1WCR1      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-DI-SGL
Q8GPC3      TRNS-VL--SGTFKSN-----E--PY-KGLSNFLS-GN-A---D-LNETICQT-NI-SGL
E8JMT9      TRNS-VM--SGTFKSN-----E--RY-QGLTSFLS-GN-A---E-LSDVICDT-SI-DNL
F5X0J9      TRNS-VM--SGTFKSN-----E--RY-QGLTSFLS-GN-A---E-LSDAICDT-SI-DNL
H2A602      TRNS-VM--SGTFKSK-----E--RY-QGLTSFLS-GN-A---E-LSDVICDT-NI-DNL
E0PD83      TRNS-VM--SGTFKSN-----E--RY-QGLTSFLS-GN-A---E-LSDVICDT-TI-DNL
F5X652      TRNS-VM--SGTFKSN-----E--RY-QGLTSFLS-GN-A---E-LSDVICDT-TI-DNL
G5KD11      IRNS-VM--SGTFKSD-----S--KY-EGLSSYLS-GN-T---E-LSKVIVST-NI-DKL
B9DUJ4      IRNS-VI--SGTFKAD-----E--KY-EGLSSYLS-GN-A---D-LSSVISHT-SV-ENL
G5KAJ2      IRNS-VM--SGTFKSD-----E--KY-EGLSSYLS-GN-A---D-LSHVISHT-NI-SNL
F1Z124      IRNS-VM--SGTFKAD-----E--KY-EGLSSYLS-GN-A---E-LSAVISHT-NI-ENL
Q2KM74      VRNS-VM--SGAFKSD-----D--RY-EGLSSYLS-GN-A---E-LSSVISRT-DV-PNL
C6LDI8      NRKS-TL--EYRYGVD-----R--TV-KGLSHFLA-GT-A---E-LRDVLCQT-NI-PYF
D4J4T6      LRKS-VL--YNRCMPD-----Q--EV-KGLSHYLA-GF-V---P-LNDVICKT-NI-KNM
D4LTH2      LRNS-VL--MKSVQVD-----V-SDK-KGLNHYLS-GL-A---E-YDEVVYKT-NI-ENA
D4LG06      LRKS-VQ--MQRMQVE-----NASET-KGLNHYLS-GM-A---E-YEDVVYKT-NI-ENA
A7VF42      LRKS-VI--KGRHNMK-----SESEI-KDLGYYLS-GQ-A---E-YEDVVYET-NI-PNA
A8SQS8      LRKS-VI--KERHHIN-----NTEKL-QDLGYYLS-GQ-A---E-IEDVVYET-QV-ENA
D5HFS4      LRKS-VI--KDRHHIK-----DADKL-PDLGYFLS-GQ-S---E-MEDVIYET-QV-ENA
C9LAS1      IRKS-AY--VSRYRIK-----Q--KV-NGLSQYLS-GQ-L---A-KEFLIYQT-NF-LNV
F3AH92      IRKS-VY--VKRYSVK-----Q--EV-KGLSQCLS-GQ-V---D-KEQITYQT-NF-ENV
I5ASF8      IRNS-QY--VSRFGVK-----Q--HV-LGLSEYLS-GQVD---E-VNQIFYQT-NY-DNL
E7GL81      VRKS-VL--VTRYKLD-----R--KI-EGLSQYLS-GQ-K---K-LEEVIYTT-NI-PNL
G5F9E2      VRKS-VL--VTRYKLD-----R--KI-EGLSQYLS-GQ-K---K-LEEVIYTA-NI-PNL
E7GL57      IRKS-IL--VTRYQLD-----R--RV-DGLSQYLS-GQ-K---K-LEEVVYKT-NL-PNL
G5F9A9      IRKS-IL--VTRYQLD-----R--RV-DGLSQYLS-GQ-K---K-LEEVVYKT-NL-PNL
E7GL40      IRKS-VL--VSRYHLE-----H--QV-DGLSQYLS-GQ-C---K-KEEVVYRT-NI-PNL
G5F9H2      IRKS-VL--VSRYHLE-----H--QV-DGLSQYLS-GQ-C---K-KEEVVYRT-NI-PNL
A8RK85      IRKS-VM--VKRYEIK-----G--NP-NGLSQYLS-GQ-K---S-LEEICYET-DM-ENL
G5HTB2      IRKS-VL--IKRYEIK-----G--NP-NGLSQYLS-GQ-K---S-LDEICYAT-DV-ENF
G5HNC5      IRKS-VI--VKRHEIQ-----G--NP-CGLSQYLS-GQ-K---T-AEEICYGT-DV-ENL
C0CZV9      IRKS-VL--VSRYQLE-----D--EV-CGLSQYLS-GQ-K---P-LEEIRYAT-SV-ENL
A8RSK9      IRKS-VL--VSRYQLE-----H--EV-PGLSQYLS-GQ-R---P-LEHVLYDT-NI-ENL
C5EN03      IRKS-VL--VSRYQLD-----T--EV-YGLSQYLS-GQ-K---T-LEEVLYDT-NV-ENL
G5HG45      IRKS-VL--VSRYQLE-----T--EV-YGLSQYLS-GQ-K---T-LADVLYDT-NV-ENL
D9ST44      FRNP-SL--HRQFNIP--------NR-KGLLGFLE-GNA----L-FSESVQKT-KV-SNL
G2Z8Q3      LRLP-SQ--HYILGVD--------NS-IGLTDILE-ETI----Q-SQNAIQKT-SL-YNV
C8W5K2      FRKP-GL--HTVFGQS--------NN-KGLVDIIL-GRL----P-LDLGLKNV-GI-DGL
A5V0I3      LRRP-SL--HTLFGLS--------ND-IGLTNMIL-AHN----D-APPPLQET-GV-PGL
F5LM71      LRKP-TA--HRTFGLS--------NR-TGLTDVLT-RQA----E-VEEALKET-DI-PGL
D7VBW4      LRRP-TI--HQTFAIS--------NQ-RGVSSWLS-GQLT---D-VNEAIYPV--L-DHL
F9UQ54      LRRP-TI--HQTFAIS--------NQ-RGVSSWLS-GQLT---D-VNEAIYPV--L-DHL
H6LKR8      LRLP-RI--GKIFDIS-----L--NQ-PGLSNMLV-DGL----I-FDSVLNKVKDL-EKF
E0I7B5      LRKP-SL--HRMFDLS--------NR-IGLTNLLA-GQF----H-LSEVEQAT-LV-DNL
D7UYE4      MRKP-TQ--HYQFNKS--------NI-EGLSKLII-KKS----D-FEKSILDT-GI-DNL
Q4A120      MRKP-TQ--HYIFNKN--------NI-KGLSNVII-NKS----T-FEDAVYST-EV-LNL
D9SVC7      IRKP-YI--HKLFSLP--------NK-TGLTTVLT-NQC----D-LMDAIQET-EV-DNL
C8VYQ6      MRKP-TQ--HKIFELS--------NI-KGLSNVLI-GEL----S-LMKGLLDV-GI-EGL
D9S1J9      LRRP-KL--YKLFLLE--------NY-KGLSNLLA-EDL----P-LDTVVNTT-KV-ENL
C0GGR5      LRNP-TM--HKIFNVR--------NN-VGITNLLL-NGSI---S-LEETL-VS-PR-PNL
B1HR41      MRKP-TL--HHTFYLD--------NV-FGLSSVLS-RQA----T-LQEVIQAT-FV-DGV
C6CSC8      MRKP-TA--HKTFQIS--------NR-FGLSSVIS-QQS----T-LQEVIQAT-DI-PNM
D6Y034      MRKP-TG--HFTFQLP--------NK-QGLSNVLA-KQA----S-LSSCVQES-QI-EGV
Q8EME8      LRKP-TI--HYTFRLD--------NL-RGLSNILV-GET----S-LRDAVESS-DV-ENL
F3Y922      MRNP-TI--AKTFELI--------NN-RGLSTLLS-NKTM---T-TEEVLQPT-NL-ENL
G4L594      LRKP-TI--HKTFQLN--------NE-AGLSTVLS-TGV----K-AGETAQKT-AV-ENL
C9B454      LRKP-VV--YETFQLN--------NA-SGLSTALS-SSG----S-VADEIQRT-PV-ENL
Q3XYS6      LRKP-VV--YKTFQLN--------NA-SGLSTALS-SLG----S-VVDVIQRT-PV-ENL
C9ALZ9      LRKP-VI--YKTFKLN--------NA-SGLSTVLS-SSG----S-VADEIQRT-PV-DNL
C9BUG7      LRKP-VV--YKTFQLN--------NA-SGLSTALS-SSG----S-VADVIQRT-PV-ENL
D4RJF4      LRKP-VV--YKAFQLN--------NT-SGLSTALS-SSG----S-VADVIQRT-PV-ENL
C8ZXT9      MRKP-TV--HKTFNLL--------NN-VGVSTVLS-TST----N-LAEAAQQT-VI-DNL
C9A6V5      MRKP-TV--YKTFSLN--------NA-SGLSTVLS-TST----S-VLEAAQKT-VI-DNL
C9CHY8      MRKP-TV--YKTFNLN--------NA-SGLSTVLS-TST----S-VLEVAQKT-VI-DNL
Q814Z0      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SI-DNL
B9IRQ6      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
A0RL70      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
Q6HB09      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
B7HFH1      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQKT-SV-DNL
B7IQS8      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----H-LEKCVQTT-SV-DNL
B3ZRD6      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
B5UQ73      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-LV-DNL
G9QCG3      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
Q3EV64      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
B7HXB4      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-YSE----R-LEKCVQTT-SV-DNL
Q72XH8      MRKP-AM--HQMFQVD--------NI-FGLTNVLT-HSE----R-LEKCVQTT-SV-DNL
Q5WBB4      MRKP-TA--HYTFGLM--------NN-RGLTNVLT-RQQ----K-QDDVIQET-NV-ENV
B1YMM5      MRRP-TV--HYTFRVA--------NG-LGLSSLLT-RQA----D-LGKAILPT-KV-DNL
D7WMM8      LRKP-TM--HYTFLLQ--------NA-RGLSNLLT-RHF----T-ISEVVNNT-DI-ANL
A7Z921      LRKP-TI--HETYQLE--------NV-QGLTNVLV-GNA----S-LGETVQKT-LI-DNL
I2CAF2      LRKP-TI--HETYQLE--------NV-QGLTNVLV-GNA----S-LGETVQKT-LI-DNL
A7Z9K0      LRKP-TV--HFTFKLD--------NG-TGLTSLLL-KQM----P-FQKAVLPA-DE-ANL
I2CB16      LRKP-TV--HFTFKLD--------NG-TGLTSLLL-KQM----P-FQKAVLPA-DE-ANL
I2HW53      LRKP-TV--HFTFKLD--------NG-TGLTSLLL-KQM----P-FQKAVLPA-DE-ANL
G9QKR4      LRKP-TM--HYTFRVT--------NT-VGLTNVLT-RQA----S-LVEAVQAT-DV-EKL
D5DBK3      LRKP-TA--HYTFRLE--------NH-AGLTNVLT-RQS----T-LGQGVQES-EV-PNL
D5DY81      LRKP-TA--HYTFRLE--------NH-TGLTNVLT-RQS----S-LGQAVQST-EV-PNL
Q2BFS5      LRKP-TA--HYTFNLT--------NN-NGLTNVLT-KSS----S-LLKAVKET-AI-ENL
A4ITF3      LRKP-TV--HYTFRLN--------NY-AGLTSVLT-NAS----P-LSSALQDT-SV-ENL
C5D961      LRKP-TV--HYTFRLN--------NY-MGLTNVLT-NSA----P-LLPSCQET-SV-ENL
G8MZ93      LRKP-TV--HYTFRLN--------NY-KGLTNVLT-GSA----P-LLPTCQAT-EI-DHL
F0G6H5      LRKG-AL--HDHFRYS---------RAPGLSDVVM-GT-H---R-LDEALKR--DVRPGL
F2I4B7      MRKP-TV--HKTFGVP-----N---D-RGLTNLLT-DS-R--LE-IHQVIKKS-YV-PNL
Q74BQ8      LRKP-MT--AQYLGIP---------GERGLSEYLS-VG-A---H-LPELLVRT-GI-GRL
F0JCB8      IRSP-SC--HELLCME---------NGYGLSDCLV-DG-S---P-IGKGLVKT-GI-GKL
Q314L3      LRGP-TC--HELLGVA---------RTPGLTDCLL-DG-T---D-VGEALVPT-GL-GRL
B5EA81      LRRP-SV--HRYLNVE---------QGVGLSELLT-GE-A---Q-VGETIIPT-GI-GKL
C6DZX5      LRRP-SV--HRYLNVE---------QGVGLSELLT-GE-A---Q-VSETIVPT-GI-GKL
A1ARV8      LRRP-SL--HRYLNIE---------RNVGLADCLT-RG-V---D-LGEAIIPT-GI-GKL
C6CW37      LRKP-TI--HRIFSQT-----N---R-QGLTNLLT-SQ-S---T-LQEVIKDG-GI-DNL
G9RSY9      LRKP-VI--HRYLKID-----N--SAYKGITSALA-DG-----S-LAESIINMKGL--GL
B9Y884      LRMP-TI--HKKLKLK-----N---K-KGISDIIG-HQ-A---E-FEEVVL--QPY-ENV
A5Z5P9      MRNS-VI--VNKYGIEKEDGSE---M-EGLAHYLA-EE-F---P-LENVVY-NTPL-EDG
Q1AUN8      LRRP-SL--HAVFDLR-----N---I-NGLVNAIT-GE-R---G-LSEVLS--EPL-PNL
F0SX22      LRRP-RI--SSLLSMP-----A---S-PGLSNVLV-SL-S---S-PDEVIH-TMSN-STA
B6W7H4      LRMP-KV--GKVAGIE-----T---N-MGLTNVIT-GK-V---E-LDRALIKDQYE-DNL
F0GT81      LRSP-SI--SEVSGIK-----D---N-VGLTNYLT-GK-V---S-LERAINADTSQ-DNL
B1R3X6      LRRP-TI--HKKFGIS-----N---S-IGLTEYII-GK-N---D-LNNVIQI--LN-ENF
Q8XN76      LRRP-TI--HKKFGIS-----N---S-IGLTEYII-GK-N---D-LNNVIQI--LN-ENF
B1BNK1      LRRP-TI--HKKFGIS-----N---S-IGLTEYII-GK-K---D-LNNVIQI--LN-ENF
B1V0N7      LRRP-TI--HKKFGIS-----N---S-IGLTEYII-GK-N---D-LNNVIQI--LN-ENF
Q0SVR8      LRKP-VV--HKEFQIS-----N---S-RGLSEFLI-GN-V---E-FSKVVYK--HE-SGL
B1BNH3      LRKP-VV--HKNFGIS-----N---S-VGLSEFLI-GK-V---E-FSKVVYK--HE-SGL
Q8XN46      LRKP-VV--HKNLGIS-----N---S-IGLSEFLI-GK-A---E-FSKVVYK--HE-SGL
B1V1Z4      LRKP-VV--HKNFGIS-----N---S-VGLSEFLI-GK-V---E-FSKVVYK--HE-SGL
G5GFW0      IRKS-VM--LTRYQVD----ID---V-YGLSQYLS-GQ-I---K-LEEVIY-STNI-EDM
C2EFR6      LRKS-VS--RQLIRTG----SI---E-MGLSDYLV-GR-A---Q-FDDVIA-QSNI-ENF
F3ATF5      IRKS-IL--ASRYGVG----KQ---V-QGLSNYLS-GQ-A---S-IAEIIY-RTNY-ENM
D4M2S0      IRKS-SY--IKRYQVK----QK---T-NGLSQYLS-GQ-I---S-LEEIIY-STNY-RNL
F4BS19      MRNP-SL--HKLFKVR-----N---Q-QGLTSILT-TK-N---R-QIANLLHKTSQ-ENL
D4CG08      IRKS-VL--LTRYQVE----QE---V-HGLTEYLS-GQ-R---Q-MEEVIC-TTDI-QGM
D4MP30      IRKS-VL--LTRYQVE----QE---V-HGLTEYLS-GQ-R---Q-MEEVIC-TTDI-QGM
C6LCS5      LRKS-VL--IGRLGVT----EK---I-VGLTNYIT-GQ-C---E-FKEIVC-TTNY-PSL
B0P2G2      LRKS-VM--AARYHIQ----GI---D-KGLSHYLT-GQ-A---E-VEDIIY-ETEV-EGL
D4MW29      LRKS-VM--AARYHIQ----GI---D-KGLSHYLT-GQ-A---E-VEDIIY-ETEV-EGL
E5VMX8      LRKS-VM--AARYHIQ----GI---D-KGLSHYLT-GQ-A---E-VEDIIY-ETEV-EGL
D4JMC2      MRKS-VL--VGRLRAKVESGGK---I-YGLSHYLS-GQ-V---S-LDKVVY-ATNI-KGV
D6E0V4      MRKS-VL--VGRLRAKVESGGK---I-YGLSHYLS-GQ-V---S-LDKVVY-ATNI-KGV
D6E330      MRKS-VL--AGRLRATAASGGE---I-CGLSHYLS-GQ-R---R-LEEVMY-GTEI-PGL
C4Z8M5      MRKS-VL--AGRLRATAASGGE---I-CGLSHYLS-GQ-R---R-LEEVMY-GTEI-PGL
D4JI67      MRKS-VL--AGRLRATAASGGE---I-CGLSHYLS-GQ-R---R-LEEVMY-GTEI-PGL
D3AC80      IRKS-VL--VGRYKAE----GN---K-FGLTHYLS-GQ-K---T-IDDVIC-NTDI-NNM
G5IFS3      IRKS-VI--LGRYRIN----KE---V-FGLTHYLT-RQ-R---G-KREVIY-NTNI-PGM
D4RX67      LRKS-VL--MGRYKIS----KS---I-GGLSHYLS-GM-Y---P-LEEVVC-TTNV-ENL
A6BIG7      LRKS-VL--VGRYKVT----GK---I-KGLTHFLS-GQ-S---D-AKDVIQ-KTQD-SNL
C0C0F8      LRKS-VL--MGRHKVN----GD---L-KGLSHFLS-GQ-S---E-VDDIIY-KTQE-PGL
Q97EP8      LRKP-SV--HKKFKIS-----N---N-IGLSNVLA-GQ-T---K-FESASH--WYN-QNL
Q97ER5      LRKP-SV--HKKFKIS-----N---N-DGLSNVLA-GH-T---K-FENASN--WYS-KNL
D2RIR2      LRKP-VQ--HKIFGVI-----N-----QGVTNCLA-QG-V---P-FAQVVH-PNVF-RNL
G0VNK6      MRKP-VV--HRRFGLL-----N-----RGLSNCFA-ED-L---P-LKEVIQ-ADVF-PNL
I0GRR2      MRKP-VQ--HKKFRLQ-----N-----KGLSNIIA-TG-E---S-LESMIQ-NNVI-QNL
A0PZ02      LRKP-TV--HKKFHIS-----N---E-KGLSNYLV-GE-V---P-FEEVVV--NYN-ENL
B1B736      LRKP-TV--HKKFNIS-----N---I-KGLSNYLV-GE-V---S-FEEVAV--KYN-ENL
F6BI62      LRNP-TV--HQMFKIP-----N---M-SGLTNIIV-ED-D---R-YEKYVISDKEF-DNL
Q8RBS5      LRNP-TV--HKSFNLP-----N---N-RGLTNLLI-DE-G---D-YEAYLNVDNSY-DNL
G2MWC2      LRNP-TV--HKTFNLP-----N---S-RGLTNLLI-DE-G---D-YEAYLNIDNSY-NNL
B0K4N1      LRNP-TV--HKTFNLS-----N---S-RGLTNLLI-DE-G---D-YEAYLNVDTSY-SNL
B0KAR5      LRNP-TV--HKTFNLS-----N---S-RGLTNLLI-DE-G---D-YEAYLNVDTSY-SNL
E8UV29      LRNP-TV--HKTFNLS-----N---S-RGLTNLLI-DE-G---D-YEAYLNVDTSY-SNL
C7ISF7      LRNP-TV--HKTFNLS-----N---S-RGLTNLLI-DE-G---D-YEAYLNVDTSY-SNL
F7K9V1      LRKS-VL--KGRYKTN-----A--AR-YGLSHYLS-GQ-A---S-ISDISCKT-NI-PDF
F7K8E9      LRKS-VL--KGRYKSN-----A--AR-YGLSHYLS-GQ-A---S-ISDIFCKT-NI-PNF
F7KL96      LRKS-VL--KGRYKSN-----A--SR-YGLSHYLS-GQ-A---S-ISDISCKT-NI-PNF
C9AAE5      LRKP-TQ--HYLFSQE-----M---H-VGLSNYIR-RD-I---S-IESCVQQVILEDCEF
H7F6C8      MRKP-TL--HKRFSKN-----L---H-LGLSNVMT-GD-I---S-LEDSIQEVELRASTL
H7F5T6      LRRP-SL--GFAIPIV-----K--AS-PGLTGILD-SS-Q-NLT-PEDVIVPV-TD-TNL
E6PYQ3      LRKP-TI--AQRLKMS-----A--TDQPGLSRYLS-DS-S--VL-PEDCVQRVTEI-PGL
C1J9I3      LRRP-TI--HATFRTL-----N--I--DGVTTILI--G-KD--E-AGAVVEET-FV-DNL
B1MZT1      LRRP-TV--AITFDVT-----D--N--HGLTNYLA-DA-HS--E-LGSIIHHT-RM-DTL
Q03W95      LRRP-TV--AVTFGLN-----K--NA-SGLTNYLG-DS-EK--E-VGSIIHRT-SM-DNL
B1R3V1      LRKP-VV--HKNFGIS-----N---S-VGLSEFLI-GK-V---E-FSKVVYKH--E-SGL
I5B296      LRSP-TI--HTSFGYS-----G--KE-QGLSDYLA-KN-I---P-LSSVLKKS-SV-NKL
D4YF13      LRKP-TL--HKTFKLN-----N---N-VGLTTALV-NE-EY--S-LESVIQYS-ED-FDL
E6U7N4      LRKP-TI--KKNLKLK-----D--VR-SGISSVLA-DQ-K---S-EDDCIVYL-SD-LNL
C0QCJ2      LRLP-SL--HTRFGFS-----D---I-PGLSEYLR-AG-K---S-LGSILRKT-AI-DKL
F2I6Z7      LRKP-TV--HKTFDIH-----S---R-KGLTTYLT-DR-D--VD-YMDVAQYV-AE-VNT
C2MBF8      IRKN-TL--SKAIGMH-----C--RGQLGLSSYLS-DA-R--IT-PEQIMSPSLQT-ESL
D3AE78      MRKS-VL--MGHYRVD-----Q--ET-RGLSHYLV-GQ-E---S-AENVAYRT-NI-DNM
Q39U17      LRRP-GT--SSYLGIR-----A---E-VGLSDCLY-GK-V---D-VKDALVKT-GI-GKL
