BYKdb

Dataset for cluster tadcd of phylum candidatus-kryptonia

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S4MUQ7      MEKIGTNGQTFFQ-EEETINLYEVIQVLYRGKWLIILIFILVVLATAIFTFMQDPIYEST
A0A0N7MUP1      MEKINTNGQTFFQTEEETINLYEVIQVLYRGKWLIILVFILVVLATATFTFMQDPIYEST
A0A0P1MWA2      MEKTNVNGQPFFQTEEETINLYEVIQVLYRGKWLVILIFILVVLATAIFTFMQDPIYEST
                *** ..***.*** ********************:**:********* ************

A0A0S4MUQ7      AVILIEKGKKGLGLAQAFDITGFSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVEPEKK
A0A0N7MUP1      AVVLIEKGKKGVGLTEAFDITGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVDPENK
A0A0P1MWA2      AVVLIERGKKGLGLTEAFDITGLSEQRNIKNEIEILKSRSLAEAVAKKLIDRVYVDLNDK
                **:***.****:**::******:***************************:****: :.*

A0A0S4MUQ7      SDTILVILPSRKELKEGIKPFAKIETIIERFEKNVKIESPRDADIIKITARSKNPKEAAL
A0A0N7MUP1      KDTILVILPSKKELKEGIKPFAKIETILERFKEDVKIESPRDADIIKITVRSKNPKEAAL
A0A0P1MWA2      KDTILIIKPSRKELKEGIKPFAKIETIIERFEKDVKIESPRDADIIKITVRSKNPKEAAL
                .****:* **.****************:***:::***************.**********

A0A0S4MUQ7      IANTFADAYYERNLMMSRNESRSVRKFLEEQLADKRKQLDQAENQLESYMKSAGVVALDE
A0A0N7MUP1      IANTFADSYYESNLMMSRNESRSVRMFLEEQLAEKRKLLRQAEAQLENYMKQAGVVALDE
A0A0P1MWA2      IANTFADAYYERNLMMSRNESRSVRKFLEEQLADKKKLLDQAENQLESYMKSAGVVALDE
                *******:*** ************* *******:*.* * *** ***.***.********

A0A0S4MUQ7      ESKKLIEQLSNLESARGEAIVDISAAKKKLDSYLEQIKQIEPEFVKVATEALDPYIKYLQ
A0A0N7MUP1      ESKELIKQLSDLESKRGETIVDISSAKRKLDSYLEQIKQIEPEFVKVATEALDPYIKYLQ
A0A0P1MWA2      ESKKLIEQLANLESKRGEAIVEISSAEKKLNAYLEQIKQIEPEFVKVATEALDPYIKYLQ
                ***:**:**::*** ***:**:**:*:.**::****************************

A0A0S4MUQ7      EEIAKLEVTRDQIIAQNPKVGSQEVLNKSLREIDEQLASLRKKLQEKIAEFLKTGFASSG
A0A0N7MUP1      EEIAKLEVTRDQIIAQNPKVGSKEVLNKSLREIDEQLASLRKKLQDKISEFLKIGFASSG
A0A0P1MWA2      EEIAKLEVTRDQIIAQNPKVGSQEVLNKSLREIDEQLASLRKKLQEKIAEFLKTGFASSG
                **********************:**********************:**:**** ******

A0A0S4MUQ7      SPGTQTYDPTGFVKELKQKILLTEIELSAYEARKKEIEKLIEQLNRKFETIPAKLIDYAR
A0A0N7MUP1      SPGTQSYDPTGFVKELKQKILLTEIELSAYEARKKELDRLIEQLNKKFETIPSKLIDYAR
A0A0P1MWA2      SPGTQTYDPTGFVKELKQKILLTEIELTAYEAKKRELERLIEQLNRKFETIPAKLIDYAR
                *****:*********************:****.*.*::.******.******:*******

A0A0S4MUQ7      LERARMSAEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGVRPVSPKVHLNLILSIII
A0A0N7MUP1      LERTRLSNEKLYLLIEEKYQEAMIAERSQFGYVQIIDYATPGIKPVSPKVHLNLIIGIVL
A0A0P1MWA2      LERARMSSEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGLKPVSPKIHLNLILSIIV
                ***:*:* ******************.***************:.*****:*****:.*::

A0A0S4MUQ7      GLGLGVGIVFVKEYFDRSVKTPEQLEKRGFTVLSAIPVIEIEAKLDGKQLRKDEGRNIAA
A0A0N7MUP1      GLGLGVTIVFVREFFDRTVRSPEQLEKRGFTVLSAIPVIEVEVKLDGKQLKKDEGRNIAA
A0A0P1MWA2      GLGLGVGIVFVKEYFDRTIKTPEQIEKRGFTVLSAIPIIEVETKLDGKQLKKDEGRNIAA
                ****** ****.*:***::.:***:************:**:*.*******.*********

A0A0S4MUQ7      HLITHLSPKSPVAEAYRVMRTGIQFAKLDKKIKSIVVASSAPKEGKSTTASNLAITMATA
A0A0N7MUP1      HLITHLNPKSPVAEAYRVLRTGIQFAKLDRKIKSIVVASSAPKEGKSTTSSNLAITMAKA
A0A0P1MWA2      HLITHLSPKSHIAEAYRVLRTGIQFAKLDKKIKSIVVASSAPKEGKSTTASNLAITMASA
                ******.*** :******:**********.*******************:********.*

A0A0S4MUQ7      GLKTVLVDTDLRRPVLHRVFNVPREPGLTDYLFDRADVQEIFKQTEVENLYLVPCGVVPP
A0A0N7MUP1      NLKTVLVDADLRRPVLHRVFGVKREPGLTDYLFERAELDEIFRKTDIENLYLIPCGVVPP
A0A0P1MWA2      GLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAEIEEIFKQTEVENLYLVPCGVVPP
                .*****:*:***********.* ********** **:::***.:*::*****:*******

A0A0S4MUQ7      NPAELLGSEKMKEFVEYLKLNYDFVVFDTPPLVAVTDALILASQVDSVLLVASAGKTEID
A0A0N7MUP1      NPSELLGSEKMKKFVEYLKSNYDLVVFDTPPLVAVADALILANQVDGVLLVASAGKTEID
A0A0P1MWA2      NPAELLGSEKMKEFIEYLKLNYEMVIFDTPPLVAVTDALIIASQVDGVLLVASAGKTEID
                **:*********:*:**** **::*:*********:****:*.***.*************

A0A0S4MUQ7      VLEKAREMVQRVGGNVIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADRDKSRG--
A0A0N7MUP1      VLDKAREMIQRVEGNVIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADREKGEGNA
A0A0P1MWA2      VLDKAREMIQRVGGTVIGVLLNNFDASSTYGTYYRYYRYYRYYDYYGADRDKGEGKK
                **:*****:*** *.************:**********************:*. *  

© 1998-2020Legal notice