B9M2X6      LRKP-SI--HKYFGFE-----P---K-LGLTDCLT-RG-I---D-VGETLIKT-GI-GKL
A5G424      LRKP-SI--HQYIGLD-----P---K-VGLAECLL-DG-V---D-VGEAIVNT-GI-GKL
E8WSZ5      LRRP-SL--HDYLEIE-----P---G-AGLSDILK-GE-A---D-IGETIVQT-GI-GKL
C7LPS3      LRRP-AV--HKYLGLG-----S---C-KGLSDCMR-EG-L---D-VGELLVKT-GI-GKL
C3WFM9      IRRP-RA--HESFGIK-----V---E-RGLESVLT-EN-V---N-PKDVIIKD-LI-PNF
D4YHG7      LRKP-TV--AKTFNIN-----T---T-VGLTSLLT-DR-DA--S-IMDTVNYV-AD-ANI
A4J8V0      LRKP-TQ--HKVWEID-----N---I-IGLTNILL-GD-T---E-IATALQPS-PM-KNL
A8U9F4      MRKP-TV--HKTFRLP-----N---R-DGLTTLLT-ER-D--VE-IKDIAHRL-ET-EGL
F4BSD9      MRKP-TV--HKTFRLP-----N---R-DGLTTLLT-ER-D--VE-IKDIAHRL-DT-EGL
F7V792      LRNS-TLADRCRMETD-----S--GQPMGLSHYLA-ND-C---E-LEDVLYAT-KT-EGA
F6IR93      LRRP-TV--HQTFGVP-----N---Q-RGLSSWLS-GQ-LE--D-VNDAIHPV--L-AHL
G0M0F9      LRRP-TV--HQTFGVP-----N---Q-RGLSSWLS-GQ-LE--D-VNDAIHPA--L-AHL
F6ITB4      LRRP-TI--HKTFGLK-----N---Q-KGLSSWLG-NQ-LD--D-VNDAIHPV--I-GNL
G0M1X9      LRRP-TI--HKTFGLK-----N---Q-KGLSSWLG-NQ-LD--D-VNDAIHPV--I-GNL
G0LYN9      LRRP-TI--HTTFGLE-----N---H-KGLSSWLA-NQ-MD--N-VNDAIHPV--I-GNL
D7VC13      LRRP-TI--HKTFGLK-----N---H-KGLSSWLA-NQ-LD--D-VNDAIHPV--I-GNL
F9UMZ6      LRRP-TI--HKTFGLK-----N---H-KGLSSWLA-NQ-MD--D-VNDAIHPV--I-GNL
G7QCG1      LRAP-TC--HRYLEVA-----P---E-RGLSDCLL-DG-L---D-VGQALINT-GI-GKL
I2Q341      LRAP-TC--HRYLEVA-----P---E-RGLSDCLL-EG-L---D-VGPALINT-GI-GKL
H8YYB9      LRRP-SV--IRYFTDA-----D---L-PGVSDYLL-EQ-R---E-LAEILVNP-GI-ERL
I5AV01      MRKS-VL--VGRTGVS-----G--KQIKGLAHALS-GQ-C---D-GVDVVYAT-DI-PNF
B0GAL3      IRKS-VL--VQRYLVD-----S--DV-KGLSQYLS-GQ-A---P-VRDILYGT-NY-ENM
G1WUK2      IRKS-VL--VQRYFVD-----S--DV-KGLSQYLS-GQ-A---P-VRDILYGT-NY-ENV
E0RZL3      MRKS-VL--VGRYKTG-----S--VR-LGLTHCLV-GR-ER----LSSVICET-DT-PNL
F0K0J7      LRRP-TM--HSTFNVS-----N---S-NGLTTLLT-SR-SMEMD-ANSVIRES-GV-ENL
Q1G8E4      LRRP-TM--HSTFNVS-----N---S-NGLTTLLT-SR-SMEMD-ANSVIRES-GV-ENL
D6S4X4      LRRP-TV--HSTFSLT-----N---R-RGLTSILT-SD-SNELN-LDEFTQDS-GI-ENL
D0DJH0      LRRP-TL--HSTFNVK-----N---N-TGLTTVLT-SE-ADEIN-LNDVVEES-GI-DNL
C7XKF3      LRRP-TL--HSTFNVK-----N---N-TGLTTVLT-SE-ADAIN-LNDVVEES-GI-DNL
E3R264      LRRP-TL--HSTFNVK-----N---N-TGLTTVLT-SE-ADAIN-LNDVVEES-GI-DNL
D5GZJ8      LRRP-TL--HSTFNVK-----N---N-TGLTTVLT-SE-ADEIN-LNDVVEES-GI-ENL
C2EPK5      LRRP-TV--HTTFNLS-----N---H-VGLSTVIS-SS-AKEVD-LDKVIQDS-GV-KNL
A4ZGZ8      LRRP-TV--HRTFNLS-----N---H-VGLSTVIS-ST-AKEVD-LDEVVQES-GI-DDL
A8YX89      LRRP-TV--HRTFNLS-----N---H-VGLSTVIS-ST-AKEVD-LDEVVQES-GI-DDL
F0NWJ7      LRRP-TV--HRTFNLS-----N---H-AGLSTVIS-ST-AKEVD-LDEVVQES-GI-DDL
E4SMV5      LRRP-TV--HSTFNLS-----N---H-VGLSTVIS-ST-AKEVD-LDSVVQES-GV-DNL
F0TGY2      LRRP-TV--HSTFNLS-----N---H-VGLSTVIS-ST-AKEVD-LDSVVQES-GV-DNL
Q5FIC7      LRRP-TV--HSTFNLS-----N---H-VGLSTVIS-ST-AKEVD-LDSVVQES-GV-DNL
F2M2M6      LRRP-TV--HSTFNLS-----N---H-VGLSTVIS-ST-AKEVD-LDSVVQES-GV-DNL
G7M0Q3      LRKP-SV--HVNFNVS-----N---L-VGISEVLL-GK-V---P-IEEAVQGY-N--EKL
G7M1R9      LRKP-SV--HKNFKVS-----N---L-KGLSEVLI-GK-E---E-LDNVVLKR-N--DNL
A6M2L9      LRKP-SV--HKNFKVS-----N---L-IGLSEVLL-GK-A---A-IEEAVQKR-N--DNF
G7M566      LRKP-SV--HKNFKAS-----N---L-VGISEILI-GK-V---S-IEEAVQKR-N--DNL
E0NHP4      MRRP-TV--HRTFRTS-----N---A-IGLSNLLA-GT-G---S-LDDAIHST-VV-ENL
H1LCW3      LRRP-TL--HTTFGLL-----N---T-NGLSTALS-TD-I---D-FNSVVQKT-EI-DNL
C2JZS1      LRRP-TV--HATFRKL-----N---L-DGVTTVLT-GK-T---K-PDEVVEDT-FV-DNL
Q58Z10      LRRP-TV--HATFRTL-----N---L-DGVTTVLT-GK-E---K-PDDVVEET-FV-DNM
G2KUP1      MRRP-TV--YKTFMVS-----N---Q-NGLSTYLS-GN-S---N-LDESILKT-DV-DNL
G8PE06      LRRP-TV--HRTFSQN-----N---A-KGLSTLLS-GN-V---D-MDTAIHET-PI-KDL
Q03GL8      MRRP-TV--HRTFSVS-----N---A-VGLSNLLA-ET-G---S-LENAIHET-II-NNL
E9SAU1      LRKP-VQ--HKVFNIK-----N---E-VGISSLIG-GL-N---S-FKEVVHAD-VI-ENL
Q38VG5      MRRP-TI--HQTFQVP-----N---K-KGLTSLLT-ED---EFD-FNTTIQKT-PV-EHL
F0HVF1      LRWP-TL--HSTFNVS-----N---S-NGLTTLLT-SR-SKEMD-ANSVIRKS-GV-ENL
G6F8G9      LRRP-TM--HSTFNVS-----N---S-NGLTTLLT-SR-SMEMD-ANSVIRES-GV-ENL
C2EWM3      LRRP-TL--HQTFNIS-----N---R-EGLTTILT-SD-ALEMD-ITNMIKET-EI-DNL
F8DRU2      LRRP-TL--HATFSKN-----N---Q-HGLTTILT-SG-TNSVD-LHEIIQPS-GV-NNL
B3XL23      LRRP-TL--HATFNKS-----N---Q-HGLTTILT-SG-TNSVD-LREIIQPS-GV-DNL
F8KGP1      LRRP-TL--HATFNKS-----N---Q-HGLTTILT-SG-TNSVD-LREIIQPS-GV-DNL
H4GK03      LRRP-TM--HSTFDLD-----N---R-QGLTTLLM-DQ-EHVIN-SQDVIQAT-EV-PNL
B2GF33      LRRS-TL--HATFGLS-----N---Q-KGLTTVLT-GD-SNEVD-LSNVVQKS-GV-ENL
C0WW26      LRRS-TL--HATFGLS-----N---Q-KGLTTVLT-GD-SNEVD-LSNVVQKS-GV-ENL
D0DSJ4      LRRS-TL--HATFGLS-----N---Q-KGLTTVLT-GD-SNEVD-LSNVVQKS-GV-ENL
C0ZHV8      LRNP-RV--HFTFDMP-----N---L-YGISSYFS-DM-C---Q-IPDIIQPS-GV-SEL
F8FCE2      MRRP-NV--HNMFRRP-----N---R-VGLSNLLA-GQ-Y---T-VQELVTET-HI-PHL
H6NE43      MRRP-NV--HNMFRRP-----N---R-VGLSNLLA-GQ-Y---T-VQELVTET-HI-PHL
I0BSG4      MRRP-NV--HNMFRRP-----N---R-VGLSNLLA-GQ-Y---T-VQELVTET-HI-PHL
Q83VF9      LRKP-TV--DITFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
G8P3D7      LRKP-TV--NLTFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RISENL
O06030      LRKP-TV--NITFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
G9M880      LRKP-TV--NITFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
G6FD42      LRKP-TV--NITFKVQ-----N---K-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
F9VC44      LRKP-TV--NITFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
A9QSJ4      LRKP-TV--NITFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
Q3ZK50      LRKP-TV--NITFKVQ-----N---R-VGLTNILM-HQ-S---S-IEDAIQGT-RLSENL
E3GPC6      LRRP-RI--HRLFEQP-----N---K-RGLTNILL-RE-C---E-PTEAIQTT-DV-ENL
G0V447      LRKP-TV--HKRFNLS-----N---Q-KGLTNLFV-ED-I---T-FEETVQRI-N--DNL
H7F1R7      MRKP-TG--HLTFRIR-----S---N-IGLSNLLA-SS-DL--A-AEEVCSQT-AI-ENL
E3H7M5      IRRP-RV--VDSFGIK-----A---N-YGLEEVLR-GK-K---N-LEDVILHN-VE-RNL
E6UHY4      LRKP-VQ--HRVFSLT-----N---D-LGLSTLIS-GT-N---T-FKEIVHHN-VI-DNL
D9QTC6      MRKP-MQ--HRIFEIT-----N---F-GGLSDLLT-GE-L---N-FAEGLQKT-NI-EGI
D9SR41      LRKP-SV--HKKFGIS-----N---Q-LGLTNVLT-EQ-C---E-IFSAIQKS-EV-RNL
E3HB18      LRRP-RA--HSTFGVE-----G---R-HGLSEVLM-GE-R---N-VEELIVKE-VE-KNL
P95696      MRKP-TQ--NYIFNEQ-----N---N-NGLSSLII-GR-T---T-MSEAITST-EI-ENL
Q2G1K7      MRKP-TQ--NYIFNEQ-----N---N-NGLSSLII-GR-T---T-MSEAITST-EI-ENL
A8YPQ5      MRKP-TQ--HYIFNLP-----N---N-EGLSSLLL-NW-S---T-YQDSIIST-EI-EDL
Q2FUV2      MRKP-TQ--HYIFNLP-----N---N-EGLSSLLL-NW-S---T-YQDSIIST-EI-QDL
P39851      MRKP-TQ--HYIFDLP-----N---N-SGLSNLII-NK-T---T-YSDSIKET-RV-ENL
C5QNG4      MRKP-TQ--NYIFEEA-----N---Y-DGLSNLII-GK-S---D-YDKAIRST-RV-PNL
Q4L9H7      MRKP-TQ--HYVFETS-----N---Y-DGLSNLIV-GK-S---D-FETAIRST-RV-ENL
A7NQ71      LRRP-SL--HTLFGLT-----N---D-VGLTTMIL-AQ-D---D-APPPLQDT-GV-PGL
E4Q5T5      LRRP-AI--HKVFGVS-----N---K-VGLTNLLV-EN-K---K-FEEIVQKD-GV-EGL
E4SDX4      LRRP-AI--HKVFGVS-----N---K-VGLTNLLV-EN-K---N-FEEIVQKD-GV-EGL
E4S7Y6      LRRP-AI--HKVFGVN-----N---R-FGLTNILA-EN-K---L-FEEVVQKD-GI-ENL
C6CS80      LRKP-TS--HYNFGLS-----N---R-TGLSHVLS-GQ-A---D-LSEVIKET-RI-KGL
E6LD64      LRKP-TV--HKTFHLQ-----N---N-VGFSNLLS-TK-E---T-MSNVIQAS-VV-PNL
F0EKB9      MRKP-TV--YKTFSLN-----N---A-SGLSTVLS-TS-T---S-VLEAAQKT-VI-DNL
H7F571      MRKP-TV--HRAFGIR-----V---N-IGLSNLLT-GD-V---E-YDEVFRET-EI-DNL
F5LE48      LRKP-TM--HKLFGIS-----N---R-SGLTNLLL-GE-A---P-VREVAIPS-HL-PNL
E7RDR3      MRKP-TT--HYTFRMG-----N---T-IGLSSVLT-RQ-S---S-IQEVIRAT-AV-ERL
E7RG08      MRKP-TM--HQTFKIS-----N---S-KGLSNVLV-RR-F---S-LKMAIQAS-GI-ENL
G2FWX4      LRNP-TQ--DKLFGLD-----N---G-KGLSVALT-QD-Q---D-ISQYIQET-SV-PGV
G2FM59      LRNP-TQ--HKLFGLD-----N---G-TGLSVSLV-QD-Q---D-YCNYIRET-DV-PGV
G7WJV1      LRNP-TQ--HKLFGLD-----N---R-VGLSIYLV-ED-G---D-YGGYIRDT-AV-PSV
H5XZD4      LRNP-TQ--HKLFGLD-----N---R-AGLSVYLV-ED-Q---D-YRKYIWET-VV-PGV
H5XZG7      MRNP-TQ--HKLFGLS-----N---M-EGLSVSLV-QD-Q---G-SHAFIKET-EV-PGV
G7W773      LRNP-TQ--HKLFELE-----N---F-EGLSNFLV-QD-D---Q-DKDFIRET-AV-PRV
G2FWT8      MRNP-TQ--HKLFGLD-----N---G-QGLSVALV-QD-Q---D-YRQYVQET-AV-PGV
I4DBG8      LRNP-TQ--HKLFGLP-----N---V-EGLSVALV-QD-Q---D-YINYARET-SV-SGL
C0EBA6      MRKP-TQ--YKIFRLT-----R---G-NGLSSLLG-GF-T---K-PENTIVED-VR-ENL
Q9K6R0      LRKP-TA--HYTFRAV-----N---T-RGLTRVLM-RQ-E---T-LEEAIQET-KV-ENL
I2HVL2      LRKP-TI--HETYQLE-----N---V-QGLTNVLV-GN-A---S-LGETVQKT-LI-DNL
D4G1R2      LRKP-TI--NQTFQVD-----N---V-TGLTNVLV-GN-A---S-LSETVQKT-PI-DNL
G4EQZ7      LRKP-TI--NQTFQVD-----N---V-TGLTNVLV-GN-A---S-LSETVQKT-PI-DNL
P71051      LRKP-TI--NQTFQVD-----N---V-TGLTNVLV-GN-A---S-LSETVQKT-PI-DNL
E0U2Z3      LRKP-TI--NQTFQVE-----N---V-TGLTNVLV-GN-A---S-LSETVQKT-PI-DNL
G4P114      LRKP-TI--NQTFQVE-----N---V-TGLTNVLV-GN-A---S-LSETVQKT-PI-DNL
A9VRC3      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-LV-DNL
C2RG49      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SI-DNL
C2T8T6      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SI-DNL
C2MTG3      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SV-ENL
C2SSX8      MRKP-AM--HQMFQVD-----N---I-VGLTNVLT-HS-E---R-LEKCVQTT-SV-DNL
C2YZB2      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQAT-LV-DNL
C3GBJ8      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-YS-E---R-LEKCVQTT-SV-DNL
C2SBU4      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-YS-E---R-LEKCVQTT-SV-DNL
C2NQN6      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SV-DNL
C3GRR0      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SV-DNL
C2PN22      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SV-DNL
C2Y452      MRKP-AM--HQMFQVD-----N---I-FGLTNVLS-LS-E---R-LEKCVQTT-LV-DNL
C2WVG6      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-LV-DNL
C3EBC0      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-LV-DNL
C2XJH9      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-LV-DNL
C2P8H3      MRKP-AM--HQMFQVD-----N---I-LGLTNVLT-NS-E---R-LEKCVQTT-SV-DNL
C2ULR6      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-NS-E---R-LEKCVQTT-SV-DNL
C2V4M2      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SV-DNL
C3H979      MRKP-AM--HQMFQVD-----N---I-FGLTNVLT-HS-E---R-LEKCVQTT-SI-DNL
G2TR25      LRRP-TV--HYTFGMT-----N---T-FGLTTVLT-KQ-G---T-LEETAVKT-DV-DHL
P96716      LRKP-TV--HTAFFLE-----N---T-VGLTSVLL-KK-S---S-MEQAVQAS-NE-KHL
G4EQF3      LRKP-TV--HTAFFLE-----N---T-VGLTSVLL-KK-S---S-MEQAVQAS-NE-KHL
D4G2E1      LRKP-TV--HTAFFLE-----N---T-VGLTSVLL-KK-S---S-MEQAVQAS-NE-KHL
I0F9R6      LRKP-TV--HTAFFLE-----N---T-VGLTSVLL-KK-S---S-MEQAVQAS-NE-KHL
E0TTZ6      LRKP-TV--HTAFHLE-----N---M-IGLTTVLL-KK-S---S-LEQAVQAS-NE-KYL
G4P1M7      LRKP-TV--HTAFHFE-----N---M-IGLTTVLL-KK-S---S-LEQAVQAS-NA-THL
A8FHL9      LRKP-AV--HEYFDLS-----H---H-TGLTNVLL-NN-C---S-LEEAILPT-PI-EHL
Q5KUM5      LRKP-TV--HYTFRLN-----N---Y-KGLTNVLT-GS-A---P-LLSTCQAT-EI-DHL
D3FZP4      LRKP-TV--HYTFQVD-----N---T-FGLTNVLT-KQ-H---T-LSEAVKET-KV-EEL
I0JRK4      LRKP-TV--HYTFRAD-----N---T-SGLSNYLV-RN-R---S-LKELAKES-RV-ENL
I3EBB3      MRKP-TV--HYTFNLM-----N---T-IGLTNVLT-RQ-M---D-LMEAVVQT-DE-KKL
E3CP62      TRNS-VL--SGTFKSN--------APYKGLSNFLS-GN-ADLNETI------CQTNISGL
C2KHF1      LRRP-TV--AVSFGLN--------RNSAGLTNCLGDSH-KEISDVV------HRTAMDNL
I0UTA5      LRRP-TL--AKKLNVD--------AKVG-LTQVLA-GQ-VDIAEAV------YQLEESNL
B7BDT8      LRHG-SA--SAYVGSP--------KKG--LSDYLG-KR-ENNCEDLIV----EKENYPGL
G9WIQ9      FRRP-TI--HKTFGLT--------NDRG-LTTVLA-MN-DQPAEII------NTSEQSNL
A0NKF6      FRRP-TL--HKTFAVP--------NEHG-LTTVLA-MH-EQPASAI------HSTEIPSL
Q04DV8      FRRP-TL--HKTFAVP--------NEHG-LTTVLA-MH-EQPASVI------HSTEIPNL
F4SM97      MRKG-YT--HKLFNKN--------NENG-LSDVLS-GK-IAFEKAI------KQIDTCGF
G5Q4J0      MRKG-YT--HELLGTN--------NVDG-LSDILA-GK-GEIASCA------KPTAIANF
G5LQM6      MRKG-YT--HELLGTN--------NVDG-LSDILA-GK-GEIASCA------KPTAIANF
G5SDT8      MRKG-YT--HELLGTN--------NVDG-LSDILA-GK-GEIASCA------KPTAIANF
F3CAY9      MRKG-YL--HRLFGLQ--------PKHG-LSDTLA-AR-LRCTEVI------HQTRVRHL
A3K8W7      MRRP-SL--HRVLGVD--------SPGP-IGDVLR-GK-LAPEDHLIRLGENDFNAGHNI
G7EJX6      LRKP-SI--AKRFDIP--------VFHPGLSNLIV-GT-EELTECV------HIDEQSGV
B7B947      IRKG-TL--SSHVQVS--------DMG--VTNYLS-GR-IDNVDEIIQKGE----LYDKL
D3LB10      FRRP-TV--HKTFAIS--------NERG-LTTVLA-MH-DQPASLIHSTEVPNLYVMAS-
S9QRP1      LRRP-SL--HRVLGVE--------PPGA-MGDMLR-GV-VPPEQHMLRMGPNTIHAGHNI
G8AU96      FRRP-SI--AKLLGYQ--------PHGS-VADLLD-GR-VGIDDLIHQETTNLGVLGNAV
A3W0H7      LRRP-SL--AHTLGQP--------DPGR-MAGFLS-GD-LPLERFLACPEDNPLHIGQTL
Q0FMP0      LRRP-SL--HKVLGVK--------NPGS-MGDVLR-GL-VPPEDHLIRMGENEIHAGRNI
             *                           .   .                          

E9TE88      DLIPRGQVPPNPSELLMSERFAELVNWASKNY--D--LVLIDTPPILAVTDAAIVGRHVG
B8D0N2      EIVPCGTREKKSAPIIDRLSFTRLLKDLSNNR--D--LVIVDSPPL-VISDSLSMAASVD
C2CI44      DLIFTGPVPPNPAEILASQVFKKFIEDLSEVY--D--YVFIDTPPVGLFTDASIVSTLCD
C7RGH6      DMIFTGPVPPNPAEILASNAFKDFVEDLSKQY--D--YVFIDTPPVGLFTDASLVSTISD
C0CK73      SIIFSGSYPPNPSELLSGIRFESLMETLRDAY--D--YIIVDAPPMGDLVDGAIISRQVD
Q1WTC8      SMIFSGPVPPNPSEILDGERFKHLIETVKEKF--D--IVIIDTPPMGSVIDAAVIAKNCD
E8JWI5      FVITSGQASPNPTALLQSERFTTMMSVLRRHY--D--YIIVDTPPIGMVVDATLIAKVCD
F3AHH0      HIAYAGPVPPNPAELLGSKRFHDLLVSLRKVY--D--YILIDTPPLGSVIDSAIVAEECD
F7K0U1      MVIFAGIIPPNPAELLGQERFGNLISSGRKVY--D--YIIIDAPPLGSVIDSAIIARVCD
C4Z672      CMIFAGPVPPNPSELVGNDRFAELIESARETF--D--MIIVDTPPIGSVIDAAVMSKFCD
P0C0T9      MVVPSGKVPPNPTALLQNAYFNKMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIASACD
Q04663      MVVPSGKVPPNPTALLQNAYFNKMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIANACD
Q67AY4      MVVPSGKVPPNPTALLQNAYFNKMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIANACD
Q3K0T0      MVVPSGKVPPNPTALLQNAYFNKMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIANACD
C5NWJ8      NVIPAGQVPPNPTGLLQNKNFNIMIEVFREYY--D--YVIIDTPPIGQVIDAAIIAPKTD
F3A499      NVIPVGQVPPNPTGLLQNKNFNIMIEVFREYY--D--YVIIDTPPIGQVIDAAIVAPKTD
Q4JZ55      YILQAGVVSPNPLSLLRSVKFETLIDSMKKYF--D--YIIVDTPPIGQVIDAAIIAQQCD
G5JTD5      TMIPAGQVPPNPTALFQSDNFKRMIEAVREHY--D--YVLLDTPPIGKVVDAAIIAQDCD
G3G7C1      TVIESGKISPNPTALLQSKNFENLLATLRRYF--D--YVVVDCPPLGMVIDAAIIAQKCD
G3G7J9      TVIESGKISPNPTALLQSKNFENLLATLRRYF--D--YVVVDCPPLGMVIDAAIIAQKCD
G3G7G6      TVIESGKVSPNPTALLQSKNFENLIATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
G8DUB0      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
G3G7I8      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
G3G7J4      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
G7SG34      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
G8DTZ0      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
G8DU07      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
A4VTU3      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVVDAAIIAQKCD
G8DU31      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
D5AGQ5      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
Q9X4U7      TVIESGKVSPNPTALLQSKNFENLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCD
A3CQY2      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
E8KLY9      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F0FHA8      DVILSGPVSPNPTGLLQSKQFDALLADLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F0I4H5      DVILSGPVSPNPTGLLQSKQFEALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F0IAY3      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F0IJI2      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F0IS53      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F2C9N0      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F2CH53      DVILSGPVSPNPTGLLQSKQFEALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F3SM32      DVILSGPVSPNPTGLLQSKQFEALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F3UDW7      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F3UNJ4      DVILSGPVSPNPTGLLQSKQFEALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
F0FQQ5      DVILSGPVSPNPTGLLQSKQFDALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCD
D6R2T8      HIILAGQPSPNPTGLLQSKNFEILLEALRTRY--D--YIIIDTSPIGLVIDAAIIAQKCD
F3UUQ2      HIILAGQPSPNPTGLLQSKNFEILLEALRTRY--D--YIIIDTSPIGLVIDAAIIAQKCD
E6IZC2      FVIEAGQVSPNPTALLQSKNFGIMIDILRNHY--D--YIVVDTPPIGLVIDAAIIAQKCD
G6A745      FVIEAGQISPNPTALLQSKNFGMMVDILRNHY--D--YIIIDTPPIGIVIDAAIIAQKCD
A8AZR3      FVIESGQSSPNPTALLQSKNFDEMMNILRRHY--D--YIIVDTPPIGLVIDAAIISQKCD
F9HJP6      FVIESGQSSPNPIALLQSKNFDIMMNILRRYY--D--YVIVDTPPVGLVIDAAIISQKCD
Q4JYT9      FVIQAGPVSPNPTALLQSENFATMIDTMRKYF--D--YVIVDTAPIGMVIDAAIITQKCD
Q4JZY1      FVIQAGPVSPNPTALLQSENFATMIDTMRKYF--D--YVIVDTAPIGMVIDAAIITQKCD
E1LQJ7      FVIQAGPVSPNPTALLQSENFATMIDTLRKYF--D--YVIVDTAPIGMVIDAAIITQKCD
F9HC65      FVIQAGPISPNPTALLQSENFHTMIDTLRKYF--D--YVIVDTAPIGMVIDAAIITQKCD
E1LPE7      FVIESGVSSPNPTALLQSDNFGIVIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCD
F9MJW5      FVIESGVSSPNPTALLQSDNFGIMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCD
E8KDN2      FVIQSGAISPNPTALLQSDKFETMIDTLRKYF--D--YIIVDTAPIGVVIDAAIIAQKCD
E8K322      FVIQSGAVSPNPTALLQSDKFEAMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCD
F9PEU4      FVIQSGAVSPNPTALLQSDKFEAMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCD
F9PZP7      FVIQSGAVSPNPTALLQSEKFEAMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCD
C1CBD1      FVVQSGAVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGVVIDSAIITQKCD
Q7WVX0      FVVQSGAVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGVVIDSAIITQKCD
P96475      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCD
Q9AHD2      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIIDTPPIGIVIDAAIITQKCD
Q4K2Q7      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K0T5      FVIQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K0E1      FVVQSGTVTPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCD
Q9AH95      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCD
Q4K1M4      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4JZ18      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q54520      FVVQSGTVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4JYH5      FVVQSGTVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCD
Q4K0V2      FVVQSGTVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
A5M4L1      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCD
B2ILP5      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCD
C1CCB9      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCD
Q4K1S7      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCD
P72512      FVVQSGPVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCD
Q4JZ84      FVIQSGSVSPNPTALLQSKNFNDMIETLRKYF--A--YIIVDTAPIGIVIDAAIITQKCD
Q4K0X5      FVIQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K0Z6      FVIQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K195      FVVQSGAVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K0A0      FVIQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCD
Q4K0K2      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K1F9      FVVQSGSVSPNPTALLQSKNFNDMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCD
Q4K045      FVIPAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
G6C7Z1      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITQKCD
D2ERX8      FVIQAGTVSPNPTALLQSKNLSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
F9LZC4      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGAVIDAAIITRKCD
F9P1W8      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGAVIDAAIITRKCD
I0J9C9      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITQKCD
A6YIA8      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4K005      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4JZL7      FVIQAGSVSPNPTALLQSENFTTMLETLRKYF--D--YIIVDTAPIGVVIDAAIITRNCD
E5F5C5      FVIQAGSVSPNPTALLQSKNFTTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCD
Q4JZG7      FVIQAGSVSPNPTALLQSKNFTTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCD
Q4JZK1      FVIQAGSVSPNPTALLQSKNFTTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCD
A5LJS0      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q9AHB7      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4K1B7      FVIQAGSVSPNPTALLQSKNFTTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCD
Q4JYK8      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4K0M3      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q9AHA4      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q9X9A1      FVIQAGSVSPNPTALLQSKNFTTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q9ZII6      FVIQAGSVSPNPTALLQRKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q8KWQ0      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4JZW7      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4JYX9      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4K0R7      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4K1K6      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4JZS3      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCD
Q4K0I2      FVIQAGSVSPNPIALLQSKNFSTMLGTLRKYF--D--YIVVDTAPIGIVIDAAIIMQKCD
Q4K254      FVIQAGSVSPNPTALLQSKNFSTMLGTLRKYF--D--YIVVDTAPIGIVIDAAIIMQKCD
Q4K237      FVIQAGSVSPNPTALLQSKNFSTMLGTLRKYF--D--YIVVDTAPIGIVIDAAIIMQKCD
B1I967      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIVVDTAPVGVVIDAAIIMQKCD
G6J8A4      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIVVDTPPVGVVIDAAIIMQKCD
Q9ZFT8      FVIQAGSVSPNPTALLQSKNFTTMLETLRKYF--D--YIVVDTAPVGVVIDAAIIMQKCD
D6ZQI8      FVIQAGSVSPNPTALLQSKNFSTMLETLRKYF--D--YIVVDTPPVGVVIDAAIIMQKCD
Q4K2A8      FVIQAGSVSPNPIALLQSRNFSTMLETLRKYF--D--YIVVDTAPVGVVIDAAIIMQKCD
Q8VU31      FVIQAGSVSPNPTALLQSRNFSTMLETVRKYF--D--YIVVDTAPVGVVIDAAIITQKCD
Q4K2E1      FVIQAGSISPNPTALLQSENFRTMIDTLRKYF--D--YIIVDTAPIGIVIDAVIVTQKCD
Q4K2F7      FVIQAGSISPNPTALLQSENFRTMIDTLRKYF--D--YIIVDTAPIGIVIDAVIVTQKCD
A5YTV7      FVVQAGSVSPNPTALLQSENFATMLDTLRKYF--D--YIIVDTAPIGVVIDAAIITQQCD
F9Q345      FVIQAGSVSPNPTALLQSENFKTMLDTLRKYF--D--YIIVDTAPIGVVIDAAIITQKCD
Q6L5R0      FVIQAGSVSPNPTALLQSENFKTMLDTLRKYF--D--YIIVDTAPIGVVIDAAIITQKCD
A5YTT9      FVIQAGSVSPNPTALLQSENFATMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQQCD
E6KKS0      FVIQAGSVSPNPTALLQSENFATMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQQCD
F2QF90      FVIQAGSVSPNPTALLQSENFATMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQQCD
E0Q2S8      FVIQAGSVSPNPTALLQSENFATMLDALRKYF--D--YIIVDTAPIGVVIDAAIITQKCD
A1ILY1      FVIQAGSVSPNPTALLQSENFATMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQKCD
Q6L5T0      FVIQAGSVSPNPTALLQSENFATMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQKCD
E9FEC5      FVIQAGSISPNPTALLQSENFATMLDTLRKYF--D--YIIVDTAPIGVVIDAAIVTQKCD
E0PPH9      FVIQAGSISPNPTALLQSENFATMLDTLRKYF--D--YIIVDTAPIGVVIDAAIVTQKCD
F5VSG9      FVIQAGSVSPNPTALLQSENFATMLDTLRKYF--D--YIIVDTAPIGVVIDVAIVTQKCD
E3CBS0      DIIESGQVAPNPTGLLQSKNFTVMMDALREHF--D--YIIVDTPPIGIVIDAAIIAQRCD
F9M366      DIIESGQVAPNPTGLLQSKNFTVMMDALREHF--D--YIIVDTPPIGIVIDAAIIAQRCD
E8K786      DIIESGQVAPNPTGLLQSKNFTVMMDALREHF--D--YIIVDTPPIGVVIDAAIIAQRCD
F8DFF4      DIIESGQIAPNPTGLLQSKNFTMMMEALRRHY--D--YIIVDTPPIGVVIDAAIIAQRCD
I1ZPH7      DIIESGQIAPNPTGLLQSKNFTMMMEALRRHY--D--YIIVDTPPIGVVIDAAIIAQRCD
E7S8W3      DVLLSGQVSPNPTGLLQSKNFEVIIEALRNHY--D--YIIVDTPPIGMVIDAAIIAQRCD
D0RXH2      DVFLSGQVSPNPTGLLQGKNFEVIMGVLREHY--D--YIVVDTPPIGMVIDAAIIAQRCD
Q83YR5      DVFLSGQVSPNPTGLLQGKNFEVIMGVLREHY--D--YIVVDTPPIGMVIDAAIIAQRCD
Q8GP54      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQAD
F8HDC3      HVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQY--D--YVIIDTPPIGLVIDAVIIAHQAD
F8LJ75      HVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQY--D--YVIIDTPPIGLVIDAVIIAHQAD
E9DM17      DVISSGPVPPNPTSLLQNENFTHLMDVARSQY--D--YVIIDTPPIGLVIDAVIVAHQAD
I0QIK6      DVISSGPIPPNPTSLLQNENFTHLLDVARSQY--D--YVIIDTPPIGLVIDAVIVAHQAD
E8KUY8      DVIASGPVPPNPTSLLQNDNFRHLMDVARSRY--D--YVIIDTPPIGLVIDAAIIAHQAD
Q7X553      DVIASGRIPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGMFIDAAIIAHQAD
Q8GP92      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGRVIDAVIIAHQAD
Q7X561      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPVGLVILAVIIAHQAD
Q7X549      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQAD
G6ERT1      DVIASGPIPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGMFIDAAIIAHQAD
O87931      DVIASGPIPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGMFIDAAIIAHQAD
Q8GPF6      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGRVIDAVIIAHQAD
Q7X555      DVISSGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAGIIAHQAD
Q7X557      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAGIIAHQAD
Q7X563      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGRVIDAVIIAHQAD
Q8GMA5      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQAD
Q8GPA8      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQAD
Q55205      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPVGMVIDAVIISHQAD
C2LSE6      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQAD
Q7X559      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQAD
F8LXJ4      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQAD
Q1WCR1      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQAD
Q8GPC3      DVIASGPVPPNPTSLLQNDNFRHLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQAD
E8JMT9      MIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLY--D--YVIIDTPPLGLVIDAAILAHHSD
F5X0J9      MIIPAGQVPPNPTSLIQNDNFKAMIETVRGLY--D--YVIIDTPPLGLVIDAAILAHHSD
H2A602      MIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLY--D--YVIIDTPPLGLVIDAAILAHYSD
E0PD83      MIIPSGQVPPNPTSLIQNDNFKAMIETVRGLY--D--YVIIDTPPLGLVIDAAILAHYSD
F5X652      MIIPAGQVPPNPTSLIQNDNFKVMIETVRGLY--D--YVIIDTPPLGLVIDAAILAHYSD
G5KD11      MVIPAGQVPPNPTTLLQNAHFNQMIETLRGIF--D--YIIIDTPPIGLVIDSAIVAQKAD
B9DUJ4      MVIPAGQVAPNPTTLLQNNNFNYMIDTLKEVF--D--YIIIDSPPIGLVIDAAIIGQKAD
G5KAJ2      MIIPAGQVPPNPTTLLQNNNFNYMIDTLREVF--D--YIIIDTPPIGLVIDSAIVAQKAD
F1Z124      MLIPAGHVPPNPTTLLQNSNFNFMIDTVKELF--D--YVIIDTPPIGLVIDSAIISQKAD
Q2KM74      MLIPSGQVPPNPTTVLQNSNFNFMIDTVKELF--D--YIIIDTPPIGLLIDSAIIAQKAD
C6LDI8      HIILSGAAAPNPSELLGNGKFSALLDGAREVY--D--YIFVDSPPIGSVIDAAVVAKQCD
D4J4T6      YMAFAGLNAPNPAELLGNPKFKAAIEAMKKSF--N--YIIVDCAPIGAVIDAAVVAKSVD
D4LTH2      SIVPCTQLLENPSPLLEDIRFRELLDKLATEY--R--FVIIDTPPLGSVSDGALIASMCD
D4LG06      YIVPCTQLLENPSPLLEDARFRELLDRLAGEY--R--FVIVDTPPLGSVSDGALIASLCD
A7VF42      YIVPCCNLLENPSALLEDARFAELLDKLAEQY--R--YVIIDSPPLGSVADAAQVASLCD
A8SQS8      YIVPCMNLLENPSALLEDARFAEILDKLAETY--R--YVIIDSPPLGSVADAAQIASLCD
D5HFS4      YIVPCMNILENPSALLEDARFAELLDKLAETY--R--YVIIDSPPLGSVADAAQIASLCD
C9LAS1      DIIFAGPMAPNPSELLEEEAFRELLAEVRGYY--D--YIIIDTPPVGSVIDAAIIAKESD
F3AH92      DIVFAGPIAPNPSELLSSKEFDDFLKEKKEQY--D--YIFVDTPPIGSMIDAAVVAEKSD
I5ASF8      FLIFSGAYASNPSEMLADESFGRLLAASAESF--D--YVFIDTPPLGQIIDAAQIGRFCD
E7GL81      DVIFSGPLSPNPAELLEEPLFKKLIDHAREEY--A--YVIIDTPPMSTIIDGAIVAGHCD
G5F9E2      DVIFSGPLSPNPAELLEEPLFKKLIDHAREEY--A--YVIIDTPPMSTIIDGAIVAGHCD
E7GL57      TMIFSGPYSPNPAELLAEPLFDKLVAWARENF--D--YVIIDTPPMGNLIDGAIISRNCD
G5F9A9      TMIFSGPYSPNPAELLAEPLFDKLVAWARENF--D--YVIIDTPPMGNLIDGAIISRNCD
E7GL40      NIIFSGPFSPNPAELLEGELFTKLIAWARECY--D--YILIDSPPMGSVIDGAVISRHCD
G5F9H2      NIIFSGPFSPNPAELLEGELFTKLIAWARECY--D--YILIDSPPMGSVIDGAVISRHCD
A8RK85      DMVLSGPFSPNPAELLEDELFKTMIESVKEIY--D--YIIIDTPPMANVIDGAIIASQCD
G5HTB2      DIILAGPYSPNPAELLEDSLFRELLEKAKERY--D--YIIIDTPPMANLIDGAIIANQCD
G5HNC5      DIILAGPYSPNPSELLEDPLFKELLDRARLKY--D--YIIIDTPPMANLIDGAIIASLCD
C0CZV9      HMIFSGPYSPNPAELLEEELFGALIRQMRQEY--D--YLIIDTPPMGNLIDGAIVARQCD
A8RSK9      SIIFAGPYSPNPAELLEESLFSDMISKLKEKY--D--YVIIDTPPMANLIDGAIVARQCD
C5EN03      SMVFAGPYSPNPAELLEEDLFGKMIDTLKKEY--D--YVIIDTPPMANLIDGAIVARQCD
G5HG45      SMVFAGPYSPNPAELLEEDLFEQMVQELKKTY--D--YVIIDTPPMANLIDGAIVARQCD
D9ST44      DIAMVGTKANNPSKLISSEKLKNLIEDLKETY--D--YIIIDTPPVTIATDAQLLSTYAD
G2Z8Q3      DLISAGQVPHNPSELLSKPILRKLLKEAKDYY--D--YILVDSPPVI-VADTTIISQQMD
C8W5K2      KLITTGSVPPNPVELISSNRTKEFISDLAEMF--D--IVLIDTPPVAPLTDAALMASNMD
A5V0I3      SLLASGPLPPRPADILGSRRMEAIIQRLRGMA--D--MVLFDTPPVIAVTDAAVLATRVD
F5LM71      YVMTCGTVPPNPSEILGSRRMTDLLERLKQEF--D--VILVDTPPVLAVSDAQVVATQCD
D7VBW4      FVMPSGPKPPNPAELLASDRMTEFLTVATRKL--D--LVIVDAPPILPVTDARILAGQVD
F9UQ54      FVMPSGPKPPNPAELLASDRMSEFLTVATRKL--D--LVIVDAPPILPVTDARILAGQVD
H6LKR8      EILTAGDRQVSPTELLNSDAFEQLIIACRKEY--D--IILIDTPPVLNFADASIVSKVAD
E0I7B5      TVIPSGPVPPNPSELLGSQKMKQLLAELKNQY--D--MILIDTPPNLAVPDGMIISANCD
D7UYE4      HLLTSGPIPPYPSELIGSVNFSLIFEELQKEY--D--FIVVDTPPVNTVTDAQLFAELAK
Q4A120      DVLTSGPIPPNPSELIGSSNMMDLFEELKQRY--D--FILIDTPPVNTVTDAQLFGELTK
D9SVC7      HILCGGKIETNSHQLIGSKKMSKLIDLVENNF--D--MVIIDGPPILLVTDSQLLANQVD
C8VYQ6      KLLPTGPTPPNPSELLGSQRMKNFIAELYEVF--D--IILVDTPPVVPVTDAALMAANVD
D9S1J9      HVITSGPVPPNPAEVLGSAKMKNFLDEVASLY--D--MVLIDAPPVNSVADAAILSTLVD
C0GGR5      YFLPCGPLPPNPAELLGSKKMRDFITSLEEHF--D--IILVDAPPALAVTDASVLASYLD
B1HR41      EIISSGAIPPNPTELLASETMTLLLHEVKERY--D--IVMIDAPPLLFLSDAQILSNKCD
C6CSC8      DVITAGPIPPNPAEMLASKRMTALLDELRTMY--D--IVLVDTPPLLAVTDAQIAATKSD
D6Y034      SVLTCGPIPPNPAELLGSKQMDTVLQEAEEMY--D--YIIIDSPPILAVTDAQLLAAKVE
Q8EME8      DLISCGPIPPNPSELLGSKRMQFFIEEAKQSY--D--IVIFDMPPVLAVTDAQVMSNFVD
F3Y922      NILPSGPIPPNPSELLDSLQMKRLIEEWKNNY--D--LIIFDTPPILAVTDAQILASKVD
G4L594      SILTSGPKPPNPSELLGSAKMNQIMEEARNIF--D--IVIFDMSPVVAVTDAQIMSSKAD
C9B454      SILPSGPKPPNPSELLSSPRMDQILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTD
Q3XYS6      SILPSGPKPPNPSELLSSPRMDQILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTD
C9ALZ9      SILPSGPKPPNPSELLSSPRMDQILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTD
C9BUG7      SILPSGPKPPNPSELLSSPRMDQILSEARQLF--D--VVIFDMPPVVAVTDAQIMSLKTD
D4RJF4      SILPSGPKPPNPSELLSSPRMDQILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTD
C8ZXT9      SILPSGPKPPNPSELLGSSRMNQVMAEAKKLY--D--IVIFDMPPVVAVTDAQIMASKAD
C9A6V5      SVLTSGPKPPNPSELLGSARMNQVMEEAKNLY--D--VVIFDMPPVVAVTDAQIMASKAD
C9CHY8      SVLTSGPKPPNPSELLGSARMNQVMEEAKNLY--D--VVIFDMPPVVAVTDAQIMASKAD
Q814Z0      SFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
B9IRQ6      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LIIFDLPPILAVTDAQIMANVCD
A0RL70      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANQCD
Q6HB09      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCD
B7HFH1      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
B7IQS8      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
B3ZRD6      HFLACGPIPPNPAELLGSKSMQELLAQAYSLY--D--LVIFDMPPILAVTDAQIMANVCD
B5UQ73      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
G9QCG3      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
Q3EV64      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
B7HXB4      HFLACGPIPPNPAELLGSKSMQELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCD
Q72XH8      HFLACGPIPPNPAELLGSKSMQELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCD
Q5WBB4      SLLTCGPIPPNPAELLNSKMMELVLQEAREKF--D--MVILDTPPVMAVADAQILANKVD
B1YMM5      SILTAGPIPPNPAELLSSKAMETLILKLRDEY--D--IIVLDAPPLLQVADSRITSKLTD
D7WMM8      YVLTSGPIPPNPAELLASTLMGSVMEELKKEF--D--IIIFDAPPLLSVTDAQILSNKCD
A7Z921      YVLTSGPTPPNPAELLSSKAMGELIQEMYSRY--S--LVIFDSPPLLAVADGQILANQTD
I2CAF2      YVLTSGPTPPNPAELLSSKAMGELIQEMYSRY--S--LVIFDSPPLLAVADGQILANQTD
A7Z9K0      DILTSGPIPPNPAELLSTGAMKDLLSEAAEVY--D--KVILDTPPVLAVADTKILGSYTD
I2CB16      DILTSGPIPPNPAELLSTGAMKDLLSEAAAVY--D--KVILDTPPVLAVADTKILGSYTD
I2HW53      DILTSGPIPPNPAELLSTGAMKDLLSEAAAVY--D--KVILDTPPVLAVADTKILGSYTD
G9QKR4      DLLSSGPIPPNPAELLSSRMMEQMLAEAYKQY--D--LVIFDSPPVLAVTDAQVLANQCQ
D5DBK3      YLLTSGPIPPNPAELLSSNQMTELLKEMKQEF--D--MVIFDTPPILAVADAQILASQVD
D5DY81      YVLTSGPIPPNPSELLASKQMGEVLGEMTERF--D--MVIFDTPPILAVADAQILANQVD
Q2BFS5      SVLTSGPIPPNPAELLGSQAMEEFLVNVQKEF--D--VVLFDTPPILAVADAQILANKVE
A4ITF3      TVLTAGPIPPNPAELLSSKMMDRLLRELNEMY--D--LVIFDTPPVLAVTDAQILANKCD
C5D961      YVLTSGPIPPNPAELLSSKAMEQCIQQLYNEF--D--LLIFDTPPVLAVTDAQILANQCD
G8MZ93      SILTSGPIPPNPAELLSSNAMAQCLEQLYETF--D--LVIFDTPPVLAVTDAQILANQCD
F0G6H5      DFLSMGSIVADPGEVLLQPALAELIERLSSQY--R--MIVIDGSPLLPVTDGLALGRLAG
F2I4B7      FYLTCGAIPPNPSELLASKRMQELMDQLRNVF--D--IIVLDCPPVLAATDAQVVSARVD
Q74BQ8      SILPAGKPAANPVELLSSQRMKDLLDEIRHRY--PDRYVIIDAPPALPFAEVRSLSNLVD
F0JCB8      SFLSAGSPVPNVGELLASKRMAESLAEMKNRY--ADRYIIIDSPPVLPFAESRNLSRLAD
Q314L3      SFLPAGRAVPNPGELFASTMMQDLLLQMKHRY--TDRYLIIDTPPVLPFSETRSLSRVVD
B5EA81      SIIRAGRAIENPAELFTSQRGKALLTELKLRY--PDRYIILDTPPVLPFAEARSLAHLVD
C6DZX5      SIIRAGRAIENPAELFTSQRGKALLTELKLRY--PDRYIILDTPPVLPFAEARSLAHLVD
A1ARV8      SVVTAGCAVSNPAELLSSARMKTFVEEIKHRY--TDRYIIFDTPPLLPFAETRSLAHLVD
C6CW37      EIITSGPTPPNPAELLGSHRMKVILEELRARY--D--LILFDTPPVLPVTDSLIMSSYCD
G9RSY9      HVMVADAIPPNPVELLGSPRMKNLIDELDKHY--E--YIIFDTPPVSVVTDAAVLSQYAD
B9Y884      DVITAGTKIPFASEFIQSNALKEFIEERKKEY--D--LILLDCPPVGLVTDGIVAASYCD
A5Z5P9      DIIPNVENIINPSMLLESDKFGNMLNQLAEDY--R--YVFVDAPPLGLVSDAEKIGSMCD
Q1AUN8      RVCTSGPVPPNPAELLSSNRFAALVEEARQGF--D--YVLIDSPPVEPVADPLILATHAD
F0SX22      DVILSGDIPPNPSELLASDQMRLLLEQLAKKY--D--YIFLDSPPINLVTDAVILSKWLT
B6W7H4      FVLLSGPVPPNPAEILASNHVKELIEELSQRF--D--YVFLDTPPVGLFTDASIVSTYCD
F0GT81      DIILTGPVPPNPAEVLASNVFKKLIEKLSSMY--D--YVLIDTPPVGLFTDASIVSTLSD
B1R3X6      SVITSGRIPPNPSEILSSKSMENLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCD
Q8XN76      SVITSGRIPPNPSEILSSKSMENLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCD
B1BNK1      SVITSGRIPPNPSEILSSKSMENLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCD
B1V0N7      SVITSGRIPPNPSEILSSKSMENLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCD
Q0SVR8      HVLPSGLVPPNPAEMLASRSMEHLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVD
B1BNH3      HVLPSGLVPPNPAEMLASRAMEHLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVD
Q8XN46      HVLPSGLVPPNPAEMLASRAMEHLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVD
B1V1Z4      HVLPSGLVPPNPAEMLASRAMEHLLTQLEEKY--D--YIILDTPPVNAVADSKILSTKVD
G5GFW0      DIIFSGRFAPNPAELLEEELFIQLIDRASKEY--D--YIIIDTPPMANVIDSAVIAKSCD
C2EFR6      SMIFSGPVPPNPSEILDGERFKHLIETVKEKF--D--IVIIDTPPMGSVIDAAVIAKNCD
F3ATF5      DIIFSGSFAPNPSELLGQEAFGTLLGAVREHY--D--YIIVDTPPIGSIIDAAIVAKQCD
D4M2S0      EIIFSGPYAPNPSELLEQGRFGRLIEETRKVY--D--YILIDTPPIISMSDAAIAAKQCD
F4BS19      ELLTSGILPPNPSELLASQRMSQFIETVKQEY--D--LIVFDLPPVNVVTDAQVMGNKSD
D4CG08      DIIFAGPYSPNPSELLAEPLFKELILKKREEY--D--YILIDTPPMAGITDGAIISTVCD
D4MP30      DIIFAGPYSPNPSELLAEPLFKELILKKREEY--D--YILIDTPPMAGITDGAIISTVCD
C6LCS5      HIIFPGPEPPNPAELLGSEAFSDMLGHMRENY--D--YVIIDTPPLGNVIDSAVIAKECD
B0P2G2      CITVAGPLTPDPTSILDSEQFEQFIENVRDMF--D--YVIIDAPPLGVVIDAVIIGKYTD
D4MW29      CITVAGPLTPDPTSILDSEQFEQFIENVRDMF--D--YVIIDAPPLGVVIDAVIIGKYTD
E5VMX8      CITVAGPLSPDPTSILDSEQFEQFIEKVRDMF--D--YVIIDTPPLGIVIDAVIIGKYTD
D4JMC2      FILFAGHEVPNPTELLETKEFKELIEFGEKNF--D--YVLVDTPPTGAAIDAAVVGKNVD
D6E0V4      FILFAGHEVPNPTELLETKEFKELIEFGEKNF--D--YVLVDTPPTGAAIDAAVVGKNVD
D6E330      FMIFAGPSVPNPTEILEKKYFQELLNFGKEHF--N--YIIIDCAPIGAAIDAAVVAKYCD
C4Z8M5      FMIFAGPSVPNPTEILEKKYFQELLNFGKEHF--N--YIIIDCAPIGAAIDAAVVAKYCD
D4JI67      FMIFAGPSVPNPTEILEKKYFQEILNFGKEHF--N--YIIIDCAPIGAAIDAAVVAKYCD
D3AC80      DMIFAGPVSPNPTELLSGDLFAELIQKAREEY--D--YVIIDAPPLGSVIDAALIARHVD
G5IFS3      DIIIAGPVSPNPTELLSGRLFEQLLQSERDNY--D--YIIVDAPPLGSVIDAAIIAKHID
D4RX67      DMILSGPVPPNPAELLGGKLLKEMITRLKKVY--D--YIIIDTPPLGNVVDSAIISSQCD
A6BIG7      HMIFAGAIPPNPAELLNSRRFQALLASARKLY--D--YVIIDAPPLGSVIDAAVIAKYCD
C0C0F8      MVIFSGVVPPNPAELLGNKRFSSFITSARKIY--D--YIIIDAPPLGSVIDSAIAAAVCD
Q97EP8      CILTAGKIPPNPAEMLSSKRMKAFLNEAKGVF--K--YIILDAPPVIAVTDPQILSTMVD
Q97ER5      CILTAGKIPPNPAEMLASKRMKAFLAEARGVF--K--YIILDAPPVIAVTDPQILSTMVD
D2RIR2      DVLTSGPVPPNPSELIGSEKMEQLLDRAGNAY--D--YVLIDLPPVLAVTDAALLGNLAD
G0VNK6      DVVTSGPVPPNPAELLGSKKMEALLQEAAETY--D--YVFLDMPPVLAVTDAALMSSRVD
I0GRR2      DVLPSGPVPPNPSEMLGSERMDNLLKTVGENY--D--YVFIDMPPILAVTDATIIGTKMD
A0PZ02      YLLPAGTIPPNPAEMVASKKMKKFLESLKENF--D--YIVIDTPPVIAVTDAQILSTIVD
B1B736      YLLPAGTIPPNPAEMVASKTMRNFLESLKETF--D--YIVLDTPPVIAVTDAQILSTVVD
F6BI62      GIITSGPIPPNPSELIGSNRMKVFLDRLKEDY--D--YVLLDAPPVLLVTDPTVLAPVVD
Q8RBS5      HILTSGPLPPNPTELLGSNKMKKLISLIRENY--D--YLFIDSPPVVTVTDAVVLAPVVD
G2MWC2      HILTSGPIPPNPAELLGSNKMKKLLSNIQKDY--D--YVFIDSPPVVTVTDAVVLAPVVD
B0K4N1      HILTSGPIPPNPAELLGSNRMKKLLSSIQENY--D--YVFIDSPPVVTVTDAVVLAPVVD
B0KAR5      HILTSGPIPPNPAELLGSNRMKKLLSSIQENY--D--YVFIDSPPVVTVTDAVVLAPVVD
E8UV29      HILTSGPIPPNPAELLGSNRMKKLLSSIQENY--D--YVFIDSPPVVTVTDAVVLAPVVD
C7ISF7      HILTSGPIPPNPAELLGSNRMKKLLSSIQENY--D--YVFIDSPPVVTVTDAVILAPVVD
F7K9V1      YVIFSGPVPPNPSELLGNDAFRLLLEYLRKEY--D--YVIVDTPPLGSVIDGAVAAQHCD
F7K8E9      YVIFSGPVPPNPSELLGNDAFGLLLEYLRKEY--D--YVIVDTPPLGSVIDGAVAARYCD
F7KL96      YVIFSGPVPPNPSELLGNDAFQLLLEYLKKEY--D--YVVVDTPPLGSVIDGAVAAQHCD
C9AAE5      SIITSGAIMSNPNDLLASSKMTAALQEVKQRY--D--VIIIDTPPVNVVSDALILAKKVD
H7F6C8      SILTSGPIPPNPNDLLSSKKMSELIEALRDSF--D--KIIIDTPPVTIVSDALVLADSAD
H7F5T6      YVLPVGARPLSPYSILNSAKLGQLIEQLKEIF--D--MIIIDTPPVMMVKDALLVSKWAE
E6PYQ3      DVMPVQEIPPFPSELLSQGRLEELLVWARDHY--D--YVLIDTPPILLVTDALIIANYCD
C1J9I3      SVITSGPIPPNPSELLNSKRMANLLNWARENY--D--IIVLDTPPVLAVSDVQVLVPKTD
B1MZT1      DVITSGPVPPNPAELLASARMTTLITQLRDHY--D--LVIFDVPPFLMVTDAQVLMSRMD
Q03W95      NVMPSGPIPPNPAELLGSGRMTNLITQLKTHY--D--MIIFDVPPFLMVTDAQVLMSKMD
B1R3V1      HVLPSGLVPPNPAEMLASRAMEHLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVD
I5B296      TILPAGQIPPNPSELLSSDQMRRLLHEVKLRY--NDRYIIIDTSPPYITSETNAIARFVD
D4YF13      YILPSGPIPPNPAELVGSQEFSVLLDQITELF--D--LVIFDTPPLHSVTDGQIISGKVD
E6U7N4      YVMTSGPIPPNPAELIGSDRMQHLIRRLEEKF--D--YILIDTPPVSVVTDAALASRLVH
C0QCJ2      SLLPAGKPPANPSELISSEQMRRLLQEVKGRY--EDRYIIIDSPPPYLTAEANALARQVD
F2I6Z7      YVIPAGPIPPNPAELLSSQRMSDLLEDVTAVF--D--LVIIDAPPLLPVTDAQIIASRTD
C2MBF8      IFLPSGPIPPNPTELLMSPRFEELLQYADEAF--D--YIVMDTIPVLNLADTRVISHLTD
D3AE78      DVIFAGPSTPNPAELLGNAKFEEMLRGAREHY--D--YVLIDSPPLGSVIDAAIIARNVD
Q39U17      VVLPAGSRVENPVELLSSGRMQSFIAEIKNRY--PDRYIIIDTPPLLSFAETYSLANMVD
B9M2X6      SILPYGKKVENPGELFSSSKMKSLIAEIKSRY--PDRYIIIDTPPVLLFAETRTISTIVD
A5G424      SVLLHGKTIRNPAELFSSLRMKELVKELKHRY--PDRYIIIDTPPVLPFAETRSISTLID
E8WSZ5      AVIRSGSQVENPVELFSSQKMRALVDELKRRY--PDRYLIFDTPPVLPFAESRALANIVD
C7LPS3      SVLPAGTPTPNPVELFSSDAMRSLFREMKIRY--GDRYIIVDTPPVLPFAETRSIASIVD
C3WFM9      DLLPTKHMRYNVTELFIGDKMKEVISSLENEY--N--TIILDMPPLAVASDAAILSKYVD
D4YHG7      YILAAGPIPPNPSELLGSNRMAELIGELEEMF--D--LVIFDTPPILAVTDAQVVATRVD
A4J8V0      HIVTTGPIPPNPAELLGSQRMTALLTSFREHA--D--IIIIDSPPIIAVTDAALLAPQAD
A8U9F4      FVITSGAIPPNPSELLASNRMNKLITEFEELF--D--LIIFDMPPVIAVTDAQVMSSKAD
F4BSD9      FVITSGVIPPNPSELLASNRMNQLMSEFEELF--D--LIIFDMPPVIAVTDAQVMSSKTD
F7V792      HIIPNLNNVVNPSILFEGDRMKSLLDELTKTH--R--YVFVDTPPLELASDGQLLGTLCD
F6IR93      FVMPSGPKPPNPAELLASDKMTEFLTVATRKL--D--LVIVDAPPVLPVTDARILAGQVD
G0M0F9      FVMPSGPKPPNPAELLASDKMTEFLTVATRKL--D--LVIVDAPPVLPVTDARILAGQVD
F6ITB4      FVMTSGPKPPNPAELLGSNKMTEFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVD
G0M1X9      FVMTSGPKPPNPAELLGSNKMTEFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVD
G0LYN9      FVMTSGPKPPNPAELLGSNKMTEFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVD
D7VC13      FVMTSGPKPPNPAELLGSNKMTEFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVD
F9UMZ6      FVMTSGPKPPNPAELLGSNKMTEFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVD
G7QCG1      VLLPAGKAVKNPMELLSSNSMRRLMTEIKQRY--RDRIILVDTPPVLLFAETRSLADVAD
I2Q341      VLLPAGKAVKNPMELLSSNSMRRLMTEIKQRY--RDRIILVDTPPVLLFAETRSLADVAD
H8YYB9      VLLPGHSSFTNSSEMLSTPRMVRLVTELKTRY--PDRIVLFDMPPLLAGDDVLAFSPYID
I5AV01      FMIYSGPFPPNPTELLGGKIFHSMLDSLRKVF--D--YIIIDTPPLGSVIDSAVIAGHCD
B0GAL3      DVIFAGPMAPNPSELLNGKVFAKLMIELKQRY--D--YVLIDTPPMANVVDAAIVGKVCD
G1WUK2      DMIFAGPMAPNPSELLNGRVFAKLMGELKQRY--D--YVLIDTPPMASVVDAAIVGKVCD
E0RZL3      YVIFSGPVPPNPSELLGGRIFSKALENMKQVF--D--YIIVDTPPLGSVIDAAVVAKQCD
F0K0J7      SILTAGPIPPNPSELLSSKHMLDLIEDLKQEY--D--MVVLDLAPILDAGETQQLTSSLD
Q1G8E4      SILTAGPIPPNPSELLSSKHMLDLIEDLKQEY--D--MVVLDLAPILDAGETQQLTSFLN
D6S4X4      SILTAGPIPPNPAELVGSKRMKTFIDLVRNYY--E--MVIIDLAPILEVSDTQELARKLD
D0DJH0      SILTSGPIPPNPAELIGSRRMETFIELVKSHY--D--MVIIDLPPVLEVSDTQELASHLD
C7XKF3      SILTSGPIPPNPAELIGSRRMETFIELVKSHY--D--MVIIDLAPVLEVSDTQELASHLD
E3R264      SILTSGPIPPNPAELIGSRRMETFIELVKSHY--D--MVIIDLAPVLEVSDTQELASHLD
D5GZJ8      SILTSGPIPPNPAELIGSRRMETFIELVKSHY--D--MVIIDLAPVLEVSDTQELASHLD
C2EPK5      SVLTAGPMPPNPSELISSKRMHDFIDLTEEHY--D--LVIIDLAPVLEVSDTQSLARHLD
A4ZGZ8      AILTAGPTPPNPSELIGSKRMQDFISLVEDHY--D--MVIIDLAPVIEVSDTQELARRLD
A8YX89      AILTAGPTPPNPSELIGSKRMQDFISLVEDHY--D--MVIIDLAPVIEVSDTQELARRLD
F0NWJ7      AILTAGPTPPNPSELIGSKRMQDFISLVEDHY--D--MVIIDMAPVLEVSDTQELARRLD
E4SMV5      YVLTAGPMPPNPAELIGSKRMRDFVKLTEERY--D--LVIIDLAPVLEVSDTQELASHLD
F0TGY2      YVLTAGPMPPNPAELIGSKRMRDFVKLTEERY--D--LVIIDLAPVLEVSDTQELASHLD
Q5FIC7      YVLTAGPMPPNPAELIGSKRMRDFVKLTEEHY--D--LVIIDLAPVLEVSDTQELASHLD
F2M2M6      YVLTAGPMPPNPAELIGSKRMRDFVKLTEERY--D--LVVIDLAPVLEVSDTQELASHLD
G7M0Q3      FVLTSGKIPPNPSEMLASLAMTYLIEKLKQDY--D--MIILDTAPLNLVTDAQILSAKVD
G7M1R9      DILTSGKIPPNPSEMLSSSSMTKLIEALRERY--D--IVILDSAPLQAVTDAQILSTKAD
A6M2L9      YFLTSGKIPPNPSEMLSSSAMSNLIERLKVEF--N--IVVLDTAPLKAVTDAQILSTKVD
G7M566      YFLTSGKIPPNPSEMLASSAMSNLIEELKKRY--D--FVVLDTAPIKAVTDAQILSTKVE
E0NHP4      SVMPSGPIPPNPSELLGSPKMVNLLGVLTTKF--D--LVIIDAPPVNTVTDAQVLAARAD
H1LCW3      SVITSGPIPPNPSDLLASNRMKELISYFKKIY--D--VIILDVPPLLSVTDTQIIAAQVD
C2JZS1      SVITSGPIPPNPSELLNSKRMGQLLDWTREKF--D--IIVLDAPPVLAVSDVQVLVPRSD
Q58Z10      SIITSGPVPPNPSELLNSKRMAGLLEWAREKY--D--IIVLDAPPVLAVSDVQVLVPKTD
G2KUP1      DVMVGGPVPPNPAELIGSDRFKNLLNTLSKDY--E--WVLIDTPPVNSATDASLIAAASN
G8PE06      SIMTSGPIPPNPSELLGSERMGEIMKSLSEKF--D--VVIIDAPPVNTVTDAQVLAARAD
Q03GL8      SVMPSGPIPPNPSELLGSGKMAALLDQLTDHY--D--LVIIDAPPVNTVTDAQVLAARAD
E9SAU1      DVVTCGPIPPNPSELMGSDNMKMLLEQLAAHY--D--YIIIDTPPINIVTDALTLLDTIA
Q38VG5      FVLPCGVVPPNPSELLNTKKMDKLIVELTKHF--D--LVIFDAPPVISVTDAQILASKVD
F0HVF1      SILTAGPIPPNPSELLSSKHMLDLIEDLKQEY--D--MVVLDLAPILDAAETQQLTSSLD
G6F8G9      SILTAGPIPPNPSELLSSKHMLDLIEDLKQEY--D--MVVLDLAPILDAGETQQLTSSLD
C2EWM3      SILTSGPIPPNPAELLNSQRMQALIASVEQSY--D--VVILDVPPILAVSDTQALVSHLD
F8DRU2      DILTAGPIPPNPAELLNSQRMKTLLDTVKGIY--D--MVIVDVPPMLEVTDTQILSRHLD
B3XL23      DILTAGPIPPNPAELLNSQRMRTLLDTVKGIY--D--MVIVDVPPMLEVTDTQILSRHLD
F8KGP1      DILTAGPIPPNPAELLNSQRMKTLLDTVKGIY--D--MVIVDVPPMLEVTDTQILSRHLD
H4GK03      DVLTVGPVPPNATGLLNSQRMRDLVATFEQMY--D--VVIIDVPPILEVNDTQVLSSMLD
B2GF33      EVLTAGPVPPNPSELLGSQRMKSLINGVRDAY--D--LVVLDVPPMLQVTDTQVLSGSLD
C0WW26      EVLTAGPVPPNPSELLGSQRMQSFINGVREAY--D--IVVLDVPPMLQVTDTQVLSSNLD
D0DSJ4      EVLTAGPVPPNPSELLSSQRMQSLIKGVREAY--D--LVVLDVPPMLQVTDTQVLSSNLD
C0ZHV8      SIITAGPIPHNPAEMLGTPRLLELMDYLRHSY--D--FVIVDSPPLI-VSDAMVLAREMD
F8FCE2      EMLSAGVIPHNPSELLSSERWVQFIEFAKNKY--D--VVIIDTPPALSLPDAQLVAGHSC
H6NE43      EMLSAGVIPHNPSELLSSERWVQFIEFAKNKY--D--VVIIDTPPALSLPDAQLVAGHSC
I0BSG4      EMLSAGVIPHNPSELLSSERWVQFIEFAKNKY--D--VVIIDTPPALSLPDAQLVAGHSC
Q83VF9      TIITSGPIPPNPSELLASSAMKNLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVG
G8P3D7      TIITSGPIPPNPSELLASSAMKDLIDSVSDFF--D--VVLIDTPPLSAVADAQILSSYVG
O06030      TIITSGPIPPNPSELLASSAMKNLIDSVSDFF--D--VVLIDIPPLSAVTDAQILSSYVG
G9M880      TIITSGPIPPNPSELLASSAMKNLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVG
G6FD42      TIITSGPIPPNPSELLASSAMKNLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVG
F9VC44      TIITSGPIPPNPSELLASSAMKNLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVG
A9QSJ4      TIITSGPIPPNPSELLASSAMKNLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVG
Q3ZK50      TIITSGPIPPNPSELLASSAMKNLIDSVSDSF--D--VVLIDAPPLYAVTDAQILSVYVG
E3GPC6      FMISSGPIPPNPSEILASKRLIELINQFKLAF--D--YILIDAPPVGVVTDAAVLSHVTD
G0V447      YVLTSGILPPNPAEMLSSSKFKSFIENLRQSF--D--VIILDTPPVIAVTDAQVLSTISD
H7F1R7      DILTSGTLPPNPNELLASKKMGQILEELASCY--D--QIIIDTPPILASSDALVLTSYVN
E3H7M5      DLLPATSFGENVTELFLGKKIVEILDGLKEKY--N--LIVLDTPPLTVATDAALLSTYAD
E6UHY4      DIVTCGPIPPNPSEMLGSDNMKQLLDQLSAHY--D--YIIIDTPPINIVTDCLTLLDSIA
D9QTC6      SLISGGNVPPNPAELLGSQKMEEVIKQAENKA--D--IVLIDSPPVIAVTDSRLLANKVD
D9SR41      YILASGPIPPNPSELLGSKKMQNLLDLLKSKF--D--MVIIDTPPVLAVTDSQILSTEVD
E3HB18      DLLPTKPMEQNVTELLQSKKMESLVEEVQEKY--D--LVVIDTAPLMVATDAAILSKISD
P95696      DLLTAGPVPPNPSELIGSERFKELVDLFNKRY--D--IIIVDTPPVNTVTDAQLYARAIK
Q2G1K7      DLLTAGPVPPNPSELIGSERFKELVDLFNKRY--D--IIIVDTPPVNTVTDAQLYARAIK
A8YPQ5      DVLTSGPIPPNPSELITSRAFANLYDTLLMNY--N--FVIIDTPPVNTVTDAQLFSKFTG
Q2FUV2      DVLTSGPIPPNPSELITSRAFANLYDTLLMNY--N--FVIIDTPPVNTVTDAQLFSKFTG
P39851      NVLTAGPTPPNPSELIASSKFATIFNELLNHY--D--FIVIDTPPINTVTDAQVYARIVK
C5QNG4      DLLTSGPIPPNPSELIDSDRFYEIYNELLRRY--D--FVLIDTPPVNTVTDAQVFLQYVK
Q4L9H7      DLLTSGPIPPNPSELIASEKFENILNDLFKYY--D--FILIDTPPVNTVTDAQVFMQYVK
A7NQ71      SLLASGPLPPRPADILGSRRMETVIQRLRTMA--D--IVLFDTPPVIAVTDAAVLATRVD
E4Q5T5      DLITSGPIPPNPAELLGSKKFENFLNTISQSY--D--YIIIDTPPCGSLTDAAIIGRIVD
E4SDX4      DLITSGPIPPNPAELLGSKKFENFLNTISQSY--D--YIIIDTPPCGSLTDAAIIGRIVD
E4S7Y6      DLLTSGPIPPNPAELLGSKKFENFLSYVRERY--D--YVIIDTPPCGSITDAAIVGRIVD
C6CS80      DVLPSGPVPPNPSELLGSSRMEELLGKLREQY--D--MVLIDTPPVLAVADAQVVANKCD
E6LD64      SLLTSGPKPPNPSELLSTARMDQLIRELRGAF--D--LVIFDMPPIVQVTDAQIMASKVD
F0EKB9      SVLTSGPKPPNPSELLGSARMNQVMEEAKNLY--D--VVIFDMPPVVAVTDAQIMASKAD
H7F571      FVLTSGTIPPNPNELLASKKMGKFMQQFIQDF--D--QVIVDTPPILASSDALVITPYVD
F5LE48      YLIPSGPSTPNPAEMLASKRMTQFIEQAKAEY--D--IVLIDSPPILAVTDAQILATKCE
E7RDR3      DLMTCGPIPPNPAELLASKSMDTLIAQLKNTY--D--LIIFDAPPVLSVTDGQILANKCE
E7RG08      DLLPSGPIPPNPAELLGSSNMDLLFESALDTY--D--MIIFDSPPVLSVTDSVILANKCE
G2FWX4      MVLTAGPVPLNPAELIGTVRMKQLVKEVSELY--D--MVLFDTPPIIAVTDGSILAQEVD
G2FM59      MVLPAGPVPPNPAELVGSKRMKLLIEEVSEQF--D--MILIDTPPVIAVTDAAILAQEVD
G7WJV1      RVLPAGPVPPNPAELLGSKGMEHLLEGAGGEF--D--MVLIDTPPVIAVTDALILAQEVD
H5XZD4      RVLPAGPVPPNPAELVGSKRMKCLIEEVSGEF--D--MVLMDTPPVIAVTDAAILALEVD
H5XZG7      SVLPGGPIPPNPAELVGSKRMKHLIEELSGQF--D--VVIIDTPPIIAVTDAAIIAQKVD
G7W773      KVLTGGPIPPNPAELVGSQRMKRLIEEVSELY--D--VVLIDTPPIIAVTDAAVLAQEVD
G2FWT8      MVLTGGPIPPNPAELVGSKRMKRLIEEFSEQF--D--TVLIDTPPIIAVTDAAIIAQEVD
I4DBG8      RVITGGPIPPNPAELVGSKRMKRLIEEASEQF--D--MVLIDTPPVVAVTDASILAQEVD
C0EBA6      DLITSGPIPPNPTELLSSSKMRELLEELNKTY--E--YIILDTPPINIVSDALALADICA
Q9K6R0      SLLTSGPIPPNPAELLNSKMMELIIKEVRDQF--D--IVIIDSPPLNAVTDAQILSSKCD
I2HVL2      YVLTSGPTPPNPAELLSSKAMGELIQEMYSRY--S--LVIFDSPPLLAVADGQILANQTD
D4G1R2      YVLTSGPTPPNPAELLSSKAMGDLISEIYEQF--S--LVIFDSPPLLAVADAQILANQTD
G4EQZ7      YVLTSGPTPPNPAELLSSKAMGDLISEIYEQF--S--LVIFDSPPLLAVADAQILANQTD
P71051      YVLTSGPTPPNPAELLSSKAMGDLISEIYEQF--S--LVIFDSPPLLAVADAQILANQTD
E0U2Z3      YVLTSGPTPPNPAELLSSKAMGDLISDIYEQF--S--LVIFDSPPLLAVADAQILANQTD
G4P114      YVLTSGPTPPNPAELLSSKAMGDLISDIYEQF--S--LVIFDSPPLLAVADAQILANQTD
A9VRC3      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVVFDLPPILAVTDAQIMANVCD
C2RG49      SFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C2T8T6      SFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C2MTG3      HFLACGPIPPNPAELLGSKSMQELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCD
C2SSX8      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCD
C2YZB2      HFLACGPIPPNPAELLGSKSMQELLAQAYSLY--D--LVIFDLPPILAVTDAQIMANVCD
C3GBJ8      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANLCD
C2SBU4      HFLACGPIPPNPAELLGSKSMQELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCD
C2NQN6      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANQCD
C3GRR0      HFLACGPIPPNPAELLGSKSMQELLAQAYSLY--D--LVIFDMPPILAVTDAQIMANQCD
C2PN22      HFLACGPIPPNPAELLGSKSMQELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCD
C2Y452      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDLPPILAVTDAQIMANVCD
C2WVG6      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C3EBC0      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C2XJH9      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C2P8H3      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C2ULR6      HFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
C2V4M2      SFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDLPPILAVTDAQIMANVCD
C3H979      SFLACGPIPPNPAELLGSKSMKELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCD
G2TR25      HVLTSGPIPPNPAELLSSKAMKEFFKEAKEQY--D--IILLDTPPVLAVTDAQVLTNQCD
P96716      DVLTSGPIPPNPAELLSSKWMKELAYEACAAY--D--MVIFDTPPILAVADAQILGNVAD
G4EQF3      DVLTSGPIPPNPAELLSSKWMKELAYEACAAY--D--MVIFDTPPILAVADAQILGNVAD
D4G2E1      DVLTSGPIPPNPAELLSSKWMKELAYEACAAY--D--MVIFDTPPILAVADAQILGNVAD
I0F9R6      DVLTSGPIPPNPAELLSSKWMKELADEASVAY--D--MVIFDTPPILAVADAQILGNVAD
E0TTZ6      DVLTSGPIPPNPAELLSSKWMKELADEACAAY--D--MVIFDTPPILAVADAQILGNVAD
G4P1M7      DVLTSGPIPPNPAELLSSKWMNELADEVCAAY--D--MVIFDTPPILAVADAQILGNVAD
A8FHL9      ELLPSGTIPPNPAELLSSSVMKQLFYEIEQQY--E--MVIVDSAPLLPVADAKILANRTD
Q5KUM5      SILTSGPIPPNPAELLSSNAMAQCLEQLYETF--D--LVIFDTPPVLAVTDAQILANQCD
D3FZP4      HVLTCGPIPPNPSELLSSKAMADLLEDAFQYY--D--YVLLDTPPTLAVTDAQILANLTD
I0JRK4      DLLPSGPIPPNPSELLGSTMMEKLIEEAKEHY--D--MIIFDTPPVLAVADSQVLSKFVD
I3EBB3      YVLPSGPIPPNPAELLGSKAMDEFLERVYEEF--D--VVLFDTPPILAVTDAQIMANRCD
E3CP62      DVIASGPVPPNPTSLLQNDNFRHLMDVARSRY--D--YVIIDTPPIGLVIDAAIIAHQAD
C2KHF1      DVITSGPIPPNPAELLGSGRMTELVTQLKSQY--D--LIIFDVPPFLMVTDAQVLMSKVD
I0UTA5      FVLTAGRIPPNPSELLGSDKMRQLVRELSEEF-----VVVLDAPPLLPVTDASLLSYAVD
B7BDT8      FVLPVGTIPPNPTELLAEPRLAELIEKMRCRF--D--YILIDCPPVDIVADTQIIEKLAD
G9WIQ9      FIMTSGPMPPNPSELLASDKMVQIIDWMRRNF--D--LVVIDSTPLLLVPDAQSLIPRSD
A0NKF6      YVMTSGPMPPNPSELLASDKMLRVVSWMREQF--D--MVVIDSTPLLLVPDAQALIPRAD
Q04DV8      YVMTSGPMPPNPSELLASDKMLRVVSWMREQF--D--MVVIDSTPLLLVTDAQALIPRAD
F4SM97      DYISRGSVPPNPAELLMHRRLNELLIWANSQY--D--IVILDTPPILAVTDAAIIGQYVG
G5Q4J0      DLIPRGQVPPNPSELLMSERFGELIAWASSRY--D--LVLIDTPPILAVTDAAIVGRHVG
G5LQM6      DLIPRGQVPPNPSELLMSERFGELIAWASSRY--D--LVLIDTPPILAVTDAAIVGRHVG
G5SDT8      DLIPRGQVPPNPSELLMSERFGELIAWASSRY--D--LVLIDTPPILAVTDAAIVGRHAG
F3CAY9      DFMSCGFAAPNPSELLMHDNFNKMLAELSPLY--D--LILIDTPPILAVTDATLVGRQAG
A3K8W7      AFGLNTVTEAYASELLQDPRTRVTLDRIEEELRPD--VVLFDLPPALSYDDVIAFQPLFD
G7EJX6      AIMPSGQIPGNPLELLSNIRFSELLELLKAKY--D--HIIIDTPPTQAVSDALVIAQSAD
B7B947      DIIHAGPVPPNPAELLLSDRLEALIAELRERY--D--YIILDNVPAGVVADAVIVNRVAD
D3LB10      -----GPMPPNPSELLSSDKMLKVINWMKEQF--E--MVVIDSTPLLLVPDSQALIPRSD
S9QRP1      AFGFNTESEPYASELLQDPRTAATLDDLQTRFAPD--VMLFDLPPALFYDDVIAFRPLFD
G8AU96      G-------TPDAHDRISSQAMSDLIQWARHNY--D--VVVIDSAPVMLFSDALALSFLAD
A3W0H7      AMGLNDRAEPYAAEILHAPETGEVLQDMYRRLAPD--VVIFDMPPALYYDDVLGFRPQFD
Q0FMP0      AFGFNGTVEPYASELLQSPQSRTALRHIEDEFAPD--VMLFDLPPALYYDDVMAFRGQFD
                           .                      :..*  *               

E9TE88      TTLMVARYAVNTLKEVETSLS-----RF-EQNGIPVKGVILNSIFRRA------------
B8D0N2      GVILVVSIGESNKRGFRDGLK-----ML-ENAEANLLGIVANKIPHKQ--------KE--
C2CI44      GVIFVIKSSDTKKEDITLALD-----NL-KKVDAHILGAVLTYVPMKD--------KR--
C7RGH6      GVIFVIKSSDTKKEDISLAIE-----NL-KKVDAHILGAVLTHMPMKE--------KK--
C0CK73      GTLLVVRNDFVKTKAVKKVKQ-----QI-EQNGGRVLGVALNRIKKNQ------------
Q1WTC8      GGIIVINSGQASYRQIRKTKE-----QL-ERADSKIIGCVLNKVDASN--------ND--
E8JWI5      ASLLVVSTNEVKRKMVQKSKT-----QL-EQSSTPFLGVVLNKYNVQA--------DK--
F3AHH0      GAILVIEAGVISHRFAQEVKG-----QL-DKTNCPVLGVVLNKVDMSR--------QKY-
F7K0U1      ASVLVISANAISHKFARVVKE-----QL-ERSECPILGVVLNKVDMSQ--------NKY-
C4Z672      GGILVIGAGDISYKFARKSKE-----QL-DLVGCKILGCVLNKVDMAG--------NSY-
P0C0T9      GFVLVTQAGRIKRNYVEKAKE-----QM-EQSGSKFLGIILNKVNESV--------AT--
Q04663      GFILVTQAGRIKRNYVEKAKE-----QM-EQSGSKFLGIILNKVNESV--------AT--
Q67AY4      GFILVTQAGRIKRNYVEKAKE-----QM-EQSGSKFLGIILNKVNESV--------AT--
Q3K0T0      GFILVTQAGRIKRNYVEKAKE-----QM-EQSGSKFLGIILNKVSESV--------AT--
C5NWJ8      GVVLLVEANRVKKKSIEKAKE-----QL-EKGGAEFLGVILNKVNSNE--------LG--
F3A499      GVILLVEANRVKKKSIEKAKE-----QL-EKGGAEFLGVILNKVNSNE--------LG--
Q4JZ55      GIFLVTEMRKTTRRQIFSSLQ-----QL-EQTGVPVLGLVANKAIIKK--------DS--
G5JTD5      ASVLITEAGVIRSRFVKKAIE-----QM-EKSGAQFLGVILNKVDEKS--------EN--
G3G7C1      AMVLVAGAGHVKRSAVKKVKE-----QL-EQTGTQFLGVILNKYDIAT--------EK--
G3G7J9      AMVLVAGAGHVKRSAVKKVKE-----QL-EQTGTQFLGVILNKYDIAT--------EK--
G3G7G6      AMVAVVEAGNVRRSAVKKVKE-----QL-EQTGTPFLGVILNKYDVVT--------EK--
G8DUB0      AMVLVAEAGNVKRSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
G3G7I8      AMVAVVEAGYVKRSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
G3G7J4      AMVAVVEAGNVKRSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
G7SG34      AMVLVAEAGNVKRSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
G8DTZ0      AMVLVAEAGNVKRSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
G8DU07      AMVLVAEAGNVKRSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
A4VTU3      AMVAVVEAGNVKCSSLKKVKE-----QL-EKTGTPFLGVILNKYDIAT--------EK--
G8DU31      AMVAVVEAGSVKCSSLKKVKE-----QL-DQTGTPFLGVILNKYDIAT--------EK--
D5AGQ5      AMVAVVEAGNVKCSSLKKVKE-----QL-EQTGTPFLGVILNKYDIAT--------EK--
Q9X4U7      AMVAVVEAGNVKCSSLKKVKE-----QL-EQTGTPFLGVILNKYDIAT--------EK--
A3CQY2      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
E8KLY9      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F0FHA8      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F0I4H5      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F0IAY3      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F0IJI2      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F0IS53      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F2C9N0      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F2CH53      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F3SM32      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F3UDW7      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F3UNJ4      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTPFLGVVLNKYNIDL--------ER--
F0FQQ5      ASFLVTQAGHIKRKAVMKAKE-----QL-EQTGTSFLGVVLNKYNIDL--------ER--
D6R2T8      ASLLVTEAGAVKRKAVAKAKE-----QL-AQTGTPFLGVVLNKFNVQL--------ER--
F3UUQ2      ASLLVTEAGAVKRKAVAKAKE-----QL-AQTGTPFLGVVLNKFNVQL--------ER--
E6IZC2      ASVLVVESGNVKRKTLQKAKE-----QL-EQTGTPFLGVILNKYDTQL--------EK--
G6A745      ASALVVESGNVKRKALQKAKE-----QL-EQTGTPFLGVILNKYDTQL--------EK--
A8AZR3      ASILVAEAGSVKRKALQKSKE-----QL-EQTGTPFLGVVLNKYDVSG--------DR--
F9HJP6      ASILVAESGSVKRKALQKAKE-----QL-EQTSTPFLGVILNKYDVSN--------DR--
Q4JYT9      ASILVTAARETKRRDILKAKE-----QL-EQTGVPFLGVVLNKFNTEV--------EK--
Q4JZY1      ASILVTAARETKRRDILKAKE-----QL-EQTGVPFLGVILNKFNTEV--------EK--
E1LQJ7      ASILVTATGETKRRDVLKAKE-----QL-EQTGTPFLGVVLNKFNIEV--------GK--
F9HC65      ASILVTAAGETKRRDILKAKE-----QL-EQTGTPFLGVVLNKFNTEV--------EK--
E1LPE7      ASILVVESGAAKRREVQKAKS-----QL-EQAGKPFLGVVLNKFDVQR--------EK--
F9MJW5      ASILVVESGAAKRREVQKAKS-----QL-EQAGKPFLGVVLNKFDVQR--------EK--
E8KDN2      ASILVTEASVTKRREVQKAKT-----QL-EQTGTPFLGVILNKFNIHL--------EK--
E8K322      ASILVTEASATKRREVQKAKD-----QL-EQTGTPFLGVILNKFNIQL--------EK--
F9PEU4      ASILVTEASATKRREVQKAKD-----QL-EQTGTPFLGVILNKFNIQL--------EK--
F9PZP7      ASILVTEASATKRREVQKAKD-----QL-EQTGTPFLGVILNKFNIKL--------EK--
C1CBD1      ASILVTATGEVNKRDVPKAKQ-----QL-EQTGKLFLGVVLNKFNVQH--------EK--
Q7WVX0      ASILVTATGEVNKRDVPKAKQ-----QL-EQTGKLFLGVVLNKFNVQH--------EK--
P96475      ASILITATGEANKRDVQKAKQ-----QL-EQTGELFLGVVLNKLDISV--------DK--
Q9AHD2      ASILVTATGEANKRDIQKAKQ-----QL-KQTGKLFLGVVLNKLDISV--------NK--
Q4K2Q7      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K0T5      ASILVTATGEVNKRDVQKAKQ-----QL-EQTEKLFLGVILNKFDVQH--------EK--
Q4K0E1      ASILITATGEANKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q9AH95      ASILITATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K1M4      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVILNKFDVQH--------KK--
Q4JZ18      ASILVTATGEVNKRDAQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q54520      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVFNKLDISV--------DK--
Q4JYH5      AFILVTATGDVNKRDVQKAKQ-----QL-EQAGKLFLGVVLNKLDISV--------DK--
Q4K0V2      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
A5M4L1      ASILVTATGEANKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
B2ILP5      ASILVTATGEANKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
C1CCB9      ASILVTATGEANKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K1S7      ASILVTATGEANKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
P72512      ASILVTATGEANKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4JZ84      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K0X5      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K0Z6      ASILVTATGEVNKRDVQKAKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K195      ASILVTATGETNKRDVQKAKQ-----QL-KQTGKLFLGVVLNKLDISV--------DK--
Q4K0A0      ASILVTATGEANKRDVQKVKQ-----QL-EQTGKLFLGVVLNKLDISV--------DK--
Q4K0K2      ASILVTATGEANKRDVQKAKQ-----QL-KQTGKLFLGVVLNKLDISV--------DK--
Q4K1F9      ASILVTATGEANKRDVQKAQQ-----QL-KQTGKLFLGVVFNKLDISV--------DK--
Q4K045      ASILVTEAGGVNRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
G6C7Z1      ASILVTAAGETNRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------YK--
D2ERX8      ASILVTAAGETNRRDIQKAKE-----QL-EQTGKPFLGVVLNKFDTSV--------YK--
F9LZC4      ASILVTAAGETNRRDIQKAKE-----QL-EQTGKPFLGVVLNKFDTSV--------DK--
F9P1W8      ASILVTAAGETNRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
I0J9C9      ASILVTEVGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
A6YIA8      AFYFMDEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSI--------DK--
Q4K005      ASILVTEAGEVNRRDIQKAKE-----QL-EHTGKPFLGIVLNKFDTSV--------DK--
Q4JZL7      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGIVLNKFDTSV--------DK--
E5F5C5      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGIVLNKFDTSV--------DK--
Q4JZG7      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGIVLNKFDTSV--------DK--
Q4JZK1      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGIVLNKFDTSV--------DK--
A5LJS0      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q9AHB7      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4K1B7      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4JYK8      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNRFDTSV--------DK--
Q4K0M3      ASILVTEVDEVNRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q9AHA4      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------NK--
Q9X9A1      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------NK--
Q9ZII6      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q8KWQ0      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGIVLNKFDTSV--------DQ--
Q4JZW7      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4JYX9      ASILVTEAGEITRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4K0R7      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4K1K6      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4JZS3      ASILVTEAGEINRRDIQKAKE-----QL-EHTGKPFLGVVLNKFDTSV--------DK--
Q4K0I2      ASILVTKAGETKRRELQKAKE-----QL-EQTGKSCLGVVLNKFDTSV--------DK--
Q4K254      ASILVTKAGETKRRDLQKAKE-----QL-EQTGKSCLGVVLNKFDTSV--------EK--
Q4K237      ASILVTKAGETKRRDLQKAKE-----QL-EQTGKSCLGVVLNKFDTSV--------EK--
B1I967      ASILVTKAGETKRRDLQKAKE-----QL-EQTGKSCLGVVLNKLDTSV--------EK--
G6J8A4      ASILVTKAGETKRRDLQKAKE-----QL-EQTGKSCLGVVLNKLDTSV--------EK--
Q9ZFT8      ASILVTKAGETKRRDLQKAKE-----QL-EQTGKSCLGVVLNKLDTSV--------EK--
D6ZQI8      ASILVTKAGETKRRDLQKAKE-----QL-EQTGKSCLGVVLNKLDTSV--------EK--
Q4K2A8      ASILVTKAGETKRRDIQKAKE-----QL-EQTGKPCLGVVLNKFDTSV--------DK--
Q8VU31      ASILVTKAGETKRRDIQKAKE-----QI-EQTGKPCLGVVLNKFDTSV--------DE--
Q4K2E1      ASVLITAVGEVHRRDVQKAKE-----HL-EQTGKPFLGVVLSKLNTSI--------EK--
Q4K2F7      ASVLITAVGEVHRRDVQKAKE-----HL-EQTGKPFLGVVLSKLNTSI--------EK--
A5YTV7      ASVLITAAGETNRRDVQKAKE-----QL-EQTGKPFLGIVLNKLNTSV--------EK--
F9Q345      ASILVTAAGETNRRDIQKAKE-----QL-EQTSKPFLGIVLNKLNTSV--------EK--
Q6L5R0      ASILVTAAGETNRRDIQKAKE-----QL-EQTSKPFLGIVLNKLNTSV--------EK--
A5YTT9      ASVLVTAAGETNRRDVQKAKE-----QL-EQTSKPFLGVVLNKFNTSV--------EK--
E6KKS0      ASVLVTAAGETNRRDVQKAKE-----QL-EQTSKPFLGVVLNKFNTSV--------EK--
F2QF90      ASVLVTAAGETNRRDVQKAKE-----QL-EQTSKPFLGVVLNKFNTSV--------EK--
E0Q2S8      ASILVTAVGETNRRDVQKAKG-----QL-EQTSKPFLGIVLNKLNTSV--------EK--
A1ILY1      ASVLVTAAGETNRRDVQKAKE-----QL-EQTGKPFLGIVLNKLNTSV--------EK--
Q6L5T0      ASVLVTAAGETNRRDVQKAKE-----QL-EQTGKPFLGIVLNKLNTSV--------EK--
E9FEC5      ASVLVTAAGETNRRDVQKAKE-----QL-EQTGKPFLGIVLNKLNTSV--------EK--
E0PPH9      ASVLVTAVGEANRRDVQKAKG-----QL-EQTSKPFLGIVLNKLNTSV--------EK--
F5VSG9      ASVLVTAVGETNRRDVQKAKG-----QL-EQTSKPFLGIVLNKLNTSV--------EK--
E3CBS0      GTVLITESGANGRKAVQKAKE-----QL-EQTGTPFLGVVLNKFNIKA--------TE--
F9M366      GTVLITESGANGRKAVQKAKE-----QL-EQTGTPFLGVVLNKFNIKA--------TE--
E8K786      GTVLITESGANGRKAVQKAKE-----QL-EQTGTPFLGVVLNKFNIKA--------AE--
F8DFF4      GTVLVVESGTNRRKMVQKAKE-----QL-EQTGTPFLGVILNKFNIKA--------AE--
I1ZPH7      GTVLVVESGTNRRKMVQKAKE-----QL-EQTGTPFLGVILNKFNIKA--------AE--
E7S8W3      GSLIVTAAGAVSRKAVQKAKE-----QL-EQTGTPFLGVVLNKFDIQL--------EK--
D0RXH2      GSFLVSASGAVSRKAVQKAKE-----QL-EQTGTPFLGVVLNKFDVKS--------EK--
Q83YR5      GSFLVSASGAVSRKAVQKAKE-----QL-EQTGTPFLGVVLNKFDVKS--------EK--
Q8GP54      ASLLVTEAGKIKRRFVTKTVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
F8HDC3      ASLLVTAAGRIKRRFVTKAVE-----QL-QQSGSEFLGVVLNKVDLAI--------DK--
F8LJ75      ASLLVTAAGRIKRRFVTKAVE-----QL-QQSGSEFLGVVLNKVDLAI--------DK--
E9DM17      ASLLVTAAGKIKRRFVTKAVE-----QL-TQSGSQFLGVVLNKVDMTV--------DK--
I0QIK6      ASLLVTAAGKIKRRFVTKAVE-----QL-TQSGSQFLGVVLNKVDMTV--------DK--
E8KUY8      ASILVTAAGKIKRRFVAKAVE-----QL-EQSSSQFLGVVLNKVDMTV--------DK--
Q7X553      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLIKVDMTV--------DK--
Q8GP92      ASLLVTEAGKIRRRLVTKAVE-----QL-AESGSQFLGVVLNKVDMTV--------DK--
Q7X561      ASLLVTAAGKITRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DR--
Q7X549      ASLLVTEAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
G6ERT1      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
O87931      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q8GPF6      ASLLVTEAGKIKRRFVTKAVE-----QL-AESGSQFLGVVLNKVDMTV--------DK--
Q7X555      ASLLVTAAGKIKRRFVTKAVE-----QL-KQSGSQFLGVVLNKVDMTV--------DK--
Q7X557      ASLLVTAAGKIKRRFVTKAVE-----QL-KQSGSQFLGVVLNKVDMTV--------DK--
Q7X563      ASLLVIAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q8GMA5      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q8GPA8      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q55205      ASLLVTEAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
C2LSE6      ASLLVTAAGKIKRRFVAKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q7X559      AKFLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
F8LXJ4      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q1WCR1      ASLLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
Q8GPC3      ASFLVTAAGKIKRRFVTKAVE-----QL-EQSGSQFLGVVLNKVDMTV--------DK--
E8JMT9      ASLLVTKAGADKRRTITKLKE-----QL-EQSGSVFLGVILNKYDIHL--------DK--
F5X0J9      ASLLVTKAGEDRRRTVTKLKE-----QL-EQSGSVFLGVILNKYDIHL--------DK--
H2A602      ASLLVVKAGADKRRTVTKLKE-----QL-EQSGSAFLGVILNKYDIHL--------DK--
E0PD83      ASLVVAKAGVDKRRTITKLKE-----QL-EQSGSIFLGVILNKYDIHL--------DN--
F5X652      ASLVVAKAGVDKRRTITKLKE-----QL-EQSGSIFLGVILNKYDIHL--------DN--
G5KD11      ASILVTQEGVIKKRFIQKAKD-----QM-EQSGATFLGIILNKVENTV--------DSYG
B9DUJ4      GSIIVTQAGAIKRRFIQKAKD-----QM-EQSGALFLGVILNKVEEVI--------DS--
G5KAJ2      ASVLVTEAGVIKRRFVQKAKE-----QM-EQSGAQFLGVILNKVEHTV--------DS--
F1Z124      ANILVTEAGAIKRRFIQKAKE-----QM-EQSGALFLGVILNKVEETL--------DS--
Q2KM74      ATILVTEAGSIKRRFVQKAKE-----QM-EQSGAQFLGVILNKVDQQL--------GS--
C6LDI8      GVVYVVESGVTSYHLAKRGKE-----QI-EKSGCRILGAVLNKVE-RK--------SKG-
D4J4T6      GMVMVIEQKKVSRRMAQKMKE-----QL-EASGCPLLGVVLNKVKISE--------NKG-
D4LTH2      GALLVIRAGSVPKTIIRQSLH-----EI-DQAGCKLLGTVLNCVEGA--GGRYGKYGH--
D4LG06      GAILVVRAGQTPKAMIKQSLY-----EI-EQSGCKLLGTVLNRAEVST-RGYG---K---
A7VF42      GAVLVVRSGETSRNVIRQSMQ-----QL-EQVNCRLLGVILNRVEASG-RAYK---SY--
A8SQS8      GAVLVVRAGETSRNLIKQSFQ-----QL-SQVGCTLLGVILNRVETAG-RAYK---KY--
D5HFS4      GAALVVRAGETSKSLIKQSFQ-----QL-DQVGCTLLGVILNRAQTTG-RAYK---KY--
C9LAS1      GAVLVIESERVSYKVAQKSME-----QL-EKTGCKILGAVLNKVNIEK-NKYYGKYDY--
F3AH92      GAILIVESDAVSYKVAQKAKQ-----QL-ERSKCHILGAVLNKADLKK-SKYYS--SY--
I5ASF8      GCIIVIESGAVSYRAAQKVKR-----QL-EQADIHILGVALNKVDRTAAGAYG----H--
E7GL81      GAIMVVESGGVSYRVLQKVKR-----QL-ERSGCRILGTVLNRVNMQV-QGYY---RY--
G5F9E2      GAIMVVESGGVSYRVLQKVKR-----QL-ERSGCRILGTVLNRVNMQV-QGYY---RY--
E7GL57      GAILVIESGNISHRLLQKVKG-----QL-EKSGCRILGAVLNKVDVRQ-NSYY----Y--
G5F9A9      GAILVIESGNISHRLLQKVKG-----QL-EKSGCRILGAVLNKVDVRQ-NSYY----Y--
E7GL40      GAILVIESGAISYRLLQKVKN-----QL-EKSGCRILGTVLNKVDIKQ-GSYY----Y--
G5F9H2      GAILVIESGAISYRLLQKVKN-----QL-EKSGCRILGTVLNKVDIKQ-GSYY----Y--
A8RK85      GAVIVIESGAISYRLVQKVRS-----QL-EKSGCRILGAVLNRVGGGYEHSYYE--KY--
G5HTB2      GAVIVIESGTISYHLVQKVKG-----QL-EKSGCRILGAVLNRVDKEYENGYYK--KY--
G5HNC5      GAVIVINSGTISYHLVQKVKS-----QL-EKSGCRILGAVLNRVGTDYDNGYYK--KY--
C0CZV9      GAVMVVESGAVSYRLEQRVKN-----QL-EKSGCRILGVVLNKIDPEY-NSY----GY--
A8RSK9      GAVMVIESGSISYRLEQRVKG-----QL-EKSGCRILGVVLNKVSMER-NGYYS--KY--
C5EN03      GAVMVVESGCISYRLEQRVKS-----QL-DKSGCRILGVVLNKMSMER-SGYYS--KY--
G5HG45      GAVMVVESGCISYRLEQRVKG-----QL-EKSGCRILGVVLNKVSMER-NGYYS--KY--
D9ST44      GCVLVVASSQVEKAAALKAKA-----LL-EKVKAKILGVVLNK-LDVK--------Q-NG
G2Z8Q3      GIIMVAEESKTQKQKFHKALT-----TL-RSTHTPIIGIILNK-TKQD--------K-SS
C8W5K2      GVLLVVAQSKSKIAMVQKSKE-----LL-LNVNARIIATVLNM-TDDP--------G-ED
A5V0I3      GVLLVLEAGRTRRDRARRARE-----IL-EKVKANIIGVVLNS----A--------RFDG
F5LM71      GVVLVVNAGGVKRELVQKARD-----SL-QFVHARILGVVLNKVARKD--------A-KM
D7VBW4      GTVLVVRQNFVEKVAVRQAVS-----AL-KNARAQLLGTILND-VDIK--------T-HG
F9UQ54      GTVLVVRQNFVEKVAVRQAVS-----AL-KNARAQLLGTILND-VDIK--------T-HG
H6LKR8      GSLLVVAANETKKAMIVEAKK-----TI-DKVGGVLLGVILTK-VKFK--------K-SS
E0I7B5      GVVLVVQAGKVKRDMVRKAKT-----NL-DHVNARILGVVLNN-VERK--------QTEG
D7UYE4      HVVYVVDAKKSHRDDVKKGKE-----LL-EKAGAKILGVVLNK-ATPE--------K-AS
Q4A120      NAVYIIDVETNNKESVKKGKN-----LL-EKSGTKILGAVLNK-AQLD--------K-SS
D9SVC7      GVLLVTCYGKTEKKALVKAKK-----TL-DSVNANTLGVVITKVPKPP--------KIEE
C8VYQ6      GVLLVVASGQAKIEMTLKAKE-----LL-LNVNARIIGTVLNMLNVQG--------E-EY
D9S1J9      GVILVVEEGSTEREAAVAAKQ-----QL-DKVNARILGVVLNKVKQQK--------G-GG
C0GGR5      GVILIAASGQAPLEQVVAAKE-----QL-LKVKANILGVVLNKVPQGN--------G-SY
B1HR41      GTLLVVNTGTVGKAAVVKSKS-----IL-TIAKANILGVILNN--YKM--------K-GS
C6CSC8      GVVLVVDQGRVKRQFAQKAIQ-----NL-QNVNARILGVVLNNVKRRS--------N-EE
D6Y034      GVVLVTSSGKTEREAAKKSKE-----LL-DNAHARILGVILNR-KDKK--------E-TT
Q8EME8      GTILVVRSKQTENDAANRAME-----AL-QSVNANVLGAVLND-RDKK--------D-AN
F3Y922      GTILVAREKIAEKSALLKAKE-----LL-IMVKATIIGAIYND-ASSV--------K-DQ
G4L594      GTLLVVRENWTRKDALSKAKE-----LL-DLVQARVLGVIYNG-SEQG--------K-DK
C9B454      GTLLVVRENTSRKESLTKTKE-----LL-EMVQARVLGVVYNG-AEHS--------K-DA
Q3XYS6      GTLLVVRENTSRKESLNKAKG-----LL-DMVQARVLGVVYNG-AEHS--------K-DV
C9ALZ9      GTLLVVRENTSRKESLTKAKE-----LL-DMVQARVLGVVYNG-AEHS--------R-DA
C9BUG7      GTLLVVRENMSRKESLTKAKE-----LL-EMVQARVLGVVYNG-AEHS--------K-DA
D4RJF4      GTLLVVRENTSRKESLSKAKE-----LL-EMVQARVLGVVYNG-AEHS--------K-DA
C8ZXT9      GTILVVRENVSRKEPLTKAKE-----LL-NMVQARVLGVVYNG-AENN--------K-DS
C9A6V5      GTILVVRENVARKESLTKARD-----LL-NMVQARIIGVVYNG-AEHT--------K-DS
C9CHY8      GTILVVRENVARKESLTKARD-----LL-NMVQARIIGVVYNG-AEHS--------K-DS
Q814Z0      ASILVVRSESTEKETAVKAKG-----LL-ESANGKLLGVVLND-RERE--------Q-GL
B9IRQ6      ASILVVRSELTEKETAVKAKA-----LL-ESAKGKLLGVVLND-RERE--------Q-SL
A0RL70      ASILVVRSESTEKESAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
Q6HB09      ASILVVRSESTEKESAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
B7HFH1      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
B7IQS8      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------E-GL
B3ZRD6      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
B5UQ73      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------N-GL
G9QCG3      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
Q3EV64      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------E-GL
B7HXB4      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
Q72XH8      ASILVVRSESTDKETAVKAKG-----LL-ESAKGKLLGVVLND-RERE--------Q-GL
Q5WBB4      GTIIVTSSGKTDREQLQKTKE-----NL-VKANAHLLGVVLNN-KPID--------D-TT
B1YMM5      GVVLVVGCTTSDRQRVLKAKE-----QL-ELAEAKILGVVLNR-RELT--------D-DS
D7WMM8      GTLLIVNSGVAENENVLKAKS-----YL-EASKANILGVVLNN-YKMP--------L-HQ
A7Z921      GSVLVVLSGKTKMDTVQKARD-----AL-QQSKAKLLGALLNK-KKIK--------K-TE
I2CAF2      GSVLVVLSGKTKMDTVQKARD-----AL-QQSKAKLLGALLNK-KKIK--------K-TE
A7Z9K0      GAIMVISSGKTDKEKAAKAKE-----AL-DYCPCKLLGAVMNG-KKQT--------K-HS
I2CB16      GAIMVISSGKTDKEKAAKAKE-----AL-DYCPCKLLGAVMNG-KKQT--------K-HS
I2HW53      GAIMVISSGKTDKEKAAKAKE-----AL-DYCPCKLLGAVMNG-KKQT--------K-HS
G9QKR4      GTVLVVKSGVTELESALKAKE-----LL-QAAKAKLLGAVLNN-KALK--------S-SS
D5DBK3      GSILVVSSGKTDKEAALKAKE-----LL-VNAKSKLLGAVLNN-RKVY--------D-EN
D5DY81      ASLLIVSSSKTEKEAALKAKD-----LL-TQAKSKLLGAVLNN-RKMK--------E-GN
Q2BFS5      GTMLVISSGYTEMEQAEKATE-----LL-RTSKGKLLGAVLNQ-KKLQ--------D-SH
A4ITF3      CTVLVVSSGNTETDAAVKAKE-----LL-EAANAKLVGVVLNQ-RKQR--------E-GS
C5D961      GTILVIESGGTEIEAAVKAKE-----LL-EAANAKLLGVVLNK-RKHR--------E-GG
G8MZ93      GTVLVIESGGTEIEAAVKAKE-----LL-EAANAKLLGVVLNK-RKHR--------D-GG
F0G6H5      IVFLVARSGVTTLTEIDESVR-----RL-QDVQVDVRGVILND-----------------
F2I4B7      GTVVVVPYGQCTKDEVKESQA-----LL-DKVNTNVLGVIMNRTERTEDY----------
Q74BQ8      SIVFVVREGQSSLANIDEAIS-----AL---NRKKILGIVFNEASAVGISS--------K
F0JCB8      GVVLVIKEGQASQADLRDTIE-----AL---QGSNILGAVYTQASRMHRSLNADAYMKYK
Q314L3      GVVMVVRENVATMEDLRESLE-----AL---EGATMLGVVYNNARSGGGRRG-------R
B5EA81      GVLFVVMERLVSQANLKDALE-----SL---KACPILGMVYNAA-AVDDKDG-------R
C6DZX5      GVLFVVMERLVSQANLKDALE-----SL---KACPILGMVYNAA-TVDHNDG-------R
A1ARV8      GVVFVVKEQTATKDNVSDAIE-----AL---KGADLLGIVYNDT-TITQNVE-------R
C6CW37      GVLLVIHAGKVKKAYVRKAKE-----RL-DFVQSRIIGAVFNQMKRQDIAFVKYYGTSK-
G9RSY9      GVILVVRQNYATFDEVGLAKK-----NL-DAVNANILGAVLNGFDTKSTEKKNG------
B9Y884      GTILVCASNRNDRKELLRVKD-----QF-EQTQVNVIGIVMTMM---PVQRKYYNSYGYR
A5Z5P9      GAILVIRSGETSKSEVKSSIK-----QL-ERSGCKILGVVLNRA---TDAKGKKNEKKYY
Q1AUN8      GVLLVLDAQRTRKGALRKALH-----DL-RGVKANVLGTVMNNF---DGKRGGYAYHGYT
F0SX22      GILFVVRAGLSEKGSVINAVN-----HL-TFVGGNILGFLLNGI------KTKSTSSRYS
B6W7H4      GVIFAIKSNDTKKDEVSHALE-----NL-NKVKGKVLGAILTFA---DLSESSYKGYY--
F0GT81      AVIFAIKSSDTKRDEISQALD-----NL-KKVDAHILGCVLTHM---PRKDNQYGSYY--
B1R3X6      GTILVVRAESTSKESIIKAYK-----EL-EKVRANVLGSVLNGI---KGNNKNYYYAE--
Q8XN76      GTILVVRAESTSKESIIKAYK-----EL-EKVRANVLGSVLNGI---KGNNKNYYYAE--
B1BNK1      GTILVVRAESTSKESIIKAYK-----EL-EKVRANVLGSVLNGI---KGNNKIYYYAE--
B1V0N7      GTILVVRAESTSKESIIKAYK-----EL-EKVRANVLGSVLNGI---KGNNKIYYYAE--
Q0SVR8      GTILVVKYGYTKKDGVIEAVK-----GL-RAVKANIIGTVFNGE---ENQRGKYYHYY--
B1BNH3      GTILVVKYGYTKKDAVIEAVK-----GL-RAVKANIIGTVFNGE---ETQRGKYYHYY--
Q8XN46      GTILVVKYGYTKKDAVIEAVK-----GL-RAVKANIIGTVFNGE---ENQRGKYYHYY--
B1V1Z4      GTILVVKYGYTKKDAVIEAVK-----GL-RAVKANIIGTVFNGE---ESQRGKYYHYY--
G5GFW0      GAVIVIESGKISYKTAQKVKL-----QL-EKSGCRILGAVLNKT---AVQERG----YYA
C2EFR6      GGIIVINSGQASYRQIRKTKE-----QL-ERADSKIIGCVLNKV---DASNN---DYYYG
F3ATF5      GAVLVFESELVSSKEAARVKE-----QL-LMTGCRLIGAVLNKV---DVKKNKYYHRYDY
D4M2S0      GAILVIESEAVSRRDAMKAKE-----QL-TKSGCKILGAVLNKV---DMKKEKYYSKYSS
F4BS19      GTVFVIRKEVADLSEILKAKE-----LL-NLVQANVLGAVFNSKERMKSLNNGY------
D4CG08      GAVLVIAAGTVSRRIERRIKE-----QL-EKSGCRILGAVLNKV---TSEHGGYYGKRYR
D4MP30      GAVLVIAAGTVSRRIERRIKE-----QL-EKSGCRILGAVLNKV---TSEHGGYYGKRYR
C6LCS5      GAAIVIAADAVSYKFVRKVKE-----QI-ERSQCRLLGVILNKV---SLNEKGYYGKYYG
B0P2G2      GAVIVIEQGVIKRKIVQDVIK-----QL-KRGEVRILGAVLNKV---DERIGAY-GNYEY
D4MW29      GAVIVIEQGVIKRKIVQDVIK-----QL-KRGEVRILGAVLNKV---DERIGAY-GNYEY
E5VMX8      GAVIVIEQGVIKRKIVQDVIK-----QL-KRGEVRIFGAVLNKV---DERIGAY-GNYEY
D4JMC2      GAVIVAAQNVTSSRAIINTKR-----TL-EDSGVKILGAVLNKCRFEESKYGHYYGNYYG
D6E0V4      GAVIVAAQNVTSSRAIINTKR-----TL-EDSGVKILGAVLNKCRFEESKYGHYYGNYYG
D6E330      GAIIVIGQGMASARMIQSVKK-----QL-EASGVRILGAVLNKV---NNKKNSHVSGYYG
C4Z8M5      GAIIVIGQGMASARMIQSVKK-----QL-EASGVRILGAVLNKV---NNKKNSHVSGYYG
D4JI67      GAIIVIGQGMASARMIQSVKK-----QL-EASGVRILGAVLNKV---NNKKNSHVSGYYG
D3AC80      GTIIVVESGAISYKMVQHVKE-----QL-EKGECRILGVVLNKV---DLDRDSYYGNYYG
G5IFS3      GAIIVVESGAISYKLAQNVKS-----QL-EKSECRILGVVLNKM---DLEKNGYYGSYYG
D4RX67      GTALVMASGVISARFAEEIVE-----QI-KNTGTKFLGIILNKV---SMSGNGYYGKYYG
A6BIG7      ASVLVVASKTVGHKFAKDVKE-----QL-EKADCPILGVVLNKV---SVSNSRYYGKYYG
C0C0F8      AAVLVIAANAISYKFARVVKE-----QL-EKSNCPILGVVLNKV---NMKQNKYYGKYYG
Q97EP8      GVVLVVSSGVADIEAAKRAKE-----LL-ENVNANIIGSVLNRV---DTESRR--GYYGG
Q97ER5      GVILVVTSGVADIEAAKRAKE-----LL-ENVNANIIGSVLNRV---DTESRK--GYYGS
D2RIR2      GVVLVVHSGMVAPEEVQEAKK-----RL-QAGKANILGVVLNGV---PQQHKG-YGYGYY
G0VNK6      GTVIILGSGDIGPDEGKQAKS-----LL-EKVHANILGVILNKV---PQHHKS----GYY
I0GRR2      GVVFVVRSGKVTPDEAKEAKQ-----RL-VQSQVNIIGTVLNGV---PKKNKAGYGYGYG
A0PZ02      GVLLVAASGQAEKEAAIRAKE-----LL-LKVKANILGVVLTKV---PLNEGK--GYGYS
B1B736      GVLLVTASGQAEKEAAIRAKE-----LL-LKVKANILGVVLTKV---PLNEGK--GYGYS
F6BI62      GVILVIQANKTEIEATKRAKE-----IL-TNLKANILGAVLNKV---KEQRS---D--YY
Q8RBS5      GVILVVHAGKTEIEAASRAKE-----IL-ESVKANILGVVLNRV---KESRN---G-YYY
G2MWC2      GVILVIQAGKTEIEAISRAKE-----IL-ESVKANILGVVLNRV---KESHR---GYYYY
B0K4N1      GVILVIQAGKTEIGAVSRAKE-----IL-ESVKANILGVVLNRV---KESHG---G--YY
B0KAR5      GVILVIQAGKTEIGAVSRAKE-----IL-ESVKANILGVVLNRV---KESHG---G--YY
E8UV29      GVILVIQAGKTEIGAVSRAKE-----IL-ESVKANILGVVLNRV---KESHG---G--YY
C7ISF7      GVILVIQAGKTEIGAVSRAKE-----IL-ESVKANILGVVLNRV---KESHG---G--YY
F7K9V1      GTVIVVESGAISYKFAQKVKE-----QL-EKVDCRILGVILNKVNMSGKG----------
F7K8E9      GTLIVIESGAISYKFAQKVTE-----QL-EKVDCRILGVILNKVNMSGKG----------
F7KL96      GTLIVIESGAISYKFAQKVTE-----QL-KKVGCRILGVILNKVNMSGKG----------
C9AAE5      GVLLVVHAEKTNKQSAKNAVK-----KL-RLVNANILGVVANGTTDTAVN----------
H7F6C8      GTVLVCRYHKTLKEKAKHAVN-----QL-RLSKAKLIGVIFNGTKNAEN-----------
H7F5T6      ASVLIARGGYSNKIDIKKSLK-----NM-QDANANILGVIFNNPQMKQDH----------
E6PYQ3      TLLVVARIGVAQRKGLFRIRH-----DL-AKYPSKQTGIVVNALPFSDTYY---------
C1J9I3      GVVVVANMGKTLKGDLRRTVE-----VL-KLANAKILGSVERVKAKHGDR----------
B1MZT1      GVAIVVSGGRTTKGALQRTSE-----IL-KIAEAPVVGFIYNDQDQKKKA----------
Q03W95      GVAIVVNGGKTNRGAIQRTHE-----IL-KIAEAPVLGFIYNDQSRKKKG----------
B1R3V1      GTILVVKYGYTKKDAVIEAVK-----GL-RAVKANIIGTVFNGEETQRGK----------
I5B296      GIILVIRHGKTRIKEVLDILD-----IY-G--REKVLGVVTNFSKKT-------------
D4YF13      GTILVVRQNYVRRDQVVEAKV-----SL-DNVKANLIGYILNDVPINKNK----------
E6U7N4      GVIFVLRQKYTTTEIAQQAQN-----NL-KNVGARIVGCVFNAFNAQKSR----------
C0QCJ2      GIIIVVKAGKTKRSDVQDLID-----TY-G--KEKILGVVKNFADARHG-----------
F2I6Z7      ASVFVLREGVASYQDIQKSKR-----LL-ESVDANVIGAIYNGADGQGMN----------
C2MBF8      ITIMVVRENHLPRRLLHELEA-----LY-RDKRLKGLCVVLNDAGIGASA----------
D3AE78      GAVIVVESGVISYKMVQKVKG-----QL-EKSGCRILGAVLNKVNQESKG----------
Q39U17      GVVFVVKEGGATMSNVKDALG-----HL-K--KEKVYGVVYNNVGINRFD----------
B9M2X6      GIVFVVKEGAASVKEVNDALT-----AL-D--KSNLLGIVYNETVNENLN----------
A5G424      GIVFVVKEGAASLNDVSDAIA-----AL-K--GTNLLGIVYNEASIDGFN----------
E8WSZ5      GTIFVVRERLATQAEIKEAYD-----HL-K--GSGVLGVVYNAADAAAGD----------
C7LPS3      GVILVVKEGMPSLEQIEEAID-----AL-D---QKVLGIVYNGAHLQSR-----------
C3WFM9      GVVVVVAYDQVAKRELEFTKE-----ML-SNAGANIYGFVVTKVDKGGLS----------
D4YHG7      GVIVVVRSGIANKNEVRKTKD-----LL-DVVNANVIGAVYNGEDANKL-----------
A4J8V0      GVVLVVASGQAKIETAQKAKQ-----ML-LNGKAKILGTILNMVEEDSQD----------
A8U9F4      GTIFVITKNGTDKEMVTKSKE-----LL-EKVKANVIGVVFNRVELKGDN----------
F4BSD9      GTIFVVNKDGADKEMVTKSKN-----LL-EKVNANVIGVVLNRVELKGDN----------
F7V792      GVILVVRADSTSKRLVQKSIH-----QI-ERSGCQLLGIVLNRAGSKKNS----------
F6IR93      GTMLVVRQNGVEKTAVRQAVG-----AL-KKAHTQLLGAVLNDV-DVKTH----------
G0M0F9      GTMLVVRQNGVEKTAVRQAVG-----AL-KKAHTQLLGAVLNDV-DVKTH----------
F6ITB4      GTVLVVRQGVAQKVAVRDAVH-----SL-KKSHANILGSVLNDVRDSSHH----------
G0M1X9      GTVLVVRQGVAQKAAVRDAVR-----SL-KKSHANILGSVLNDVRDSSHH----------
G0LYN9      GTVLVVRQGVAQKAAVRDAVN-----SL-KKVQANILGAVLNDVRDGSHH----------
D7VC13      GTVLVVRQGVAQKAAVRDAVN-----SL-KKSQANILGAVLNDVRDGSHH----------
F9UMZ6      GTVLVVRQGVAQKAAVRDAVN-----SL-KKSQANILGTVLNDVRDSSHH----------
G7QCG1      GAVLVVREGKTSLEDVQESLT-----LL-N---NKVLGLVYNATDYVKPC----------
I2Q341      GAVLVVREGKTSLEDVQESLT-----LL-N---NKVLGLVYNATDYVKPC----------
H8YYB9      AIMLVVEAGGTTRDDLRRAWN-----LL---GGKRILGVVLNKADGDSSG----------
I5AV01      GSILVIAAEEVSRRFAMDVKD-----QL-ERANCPILGCVLNKASQENER----------
B0GAL3      GAILLIESGFVGYRAAQKAIK-----QL-EKSGTHMLGAVLNKVDARKEK----------
G1WUK2      GAILVIESGFVGYRAAQKAIK-----QL-EKSGTHMLGAVLNKVDTKKEK----------
E0RZL3      GTVMVIESNAISYRFAQRVKD-----QL-DKAGAKMLGVVLNKVDIAGKG------YYGH
F0K0J7      GTILVVRQAHSQKSAVKRAVE-----LL-KLTKSPILGYVMNDVDADGD-----------
Q1G8E4      GTILVVRQAYSQKSAVKRAVE-----LL-KLTKSPILGYVMNDVDADGD-----------
D6S4X4      GVVLVVRQGKTQKQAVKRAVE-----ML-EIAQAHVLGYIMNDVKSEDA-----------
D0DJH0      GVVLVVRQSVTQKAGITRAVQ-----ML-KFAKARILGYVMNDIRAENG-----------
C7XKF3      GVVLVVRQGVTQKAGITRAVQ-----ML-KFAKARILGYVMNDIRAENG-----------
E3R264      GVVLVVRQGVTQKAGITRAVQ-----ML-KFAKARILGYVMNDIRAENG-----------
D5GZJ8      GVVLVVRQGVTQKAGITRAVQ-----ML-RFAKARILGYVMNDIRAENG-----------
C2EPK5      GIILVVRQGHTQKLAIKRSVE-----ML-RFAKARILGYIMNDISSDNAG------YGYG
A4ZGZ8      GIILVVRQGKTQKAAIKRAVE-----ML-NFSKAKVLGFIMNDISSDNA----------G
A8YX89      GIILVVRQGKTQKAAIKRAVE-----ML-NFSKAKVLGFIMNDISSDNAG------YGYG
F0NWJ7      GIILVVRQGKTQKAAIKRAVE-----IL-NFSKAKVLGFIMNDISSDNA----------G
E4SMV5      GVVLVVRQGKTQKMAIKRAVE-----ML-EFAKARILGYIMNDVSSDNA-----------
F0TGY2      GVVLVVRQGKTQKMAIKRAVE-----ML-EFAKARILGYIMNDVSSDNA-----------
Q5FIC7      GVVLVVRQGKTQKMAIKRAVE-----ML-EFAKARILGYIMNDVSSDNA-----------
F2M2M6      GVVLVVRQGKTQKMAIKRAVE-----ML-EFAKARILGYIMNDVSSDNA-----------
G7M0Q3      GTILVVRAAKTKKDVVIEAKS-----LL-DKVGANIIGTILYAAENKYNK----------
G7M1R9      GTILVVRAKRTSRESVIDAKR-----LL-DKVGANILGTVLHAVENTRGK----------
A6M2L9      GTILVIRAGETKRDIVMDAKN-----LL-DKVGANIIGTVLHAVENTRGK----------
G7M566      GTILVVRAAVTKRDAVIEAKN-----LL-DKVGANIIGAVLHAVENTRGK----------
E0NHP4      GTVLVVPQGIADKAGVRHAKQ-----ML-ETVQANILGAILNRASAEKST----------
H1LCW3      GVVLVVRQGLAQKLAIKRSTE-----LL-KMVKANLLGYVLNDVAPKNGY----------
C2JZS1      GVVVVANMGKTLKGDLKRTVE-----VL-KLAKAKILGSVERVKARRGDK----------
Q58Z10      GVVVVANMGKTLKGDLKRTVE-----VL-KLANAKILGSVERVKAKHGDR----------
G2KUP1      GTIIVVPQGIADKSSVKVAVE-----QL-KKVNAKILGSVMNRVNAKESA----------
G8PE06      GTILVVPQGYADKAGVRHAKQ-----LL-DVVHAKILGAIMNRVTAEKST----------
Q03GL8      GTILVVPQGIADKAGVRHAKQ-----LL-EAVQANILGAILNRATAEKST----------
E9SAU1      GVLLVAKHGQSTYDALEEAIE-----AV-RMADGSLLGVVINNVSVTGGKYGGKYSYKYK
Q38VG5      GTILVAPQGIADKRSVIKSKE-----LL-DVVHARILGTIMNRVKPENTG----------
F0HVF1      GTILVVRQAYSQKSAVKRAVE-----LL-KLTKSPILGYVMNDVDADGDG----------
G6F8G9      GTILVVRQAHSQKLAVKRAVE-----LL-KLTKSPILGYVMNDVDADGDD----------
C2EWM3      GVVLVVKMGQTEKAGLKRSVE-----LL-KLAHANILGYVMNDVGRNGDS----------
F8DRU2      AVVLVVKQGQTQKLAVKRAVE-----LL-NLAHANLLGYVMNDVNADGDA----------
B3XL23      AVVLVVKQGQTQKLAVKRAVE-----LL-NLAHANLLGYVMNDVNAEGDA----------
F8KGP1      AVVLVVKQGQTQKLAVKRAVE-----LL-NLAHANLLGYVMNDVNAEGDA----------
H4GK03      GVVLVVRSGVTQKVAIKRAVE-----ML-NISKANLLGYVMNDVASGDDD----------
B2GF33      GVVVVVRQGVTQKAAVRRAVE-----ML-RISKTNILGYVMNDV-YDADA----------
C0WW26      GVILVVRQGVTQKAAIRRAVE-----ML-KISQANVLGYVMNDV-YDDDA----------
D0DSJ4      GVILVVRQGVTQKAAIRRAVE-----ML-KISQANVLGYVMNDV-YDDDA----------
C0ZHV8      GCVMVVDASKTKRDSAVKAVE-----QL-KAAGANLLGVVLNNKKVGK--REG-------
F8FCE2      GVVIVIDVGKVKREAVKKMKS-----NL-EHAKGRILGVVLNNMNKKEAGTYA-------
H6NE43      GVVIVIDVGKVKREAVKKMKS-----NL-EHAKGRILGVVLNNMNKKEAGTYA-------
I0BSG4      GVVIVIDVGKVKREAVKKMKS-----NL-EHAKGRILGVVLNNMSKKEAGTYA-------
Q83VF9      GVVLVASAYETKKESLAKTKK-----ML-EQVNANILGVVLNGVDSSD--SPS-------
G8P3D7      GVVLVVRAYETKKESLAKTKK-----FL-EQVNVNILGVVLHGVDSSD--SPS-------
O06030      GVVLVVRAYETKKESLAKTKK-----KL-EQVNANILGVVLHGVDSSD--SPS-------
G9M880      GVVIVVRAYETKKESLAKTKK-----ML-EQVNANILGVVLHGVDSSD--SPS-------
G6FD42      GVVIVVRAYETKKESLAKTKK-----ML-EQVNANILGVVLHGVDSSD--SPS-------
F9VC44      GAVIVVRAYETKKESLAKTKK-----ML-EQVNANILGVVLHGVDSSE--SPS-------
A9QSJ4      GVVLVVRAYETKKESLAKTKK-----IL-EQVNANILGVVLHGVDSSE--SPS-------
Q3ZK50      GVVLVVRAYETKKESLAKAKK-----IL-EQVNANILGVVLHGVDSSE--SPS-------
E3GPC6      GYIVVAAISVTNKEGVRMALE-----TL-RNVNGNIVGVVANNAPVSK-RSGY-------
G0V447      GVILVVSSGQADKEAAKRAKE-----LL-ESVRANIIGVVLNKVEINS--RNKYGY----
H7F1R7      GVILVLRSDKTLKERAKIAVE-----QL-RNTHVHIIGTVLNYVKSDS--DNY-------
E3H7M5      GVVYVVGYDMVFKKELLSGKK-----LL-EKAGANIYGVVVNKVSING--YSMGNYGHYS
E6UHY4      GVLLIAKFAQSTYDALQEAIE-----AI-KMADGSLLGVVVNNVSVMS--GKYGGKYGYR
D9QTC6      GVMLVVAAQETDEEALAKSQQ-----ML-EKVQANVIGTVLTKYPAEESNSYYSGY----
D9SR41      GVILVAVYGKTDKKALIKAKE-----RL-DKVDANLLGSILTRVPANSKNGSS-------
E3HB18      GVIFVNGYDMVSKKELLYAKE-----IL-SSAGANIYGMVVNKIDNSGYGYGYKSHGYYN
P95696      DSLLVIDSEKNDKNEVKKAKA-----LM-EKAGSNILGVILNKTKVDK-SSSY-------
Q2G1K7      DSLLVIDSEKNDKNEVKKAKA-----LM-EKAGSNILGVILNKTKVDK-SSSY-------
A8YPQ5      NVVYVVNSENNNKDEVKKGKE-----LI-EATGAKLLGVVLNRMPKDK-SASY-------
Q2FUV2      NVVYVVNSENNNRDEVKKGKE-----LI-EATGAKLLGVVLNRMPKDK-SASY-------
P39851      NCVLVIDAEKNNKSEVKKAKG-----LL-TKAGGKVLGAVLNKMPIDK-NSSY-------
C5QNG4      DAIIVIDAEKNNKYEVKKAKS-----LI-EKADGKIIGAVLNKTPRDK-SSSY-------
Q4L9H7      ECVLIIDVENNNKDELKKAKS-----LI-EKAEGRLLGAVLNKTPVDK-SSSY-------
A7NQ71      GVLLVIEAGRTRRDRARRARE-----IL-EKVKANIIGVVLNGARF----DGE-------
E4Q5T5      GVILVAAAGEVQIEAIQQAKE-----NL-QKVNANIIGVVLNKVKRQT--SS--------
E4SDX4      GVILVAAAGEVQIEAIQQAKE-----NL-QKVNANIIGVVLNKVKRQT--SS--------
E4S7Y6      GVILVASAGEVEIEAIQHAKE-----NL-QKVNANIIGVVLNKVNKQT--SGY-------
C6CS80      GVLLVVNARTGKKQHAIKAKN-----AL-KFVQARIVGIALNQTAHRE--AGP-------
E6LD64      GTMLVVREDVSSKDAVVKAQK-----LL-QMVNANILGAIYHGTKNAV-DQG--------
F0EKB9      GTILVVRENVARKESLTKARD-----LL-NMVQARIIGVVYNGAEHSK-DSGY-------
H7F571      GTVVVLRSEKTLKDRAKIAID-----QL-RKTKIPIIGTVLNCVKNRV--DNY-------
F5LE48      GVILVLNHGKVKREVAKRAVD-----RL-EHVGVKPLGVVINNKTNTKTSSSY-------
E7RDR3      GTILVVSSGNTEKDKALKAKE-----AI-ESSNSRLIGAVLNNFELPK--DSY-------
E7RG08      GTILVLNSGKTERAHALKAKD-----AITASTKTRLLGTVLNNVQVEK--DFN-------
G2FWX4      WVVLVMDLGEENKNYVQHAKE-----LL-DKVDAKFLGAVLNKVDMKP--SE--------
G2FM59      GVILVLAAGEVNKGYAQKAKE-----QL-DKLGVKILGAVLNKVGMNT--KE--------
G7WJV1      GVILVLASGEVDKGYAQKAKG-----LL-DKLEIKILGAVLNKVGMNS--HE--------
H5XZD4      GVILVLASGEVDKGHAQKAKG-----LL-DKLGIKILGAVLNKVAMNT--KG--------
H5XZG7      GVILVLASGEVNKDFALRAKD-----QL-DKVGAKILGAVLNKADIKT--SE--------
G7W773      GVILVLASGEVNKEYAQRAKD-----QL-DKVGAKILGAVINKADLKT--SE--------
G2FWT8      GVILVLASGEVNKEFAQRAKE-----QL-DKVGAKILGAVLNKADMKT--SE--------
I4DBG8      GVILILASGEVNKDYAQRAKE-----QL-DKVGAKILGAVLNKADLKT--SE--------
C0EBA6      GVVLVIRQNQTKHETLQKAIK-----SL-EFAEMKILGAVVTHAGNER--KSR-------
Q9K6R0      GTVLVISSGKTQKEEALKAKD-----LL-DKSNANLLGVVLNNKELRN--SNM-------
I2HVL2      GSVLVVLSGKTKMDTVQKARD-----AL-QQSKAKLLGALLNKKKIKK--TEH-------
D4G1R2      GSVLVVLSGKTKTDTVLKAKD-----AL-EQSNAKLLGALLNKKKMKK--SEH-------
G4EQZ7      GSVLVVLSGKTKTDTVLKAKD-----AL-EQSNAKLLGALLNKKKMKK--SEH-------
P71051      GSVLVVLSGKTKTDTVLKAKD-----AL-EQSNAKLLGALLNKKKMKK--SEH-------
E0U2Z3      GSVLVVLSGKTKTDTVLKAKD-----AL-EQSNAKLLGALLNKKKLKK--SEH-------
G4P114      GSVLVVLSGKTKTDTVLKAKD-----AL-EQSNAKLLGALLNKKKMKK--SEH-------
A9VRC3      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2RG49      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2T8T6      ASILVVRSESTEKETAVKAKG-----LL-ESANGKLLGVVLNDRE-RE--QGL-------
C2MTG3      ASILVVRSEATEKETALKAKG-----LL-ESAKGKLLGVVLNDRE-RE--HGL-------
C2SSX8      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--HGL-------
C2YZB2      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C3GBJ8      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2SBU4      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2NQN6      ASILVVRSESTEKESAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C3GRR0      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2PN22      ASILVVRSESTEKETAVKAKV-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2Y452      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2WVG6      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C3EBC0      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2XJH9      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--QGL-------
C2P8H3      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--EGL-------
C2ULR6      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--EGL-------
C2V4M2      ASILVVRSEATEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--EGL-------
C3H979      ASILVVRSESTEKETAVKAKG-----LL-ESAKGKLLGVVLNDRE-RE--EGL-------
G2TR25      GTILVVSSGKAEVEAVKKAKE-----LL-ESANANLLGVVLNNKKTQN--THY-------
P96716      GSVLVISSGKTEKEQAAKAKE-----AL-ATCKSKLLGAIMNGKKLSK--HSE-------
G4EQF3      GSVLVISSGKTEKEQAAKAKE-----AL-ATCKSKLLGAIMNGKKLSK--HSE-------
D4G2E1      GSVLVISSGKTEKEQAAKAKE-----AL-ETCKSKLLGAIMNGKKLSK--HSE-------
I0F9R6      GSVLVISSGKTEKEQAAKAKE-----AL-ESCNSKLLGAIMNGKKLSK--HSE-------
E0TTZ6      GSVLVISSGKTEKEQAAKAKE-----AL-ESCKSKLLGAIMNGKKLSK--HSE-------
G4P1M7      GSVLVISSGKTEKEQAAKAKE-----AL-ESCKSKLLGAIMNGKKLSK--HSE-------
A8FHL9      GSILVVLSGKTKIAAVKKSKE-----VL-DGTTGKLLGAMLNGKKEKK--GRL-------
Q5KUM5      GTVLVIESGGTEIEAAVKAKE-----LL-EAANAKLLGVVLNKRKHRD--GGY-------
D3FZP4      GSILVVSSGKTNRDGAKKATE-----QL-KQAQAKLIGAVLNDKKKDN--TSY-------
I0JRK4      GALLVVRSKQTEQEAAGKAKE-----QL-EQSRANILGVVLNDMDAKD--SNY-------
I3EBB3      GTILVVSSGKTEIEQAIKAKE-----ML-QAANARILGVVLNNKKVKG--NQY-------
E3CP62      ASILVTAAGKIKRRFVAKAVE-----QL-EQSSPQFLGVVLNKVDMTVDKYGSYGSYGSY
C2KHF1      GVAIVVNGGKINKGALKRTNE-----IL-KIAEAPVLGFIYNDQSRR--KKGSYGYGYG-
I0UTA5      GVIMVGSIGKSHREQMTEATN-----NL-NKVNANLFGLVLNRAPRKGLGNSYYGFGYAN
B7BDT8      RTVFIVRAGLLERDMLPKLQS-----DY-EAKRFKNMALVLNGTIGGS-SRYGYRYGYRY
G9WIQ9      GVVLVATLGKTKKKSLLEAAH-----IL-TLARAHLLGLVSRDPERAE-KAYGYGYGYGY
A0NKF6      GVVLVAMLNKTRRRSMATAAN-----IL-KLAKANVLGVVSRDQRRAD-K----GYGYGY
Q04DV8      GVVLVAMLDKTKRRSMATAAH-----IL-KLAKANVLGVVSRDQRRAD-KGYGYGYGYGY
F4SM97      TTLLVVRFEQNTVKEIEVSFK-----RF-EQSGVTVKGCILNGVIKK--ASSYYGYGY--
G5Q4J0      TTLMVARYAVNTLKEVETSLS-----RF-DQNGIQVKGVILNSIFRR--ATGYQDYGY--
G5LQM6      TTLMVARYAVNTLKEVETSLS-----RF-DQNGIQVKGVILNSIFRR--ATGYQDYGY--
G5SDT8      TTLMVARYAVNTLKEVETSLS-----RF-DQNGIQVKGVILNSIFRR--ATGYQDYGY--
F3CAY9      TCLLVARFGMTTAQEIEACKR-----RL-GQNGILIKGAIFNAVVRKA-TTSDYDYAA--
A3K8W7      GVLLVVGGGLTTEREVKE-VE-----RR-LGTETPLLGMILNKAE----GVDVERYAY--
G7EJX6      SVIYVVKSDVTRIKPIKAGIE-----RL-FESKAHVAGIVLNQVDMSK-SNDEHSYGY--
B7B947      LTIYVVRAGRMDRRALPEVEKLYREGKL-RNMSLILNGTVYKHGTYGYHYGYGYGYGYGY
D3LB10      GIVLTAMLGKTKRKSMASAAH-----IL-KLAKANVLGVV-SRDPHRADKGYGYNYRYDY
S9QRP1      GVLMVVGGGITTEREVREVER-----RL-GD-STPLLGTVLNRAEDTQIRKYSY------
G8AU96      SVIYVVRWQHTPLDTVTAGFN-----KL-KSVDSAVGGVVLSRVVASKHVKYGHKDDAYY
A3W0H7      GVLIVVGGGRTTARHLRDLKA-----RF-GT-DTPLLGVVMNRAEGESIAKYGY------
Q0FMP0      GVILVIGGGITTEKEIRETQR-----RL-GD-DVPLLGTVLNKAEGSKIRQYTY------
                                                                        

E9TE88      -------------------SAYQDYGYYEYEYKSDAK-----------------------
B8D0N2      ----Y-------------------YYSYY-------------------------------
C2CI44      ------------------------YGNYY-------------------------------
C7RGH6      ------------------------YGNYY-------------------------------
C0CK73      ----KGA---YPYGK--------KYYSYE------YKKEK--------------------
Q1WTC8      ----Y-------Y-----------YGYYH------K------------------------
E8JWI5      ----YGF-----YGS---------YGHYG------DNLSKEE------------------
F3AHH0      ----YGK-----YYG-------RHYGRYY------GKDE---------------------
F7K0U1      ----YGK-----YYG-------KYYGKYG------EK-----------------------
C4Z672      ----YGR-----YYGKYYGKYYGKYGEES-------------------------------
P0C0T9      ------------YGD---------YGNYG------KRDRKRK------------------
Q04663      ----YGD-----YGD---------YGNYG------KRDRKRK------------------
Q67AY4      ----YGD-----YGD---------YGNYG------KRDRKR-------------------
Q3K0T0      ----YGD-----YGD---------YGNYG------KRDRKRK------------------
C5NWJ8      ----YGG-----Y--------YGHYGSYGIKGNKDKK-----------------------
F3A499      ----YGG-----Y--------YGHYGSYGLNGNKDKK-----------------------
Q4JZ55      ----YGY-----YGK---------NTASE------TERY---------------------
G5JTD5      ----YGN-----YGS------YGSYGDYG------KRTAVTRTNHASHTRRSK-------
G3G7C1      ----YGD-----YGN---------YGNYG------KKA----------------------
G3G7J9      ----YGD-----YGN---------YGNYG------KKA----------------------
G3G7G6      ----YGE-----YGN---------YGNYG------RK-----------------------
G8DUB0      ----YGE-----YGN---------YGNYG------KKA----------------------
G3G7I8      ----YSE-----YGN---------YGNYG------KKA----------------------
G3G7J4      ----YSE-----YGN---------YGNYG------KKA----------------------
G7SG34      ----YGE-----YGN---------YGNYG------KKA----------------------
G8DTZ0      ----YGE-----YGN---------YGNYG------KKA----------------------
G8DU07      ----YGE-----YGN---------YGNYG------KKA----------------------
A4VTU3      ----YSE-----------------YGNYG------KESLISQIT----------------
G8DU31      ----YSG-----------------YGNYG------KKA----------------------
D5AGQ5      ----YSE-----------------YGNYG------KKA----------------------
Q9X4U7      ----YSE-----------------YGNYG------KKA----------------------
A3CQY2      ----YGA-----CGT---YGGYGSYGNYG------K------------------------
E8KLY9      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F0FHA8      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F0I4H5      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F0IAY3      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F0IJI2      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F0IS53      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F2C9N0      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F2CH53      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F3SM32      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F3UDW7      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F3UNJ4      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
F0FQQ5      ----YGA-----YGT---YGGYGSYGNYG------K------------------------
D6R2T8      ----YGS-----YGS---YGGYGDYGNYG------K------------------------
F3UUQ2      ----YGS-----YGS---YGGYGDYGNYG------K------------------------
E6IZC2      ----YGS-----YGN------YGNYGNYG------KKK----------------------
G6A745      ----YGS-----YGN------YGDYGNYG------KK-----------------------
A8AZR3      ----YGV-----YGA------YGNYGAYG------KKH----------------------
F9HJP6      ----YGA-----YGA------YGNYGNYG------KKH----------------------
Q4JYT9      ----YGA-----YGG---YGTYGFYGNYR------KG-----------------------
Q4JZY1      ----YGA--------------YGVYGDYR------KG-----------------------
E1LQJ7      ----YGA-----YGGYGAYGAYGSYGNYG------KKK----------------------
F9HC65      ----YGA-----YGG---YGAYGSYGNYR------KKK----------------------
E1LPE7      ----YGS-----YGG------YGN---YG------KK-----------------------
F9MJW5      ----YGS-----YGG------YGN---YG------KK-----------------------
E8KDN2      ----YGS-----YGS------YGSYGAYG------KK-----------------------
E8K322      ----YGS-----YGS------YGNYGSYG------KK-----------------------
F9PEU4      ----YGS-----YGS------YGNYGSYG------KK-----------------------
F9PZP7      ----YGT-----YGG------YGNYGAYG------KK-----------------------
C1CBD1      ----YG--------S---------YGNYG------KR-----------------------
Q7WVX0      ----YG--------S---------YGNYG------KR-----------------------
P96475      ----YGV--------------------YG------RK-----------------------
Q9AHD2      ----YGV-----YGS---------YGNYG------KK-----------------------
Q4K2Q7      ----YGV-----YGS---------YGSYG------KK-----------------------
Q4K0T5      ----YGS-----YGG---------YGNYG------KK-----------------------
Q4K0E1      ----YGV-----YGS---------YGNYG------KK-----------------------
Q9AH95      ----YGA-----YGS---------YGNYG------KK-----------------------
Q4K1M4      ----YGS-----YGD---------YGNYG------KK-----------------------
Q4JZ18      ----YGV-----YGS---------YGNYG------KK-----------------------
Q54520      ----YGV-----YGF---------YGNYG------KK-----------------------
Q4JYH5      ----YGV-----YGS---------YGNYG------KK-----------------------
Q4K0V2      ----YGV-----YGF---------YGNYG------KKII---------------------
A5M4L1      ----YGV-----YAS---------YGNYG------KK-----------------------
B2ILP5      ----YGV-----YAS---------YGNYG------KK-----------------------
C1CCB9      ----YGV-----YAS---------YGNYG------KK-----------------------
Q4K1S7      ----YGV-----YAS---------YGNYG------KK-----------------------
P72512      ----YGV-----YAS---------YGNYG------KK-----------------------
Q4JZ84      ----YGV-----YGS---------YGNYG------KK-----------------------
Q4K0X5      ----YGV-----YGS---------YGNYG------KK-----------------------
Q4K0Z6      ----YGV-----YGF---------YGNYG------KK-----------------------
Q4K195      ----YGV-----YGF---------YGNYG------KK-----------------------
Q4K0A0      ----YGV-----YGS---------YGNYG------KK-----------------------
Q4K0K2      ----YGV-----YGF---------YGNYG------KK-----------------------
Q4K1F9      ----YGV-----YGF---------YGNYG------KK-----------------------
Q4K045      ----YGS-----YGK---------YGDYE------KNKKYVEG-----------------
G6C7Z1      ----HSP-----YGN---------YGDYG------KK-----------------------
D2ERX8      ----HSP-----YGN---------YGDYG------KK-----------------------
F9LZC4      ----YGS-----YGN---------YGDYG------KK-----------------------
F9P1W8      ----YGS-----YGN------------YG------KK-----------------------
I0J9C9      ----YGS-----YGG---------YGNYG------NK-----------------------
A6YIA8      ----YGS-----YGN---------YGNYG------KNKK---------------------
Q4K005      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4JZL7      ----YGS-----YGG---------YGNYG------NK-----------------------
E5F5C5      ----YGS-----YGN---------YGNYG------KNKK---------------------
Q4JZG7      ----YGS-----YGD---------YGDYG------KNKK---------------------
Q4JZK1      ----YGS-----YGN---------YGDYG------KNKK---------------------
A5LJS0      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q9AHB7      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4K1B7      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4JYK8      ----YGS-----YGN---------YGNYG------KE-----------------------
Q4K0M3      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q9AHA4      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q9X9A1      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q9ZII6      ----YGS-----YGD---------YG---------KNKK---------------------
Q8KWQ0      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4JZW7      ----YGS-----YGN---------YG-----------KK---------------------
Q4JYX9      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4K0R7      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4K1K6      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4JZS3      ----YGS-----YGN---------YGDYG------KNKK---------------------
Q4K0I2      ----YGF-----YGS---------YGSYR------KQKK---------------------
Q4K254      ----YGS-----YGN---------YGNYR------KQKK---------------------
Q4K237      ----YGS-----YGS---------YGNYR------KQKK---------------------
B1I967      ----YGS-----YGS---------YGNYR------KQKK---------------------
G6J8A4      ----YGS-----YGS---------YGNYR------KQKK---------------------
Q9ZFT8      ----YGS-----YGS---------YGNYR------KQKK---------------------
D6ZQI8      ----YGS-----YGS---------YGNYR------KQKK---------------------
Q4K2A8      ----YGS-----YGS---------YGNDR------KK-----------------------
Q8VU31      ----YGS-----YGS---------YGKKK------K------------------------
Q4K2E1      ----YSS-----YGG---------YGNYG------NK-----------------------
Q4K2F7      ----YSS-----YGG---------YGNYG------NK-----------------------
A5YTV7      ----YGS-----YGA------YGSYGNYG------RK-----------------------
F9Q345      ----YGS-----YGA---------YGSYG------KK-----------------------
Q6L5R0      ----YGS-----YGA---------YGSYG------KK-----------------------
A5YTT9      ----YGS-----YGA---------YGNYG------KK-----------------------
E6KKS0      ----YGS-----YGA---------YGNYG------KK-----------------------
F2QF90      ----YGS-----YGA---------YGNYG------KK-----------------------
E0Q2S8      ----YGS-----YGA---------YGNYG------KK-----------------------
A1ILY1      ----YGS-----YGA------YGNYGNYG------KK-----------------------
Q6L5T0      ----YGS-----YGA------YGNYGNYG------KK-----------------------
E9FEC5      ----YGS-----YGA------YGNYGNYG------KK-----------------------
E0PPH9      ----YGS-----YGA------YGSYGNYG------KK-----------------------
F5VSG9      ----YGS-----YGA---------YGNYG------KK-----------------------
E3CBS0      ----YGS-----YGG---------YGSYG------EYG---KK-----------------
F9M366      ----YGS-----YGG---------YGSYG------EYG---KK-----------------
E8K786      ----YGS-----YGG---------YGSYG------EYG---KK-----------------
F8DFF4      ----YGS-----YGG---------YGSYG------EYG---KK-----------------
I1ZPH7      ----YGS-----YGG---------YGSYG------EYG---KK-----------------
E7S8W3      ----YGS-----YGN---------YGNYG------NYGK--KR-----------------
D0RXH2      ----YGS-----YGN---------YGNYG------NYGNYGKK-----------------
Q83YR5      ----YGS-----YGN---------YGNYG------NYGNYGKK-----------------
Q8GP54      ----YGS-----YGS------YGSYGEYG------KKSDQKEGHSRAHRRRKG-------
F8HDC3      ----YGS-----YGS------YGSYGSYGEY----GGDKHTENKSRKHRRKRG-------
F8LJ75      ----YGS-----YGS------YGSYGSYGEY----GGDKHTENKSRKHRRKRG-------
E9DM17      ----YGT-----YGS------YGSYGDYG------KKSEQKSSHSRSQRRRKG-------
I0QIK6      ----YGT-----YGS------YGAYGDYG------KKSEQKSSHSRSQRRRKG-------
E8KUY8      ----YGS-----YGS------YGSYGSYGEYG---KKGKQKESHSRAHRRRKG-------
Q7X553      ----YGS-----YGS------YGSYGEYG-------------------------------
Q8GP92      ----YGF-----YGS------YGLYGEYG------KKSDQKEGHSRAYRRRKGKH-----
Q7X561      ----YGS-----YGS------YGSYGSNGSYGSQ--------------------------
Q7X549      ----YGS-----Y-----------------------------------------------
G6ERT1      ----YGS-----YGS------YGSYGEYG------KKSNQKEGHSRAHRRRKVGWN----
O87931      ----YGS-----YGS------YGSYGEYG------KKSNQKEGHSRAHRRRKVGWN----
Q8GPF6      ----YGS-----YGS------YGSYGEYG------KKSDQKEGHSRAYRRRK--------
Q7X555      ----YGS-----YGS------YGSYGEYG------KKTDQ--------------------
Q7X557      ----YGS-----YGS------YGSYGEYG------KKTDQ--------------------
Q7X563      ----YGS-----YGS------YGSYGSYGSYGEY--------------------------
Q8GMA5      ----YGS-----YGS------YGSYGSYGSYGEYRKKTDQTEGHSRAHRRRKG-------
Q8GPA8      ----YGS-----YGS------YGSYGSYGSYGEYRKKTDQTEGHSRAHRRRKG-------
Q55205      ----YGS-----YGS------YGSYGEYG------KKSNQKEGHSRAHRRRKG-------
C2LSE6      ----YGS-----YGS------YGSYGEYG------KKSDQKEGHSRAHRRRKG-------
Q7X559      ----YGS-----YGS------YGSYGEYE------KKTDQ--------------------
F8LXJ4      ----YGS-----YGS------YGSYGEYG------KKYDQKEGHSRAHRRRKG-------
Q1WCR1      ----YGS-----YGS------YGSYGEYG------KKYDQKEGHSRAHRRRKG-------
Q8GPC3      ----YGS-----YGS------YGSYGEYE------KKTDQTEGHSRAHRRRKG-------
E8JMT9      ----YGS-----YGS------YGGYGEYG------EKN----------------------
F5X0J9      ----YGS-----YGS------YGGYGSYG------NYGKSEEKTKIGRGKRKK-------
H2A602      ----YGS-----YGS------YGGYGSYG------NYGKSEEKTKIGRGKRKK-------
E0PD83      ----YGA-----YGS------YGGYGAYG------NYGKGKEKTKTGRVKRKK-------
F5X652      ----YGA-----YGS------YGGYGTYG------A---KEEKSKKGKGRRRK-------
G5KD11      GYGAYGG-----YGA------YGAYGSYG------SYGKENEKSRKASRRRK--------
B9DUJ4      ----YGG-----YGA------YGAYGNYG------NYGKEDSKSKKKNRRRK--------
G5KAJ2      ----YGS--------------YGSYGNYG------KKEKPRKHVRKSSRKRK--------
F1Z124      ----YGG--------------YGSYGAYG------NYGKPAK---KKSRKRR--------
Q2KM74      ----YGA--------------YGSYGDYG------KTKKSSK---SKKHSRK--------
C6LDI8      ----Y-G-----YGR--------YYGDYY------KK-----------------------
D4J4T6      ----YGG-----YGQ--------YYGHYG------KYGEY--------------------
D4LTH2      ----YGK-----YGKYGHYGQYGYGPQAE------EENKKSKK-----------------
D4LG06      ----YGK-----YG----NYGYG-YGY---------EPDTKHKKHSEK------------
A7VF42      ----YGK-----YGK---DYGYG-YGYGE------KKYSGKKEK----------------
A8SQS8      ----YGK-----YGKYYKQYGYGEYGRYG------QEAASSKDK----------------
D5HFS4      ----YGK-----YGKYYSQYGYG-YGTYG------KEAAAASDSTPSK------------
C9LAS1      ----Y------YKSK---------------------------------------------
F3AH92      ----YGKKYGGYRGR---------------------------------------------
I5ASF8      ----YGK-----YGKYGKYGKYGRYGYDK------SAQTQ--------------------
E7GL81      ----YGK-----YGRYHYVYGYGYGRENK------K------------------------
G5F9E2      ----YGK-----YGRYHYVYGYGYGRENK------K------------------------
E7GL57      ----YGK-----YGKY-----YGKEYSSE------H------------------------
G5F9A9      ----YGK-----YGKY-----YGKEYSSE------H------------------------
E7GL40      ----YGK-----YGKY-----YGYGHENA------KQGKEVKTASV--------------
G5F9H2      ----YGK-----YGKY-----YGYGHENA------KQGKEAKVL----------------
A8RK85      ----YGRRGGKYYGKYGRHYGRYEEGKAP------PVNEVSGARIKNDTTAQSQDT----
G5HTB2      ----YGK-----Y-----------YGKYG------EA-----------------------
G5HNC5      ----YGK-----Y--YGRYYGKTYGGGGE------KYQILDEAR----------------
C0CZV9      ----YTR-----YGKYG---KYSRYEKYA------KYDKSEITEG---------------
A8RSK9      ----YGK-----YG------KYSKYGHYG------KYDRYEKAEA---------------
C5EN03      ----YGR-----YGKYGKYSKYGKYGKYG------KYEKYEKANA---------------
G5HG45      ----YSR-----YGKYGKYSKYGKYGKYG------KYEKYEKAEA---------------
D9ST44      YY----------------------------------------------------------
G2Z8Q3      KYYYY-------------------N-----------------------------------
C8W5K2      YRYYN-------------------YG----------------------------------
A5V0I3      EYGYY-------------------A-----------------------------------
F5LM71      NTYYD-------------------YSS---------------------------------
D7VBW4      YGYGY-------------------YGTET------N------------------------
F9UQ54      YGYGY-------------------YGTET------N------------------------
H6LKR8      DY-YG-------------------YGEDK------GHSKKEKKLKKKK------------
E0I7B5      YYYYY-------------------YGSKE-------------------------------
D7UYE4      SYYYY-------------------YGDDK------K------------------------
Q4A120      SSYYY-------------------YGEES-------------------------------
D9SVC7      NYSYY-------------------YSEED------DDE----------------------
C8VYQ6      YYYYY-------------------YYSGE------DGGKKPKNKGHRKKNLPAATM----
D9S1J9      YYYYY-------------------YYYGE------GDHKRKKKKIT--------------
C0GGR5      YYHYH-------------------YGQ---------------------------------
B1HR41      TYEQY-------------------YGKE--------------------------------
C6CSC8      AYYYY-------------------YSADV------K------------------------
D6Y034      YY-YY-------------------YGND--------------------------------
Q8EME8      YY-YY-------------------YGS---------------------------------
F3Y922      GY--Y-------------------YGVK--------------------------------
G4L594      A-YYY-------------------YSD---------------------------------
C9B454      G--YY-------------------YRN---------------------------------
Q3XYS6      G--YY-------------------YGN---------------------------------
C9ALZ9      G--YY-------------------YGN---------------------------------
C9BUG7      G--YY-------------------YGN---------------------------------
D4RJF4      G--YY-------------------YGN---------------------------------
C8ZXT9      GYYYY-------------------YGN---------------------------------
C9A6V5      GYYYY-------------------YGN---------------------------------
C9CHY8      GYYYY-------------------YGN---------------------------------
Q814Z0      YY--Y-------------------YGAN--------------------------------
B9IRQ6      YY--Y-------------------YGTN--------------------------------
A0RL70      YY--Y-------------------YGAN--------------------------------
Q6HB09      YY--Y-------------------YGAN--------------------------------
B7HFH1      YY--Y-------------------YGAN--------------------------------
B7IQS8      YY--Y-------------------YGAN--------------------------------
B3ZRD6      YY--Y-------------------YGAN--------------------------------
B5UQ73      YY--Y-------------------YGAN--------------------------------
G9QCG3      YY--Y-------------------YGAN--------------------------------
Q3EV64      YY--Y-------------------YGAN--------------------------------
B7HXB4      YY--Y-------------------YGAN--------------------------------
Q72XH8      YY--Y-------------------YGAN--------------------------------
Q5WBB4      YY-YY-------------------K-----------------------------------
B1YMM5      AYQYY-------------------YSYE--------------------------------
D7WMM8      YY-EQ-------------------YYR---------------------------------
A7Z921      HY-SY-------------------------------------------------------
I2CAF2      HY-SY-------------------------------------------------------
A7Z9K0      DY-AY-------------------YGQ---------------------------------
I2CB16      DY-AY-------------------YGQ---------------------------------
I2HW53      DY-AY-------------------YGQ---------------------------------
G9QKR4      YY-YY-------------------YGDK--------------------------------
D5DBK3      YY-YY-------------------YGSN--------------------------------
D5DY81      YY-YY-------------------YGSN--------------------------------
Q2BFS5      YY-YY-------------------YGGK--------------------------------
A4ITF3      GY-YQ-------------------YQYK--------------------------------
C5D961      YY-YY-------------------YRYK--------------------------------
G8MZ93      YY-YY-------------------YQYK--------------------------------
F0G6H5      --FARGPGHGYGYGNAETHQAASGYAGMMAHRPAGAGGKGDR------------------
F2I4B7      --YYY-----YE------------------------------------------------
Q74BQ8      YGYGYGYGGYGPSAEPAEARSTAEKTGKLSRILGKRGSK---------------------
F0JCB8      YYHYAS------------------------------------------------------
Q314L3      YGYGYGYGGY--GSGA--------------------------------------------
B5EA81      YSYYRS------ADNA--------------------------------------------
C6DZX5      YSYYRS------ADNA--------------------------------------------
A1ARV8      YYSYRSYAAVSPGESA--------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      --YYYSYNYSYENADR--------------------------------------------
B9Y884      YSDSQKKTAQKKKKNSIMSSITKKGDKKK-------------------------------
A5Z5P9      NGK---------------------------------------------------------
Q1AUN8      R-----------------------------------------------------------
F0SX22      KYYR--------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ---------------------DNKKKKLKVRS----------------------------
Q8XN76      ---------------------DNKKKKLKVRS----------------------------
B1BNK1      ---------------------DNKKKKLKVRS----------------------------
B1V0N7      ---------------------DNKKKKLKVRS----------------------------
Q0SVR8      ---------------------KKD------------------------------------
B1BNH3      ---------------------KKD------------------------------------
Q8XN46      ---------------------KKD------------------------------------
B1V1Z4      ---------------------KKD------------------------------------
G5GFW0      KYYGGRNKYKYSKDTEQAGRSKWIQRDKAER-----------------------------
C2EFR6      YYHK--------------------------------------------------------
F3ATF5      YYHG------YQEKKEV----TKKNKEK--------------------------------
D4M2S0      YY--------YGKSKQE-------------------------------------------
F4BS19      ----------YAKEKELDSVG---------------------------------------
D4CG08      KYYG------YGAEK---------------------------------------------
D4MP30      KYYG------YGAEK---------------------------------------------
C6LCS5      NYYGKD------------------------------------------------------
B0P2G2      KYSYSY----YGESDTE----KNHPNT---------------------------------
D4MW29      KYSYSY----YGESDTE----KNHPNT---------------------------------
E5VMX8      KYSYSY----YGESDTE----KNHQNT---------------------------------
D4JMC2      NYYGNY----YGRDDDE----K--------------------------------------
D6E0V4      NYYGNY----YGRDDDE----K--------------------------------------
D6E330      NYYGSY----YGQSDKA-------------------------------------------
C4Z8M5      NYYGSY----YGRSDKA-------------------------------------------
D4JI67      NYYGSY----YGRSDKA-------------------------------------------
D3AC80      KYYGKYYGKYYGNYGEE----TKKQDKK--------------------------------
G5IFS3      KYYGKNYGN-YGDYGN--------------------------------------------
D4RX67      KYYGR-----YGHGGDS----TDSQKG---------------------------------
A6BIG7      KYTGY-----YGEYKY--------------------------------------------
C0C0F8      KYYGE-----YGKK----------------------------------------------
Q97EP8      YYYY------YGDEGEK----VKKHKDR--------------------------------
Q97ER5      YYYY------GHEEEN--------------------------------------------
D2RIR2      YYDY------YDENHVK----HHKKKGKREE-----------------------------
G0VNK6      YYYY------YDENHNK----KRKRR----------------------------------
I0GRR2      YYYY------YDEKHEK----HKGRHKSKQKD----------------------------
A0PZ02      YYYY------YGDEDEK---SKKRRKSKK-------------------------------
B1B736      YYYY------YGNEEEKSKTSKKRRKNEK-------------------------------
F6BI62      YYYY------YNNDGSK----HKRKRRKK-------------------------------
Q8RBS5      YYYY------YGDHKSQ----SKKRRKR--------------------------------
G2MWC2      YYYY------YDDNKPQ----HKKRRKR--------------------------------
B0K4N1      YYYY------YDDNKPQ----HRKRRKR--------------------------------
B0KAR5      YYYY------YDDNKPQ----HRKRRKR--------------------------------
E8UV29      YYYY------YDDNKPQ----HRKRRKR--------------------------------
C7ISF7      YYYY------YDDNKPQ----HRKRRKR--------------------------------
F7K9V1      --YYGAYYGKYYGKYYGKYYGNSEEGGLHAAVVQKGTKGAKAVKGEGNLHSHDNKSTRES
F7K8E9      --YYGAYYGKYYGKYYGKYYGNNEEGGLHAAVVQKGLKSGKAAKGEENTHSHEIKNGSDP
F7KL96      --YYGAYYGKYYGKYYGKYYGNNEEGGLHAAVVQKGLKSGKTAKGEENTHSHENKNGPEL
C9AAE5      --YYY-------------------------------------------------------
H7F6C8      --YYY-------------------------------------------------------
H7F5T6      --YYYPESEV--------------------------------------------------
E6PYQ3      --SGYGNYRKYYGTGYGKESGDYYSSGYISPAKKKKQQ----------------------
C1J9I3      ---GYG--YGYG-------YG-YGTNTGKK------------------------------
B1MZT1      ---GSG--YGYG-------YG-YGYGDAK-------------------------------
Q03W95      ---SAG--YGYG-------YG-YGETKA--------------------------------
B1R3V1      -------------------YY-HYYKKD--------------------------------
I5B296      --------IGYGYGYHKSGYG-YGYHQQR-------------------------------
D4YF13      ---GYG-------------YYEYYNV----------------------------------
E6U7N4      -------KYAYGHYRYKRYYT-EAYK----------------------------------
C0QCJ2      -------------------FKKYEYK----------------------------------
F2I6Z7      ---AY--------------YG-YGYRDEDIDSEDLQS-----------------------
C2MBF8      --------YGYG-------YGSYGYGSYGSYGSEKE------------------------
D3AE78      ---YYGGYYSKY-------YG-KNYVKYSGYGSGGSSGKAEKSEEKTEMKTAAAGGEENQ
Q39U17      --------ENYR-------YR-NYYAYYKDNGAQ--------------------------
B9M2X6      --------GHY-----------HDYYQHKQYAW---------------------------
A5G424      --------DRY-----------NYYYRYDAEKW---------------------------
E8WSZ5      --------ESL-----------SYYKHYQKTPAA--------------------------
C7LPS3      -------------------SS-YYYAE---------------------------------
C3WFM9      ----YGN-YGYYNNYYSYYQE-YYSDSNGNRKKHTVKKPKSKFGKFIHDIKEQYKRQFSG
D4YHG7      ---GYG--YGYG-------YG-YGYG-------QSETSK---------------------
A4J8V0      --------YYYY-------YY-YGEG-------SGDKKKGKKRGHKAACL----------
A8U9F4      -------------------YY-YYYGEGE-------------------------------
F4BSD9      -------------------YY-YYYGEE--------------------------------
F7V792      ---RYY--YGKEK------YG-YGYYRKSDYYGKHAAENAKS------------------
F6IR93      ---GY---------------G-YGYY-------GNDAN----------------------
G0M0F9      ---GY---------------G-YGYY-------GNDAN----------------------
F6ITB4      ---GY---YGYD-------NG-YGYY-------SNEDK----------------------
G0M1X9      ---GY---YGYD-------NG-YGYY-------SNEDK----------------------
G0LYN9      ---GY---YGYS-------SG-YGYY-------SDEDK----------------------
D7VC13      ---GY---YGYN-------SG-YGYY-------SDEDK----------------------
F9UMZ6      ---GY---YGYN-------SG-YGYY-------SDEDK----------------------
G7QCG1      --------SSY--------YS-SYYAACND------------------------------
I2Q341      --------SSY--------YS-SYYAACND------------------------------
H8YYB9      --------DGYY------------------------------------------------
I5AV01      ----YGRYGRYGRYGKYGRYG-KYYGHYGYYAASDDSKDSGKTKGEKAKKRKKK------
B0GAL3      ----YYSYYSYG-------SK-YGYG-------YGQNHENA-------------------
G1WUK2      ----YYSYYSYG-------SK---YG-------YGQNHENE-------------------
E0RZL3      YGNYYGKYYGKY-------YG-KYYGKYGEDNIDVPTKPNATVTDPEPDEDDLDELNYLA
F0K0J7      --D--G--YGYG-------YG-YGYG--------EEDEKKGLFGRKK-------------
Q1G8E4      --DGYG--YGYG-------YG-YGYG--------EEKEKKGLFGRKK-------------
D6S4X4      ---GYG--YGYG-------YG-YGYG-------EPEKEKKSIFSWMNK------------
D0DJH0      ---GYG--YGYG-------YG-YGYG---------AEKKKGLFGRKKSDDQ---------
C7XKF3      -GYGYG--YGYG-------YG-YGYG---------AEKKKGLFGRKKSDDQ---------
E3R264      -GYGYG--YGYG-------YG-YGYG---------AEKKKGLFGRKKSDDQ---------
D5GZJ8      -GYGYG--YGYG-------YG-YGYG---------AEKKKGLFGRKKSDGQ---------
C2EPK5      YGYGYG--YGYG-------YG-YGYGYGYGYGYGEEKKKKSWFSRLKK------------
A4ZGZ8      YGYGYG--YGYG-------YG-YGYG-------EEDKKKKGFFSRRKK------------
A8YX89      YGYGYG--YGYG-------YG-YGYG-------EEDKKKKGFFSRRKK------------
F0NWJ7      YGYGYG--YGYG-------YG-YGYG-------EEDKKKKGFFSRRKK------------
E4SMV5      -GYGYG--YGYG-------YG-YGYG-------EEDTKKKGLFSKFRK------------
F0TGY2      -GYGYG--YGYG-------YG-YGYG-------EEDTKKKGLFSKFRK------------
Q5FIC7      -GYGYG--YGYG-------YG-YGYG-------EEDTKKKGLFSKFRK------------
F2M2M6      -GYGYG--YGYG-------YG-YGYG-------EEDTKKKGLFSKFRK------------
G7M0Q3      -------------------KY-CYYE-------S--------------------------
G7M1R9      -------------------YY-YYYG-------TKDDEKKN-------------------
A6M2L9      -------------------YS-YYYG-------NDEDKDNL-------------------
G7M566      -------------------YS-NYYG-------NEEDKE---------------------
E0NHP4      ---GY---YGGY-------YG-GYYG-------GYYGTDDK-------------------
H1LCW3      ---GYG--YGYG-------YG-YGYG-------YGYDNEGK-------------------
C2JZS1      ---GYG--YGYG-------YG-YT------------TENQR-------------------
Q58Z10      ---GYG--YGYG-------YG-YG------------NESNK-------------------
G2KUP1      ---GYG--GYYG-------GG-Y-YG-------VDDK-----------------------
G8PE06      ---GYY--GGNY-------GG-Y-YG-------TGGK-----------------------
Q03GL8      ---GYY--GGYY-------GG-Y-YG-------TDNK-----------------------
E9SAU1      YGYKYG--YGYG-------YG-YSYG-------NNASVGSGKSNDNDE------------
Q38VG5      ---GY-----YG-------GY-YGGY-------YGAEESKK-------------------
F0HVF1      ---GYG--YGYG-------YG-YGYG-------YGEEKEKKGLFGRKK------------
G6F8G9      -----G--YGYG-------YG-YGYG-------YGEEKEKKGLFGRKK------------
C2EWM3      ---AYG--YGYG-------YG-YGYG-------YGYSSDNK-------------------
F8DRU2      ---AYG--YGYG-------YG-YG-------------ENTK-------------------
B3XL23      ---AYG--YGYG-------YG-YGYG----------EDAGK-------------------
F8KGP1      ---AYG--YGYG-------YG-YGYG----------EDTNK-------------------
H4GK03      ---GYG--YGYG-------YG-YGYG-------TVEPED---------------------
B2GF33      ---GYG--YGYG-------YG-YGY----------EDER---------------------
C0WW26      ---GYG--YGYG-------YG-YED----------ER-----------------------
D0DSJ4      ---GYG--YGYG-------YG-YEG----------DEE----------------------
C0ZHV8      --YYG-----YG-------YN------------A--------------------------
F8FCE2      --YQY-------------------------------------------------------
H6NE43      --YQY-------------------------------------------------------
I0BSG4      --YQY-------------------------------------------------------
Q83VF9      --YYY-----YG-------VE---------------------------------------
G8P3D7      --YYY-----YG-------VE---------------------------------------
O06030      --YYY-----YG-------VE---------------------------------------
G9M880      --YYY-----YG-------VE---------------------------------------
G6FD42      --YYY-----YG-------VE---------------------------------------
F9VC44      --YYY-----YG-------VE---------------------------------------
A9QSJ4      --YYY-----YG-------VE---------------------------------------
Q3ZK50      --YYY-----YG-------VE---------------------------------------
E3GPC6      --YYY-----YS-------AY------------EEDQHQSKKEKKHRKIKEKRGK-----
G0V447      --YYY-----YG-------EA------------EGKK-----------------------
H7F1R7      --YYY-----YQ------------------------------------------------
E3H7M5      SNYKY-----YD-------EY------------KKR------------------------
E6UHY4      YRYGYRYGYGYG-------YG------------YSYSRKPSDEGENDE------------
D9QTC6      --YNY-----YG------------------------------------------------
D9SR41      --YYY-----YY-------YG------------EKKAK----------------------
E3HB18      NNYRY-----YQ-------DY------------IKEDK----------------------
P95696      --YHY-----YG-------DE---------------------------------------
Q2G1K7      --YHY-----YG-------DE---------------------------------------
A8YPQ5      --YAY-----YG-------TD------------ES-------------------------
Q2FUV2      --YAY-----YG-------TD------------ES-------------------------
P39851      --YYY-----YG-------ED---------------------------------------
C5QNG4      --YSY-----YG-------EE------------E--------------------------
Q4L9H7      --YYY-----YG-------ED------------E--------------------------
A7NQ71      --YGY-----YA------------------------------------------------
E4Q5T5      --YYY-----YY-------YY------------YYYYTDESGETVKKKKVGRRRKKDDRY
E4SDX4      --YYY-----YY-------YY------------YYYYQDENGEVVKKKKTGRRRKKDDRY
E4S7Y6      --YYY-----YY-------YY------------YYYYQDDSGEIIKKKKGERRKKRKERY
C6CS80      --YYE-----YV-------DR------------T--------------------------
E6LD64      --YYY-----YG-------S----------------------------------------
F0EKB9      --YYY-----YG-------N----------------------------------------
H7F571      --YDY-----S-------------------------------------------------
F5LE48      --YSY-----YG-------ES------------K--------------------------
E7RDR3      --YYQ-----YY-------GN------------AE-------------------------
E7RG08      --YAQ-----YY-------TR------------APNEK----------------------
G2FWX4      --YYY-----YE-------YN------------ESKH----PKKRHRRHKAG--------
G2FM59      --YYY-----YY-------YY------------NASDD---TKKKHNRRSL---------
G7WJV1      --YYY-----YN-------YY------------NSAKD---M------------------
H5XZD4      --YYC-----YN-------YY------------NAADD---TKKKQSKMAYL--------
H5XZG7      --YYY-----YY-------YY------------HGSDD---PGKKRKSRGNP--------
G7W773      --YYY-----YY-------YY------------HGSDD---PKKKRTRKNRS--------
G2FWT8      --YYY-----YY-------YY------------HGSDD---SAKKPKRHKAR--------
I4DBG8      --YYY-----YY-------YY------------HGSEDPNESKRKHKRQRAH--------
C0EBA6      --YYR-----YM-------KY------------KSYKE----------------------
Q9K6R0      --YYY-----YG-------ES------------DR-------------------------
I2HVL2      --YSY-------------------------------------------------------
D4G1R2      --YSY-------------------------------------------------------
G4EQZ7      --YSY-------------------------------------------------------
P71051      --YSY-------------------------------------------------------
E0U2Z3      --YSY-------------------------------------------------------
G4P114      --YSY-------------------------------------------------------
A9VRC3      --YYY-----YG-------AN---------------------------------------
C2RG49      --YYY-----YG-------AN---------------------------------------
C2T8T6      --YYY-----YG-------AN---------------------------------------
C2MTG3      --YYY-----YG-------AK---------------------------------------
C2SSX8      --YYY-----YG-------AN---------------------------------------
C2YZB2      --YYY-----YG-------AN---------------------------------------
C3GBJ8      --YYY-----YG-------AN---------------------------------------
C2SBU4      --YYY-----YG-------AN---------------------------------------
C2NQN6      --YYY-----YG-------AN---------------------------------------
C3GRR0      --YYY-----YG-------AN---------------------------------------
C2PN22      --YYY-----YG-------AN---------------------------------------
C2Y452      --YYY-----YG-------AN---------------------------------------
C2WVG6      --YYY-----YG-------AN---------------------------------------
C3EBC0      --YYY-----YG-------AN---------------------------------------
C2XJH9      --YYY-----YG-------AN---------------------------------------
C2P8H3      --YYY-----YG-------AN---------------------------------------
C2ULR6      --YYY-----YG-------AN---------------------------------------
C2V4M2      --YYY-----YG-------AN---------------------------------------
C3H979      --YYY-----YG-------AN---------------------------------------
G2TR25      --YYY-----YG-------KD---------------------------------------
P96716      --YGY-----YG-------TK------------DNFMQK---------------------
G4EQF3      --YGY-----YG-------TK------------DNFMQK---------------------
D4G2E1      --YGY-----YG-------NK------------DNFMQNK--------------------
I0F9R6      --YGY-----YG-------NK------------DNFMQNK--------------------
E0TTZ6      --YGY-----YG-------NK------------ENFIQNK--------------------
G4P1M7      --YGY-----YG-------NK------------ENFIQNK--------------------
A8FHL9      --YMY-------------------------------------------------------
Q5KUM5      --YYY-----YQ-------YK---------------------------------------
D3FZP4      --YYY-----YG-------DK---------------------------------------
I0JRK4      --YYY-----YG-------N----------------------------------------
I3EBB3      --YYY-----YG-------GK---------------------------------------
E3CP62      GSYGEYGKKENKKKVIQEHIVVEKDSVNGDNAAPYALIFKEELRVKEKQEIRRIEIGVVQ
C2KHF1      ------------------------------------------------------------
I0UTA5      SYVGYATY----------------------------------------------------
B7BDT8      GYK---------------------------------------------------------
G9WIQ9      TTTNVMSSDAMKRASNAQVHQNTHHHRPEKKSETVQNQAKSTEVTPTKAVVEPTKVWSSF
A0NKF6      TSTNVMKTNDASKASSSKTAPAKPKVPKASVTDTDASKVEQQVPSDVKKEAAHSTAVAEK
Q04DV8      TSTNVMKTNDASKASSRKTAPAKPKVLKASV--TDASKVEQQVPSDTKKEASRPNAAASK
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      ------------------------------------------------------------
A3K8W7      ------------------------------------------------------------
G7EJX6      ------------------------------------------------------------
B7B947      GYGYGQRKKK--------------------------------------------------
D3LB10      ASTNMMKTDDVSKDASRHSTPVKAETQSTSLKNTEQLKHAAAKESSPSPKAQAPKSGRFF
S9QRP1      ------------------------------------------------------------
G8AU96      YALHAPARH---------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      GKEKAAEEDVIAEDDMIQLDMDMVELVEDTELIEELK-----------------------
F7K8E9      VKEKIPEESQIPEDDMIQLDIDMVELTEDTEPIEELR-----------------------
F7KL96      VKEKNPEESLVPEEDMIQLDIDMVELVEDTEPIEELK-----------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      VKRSRRRK----------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      DLKGKK------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      GVMRKD------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      TLPSDGRR----------------------------------------------------
E4SDX4      TLPSDGGR----------------------------------------------------
E4S7Y6      TAPVESKN----------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      LVVVVFAAWLASKLPYTEITKGSMVILGVVHVVTYYISSYYENLKYRGYLDELIATVKYG
C2KHF1      --------------------------------YGYGYGYGDTKSKWLINRHDRERRKRLM
I0UTA5      --------------------------------YGYSKDGTKKKVKSRKKAKK--------
B7BDT8      --------------------------------YGYAYGYGSKSYYNN-------------
G9WIQ9      EA------------------------------TNRIASRQTKTPPAPSAAANEETTAKVL
A0NKF6      KTVTAASKTAPTSAPKSSWSS-----------FSYTSTGSEKSEASSKAKEPGPNNAQEI
Q04DV8      ------------TAPKSSWSS-----------FSYTSTGSEKSEASSKAKEPGPSNVQEI
F4SM97      --------------------------------NHYGYNYGEDK-----------------
G5Q4J0      --------------------------------YEYEYQSDSK------------------
G5LQM6      --------------------------------YEYEYQSDSK------------------
G5SDT8      --------------------------------YEYEYQSDSK------------------
F3CAY9      --------------------------------YGYNYHPAPR------------------
A3K8W7      ------------------------------------------------------------
G7EJX6      --------------------------------YDYHDYSQKPEQPTA-------------
B7B947      ------------------------------------------------------------
D3LB10      NKETVQETPRAPRVKKPQASW-----------SSFSYTSSGSEKSEIPKETEKPGPSGA-
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      FIFALVVTFLSFFADGDFSISRRGLLYVTLITCTLLYLTNTLLRYFRSSIYTRRKGNKNI
C2KHF1      VYRRFLKRFFDLLLAFFLFLILLLPLLIIALIVKLTSKGPILFIQERYGRNSRPFKLYKF
I0UTA5      ------------------------------------------------------------
B7BDT8      ------------------------------------------------------------