BYKdb

Dataset for cluster orphancd of phylum candidatus-rokubacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

55 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      MPRVFGHYVPARLLTLAAGEAAIVFGSVFLGLALPLVGFHVIRPAWGDGFAPSMVLTTLV
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      LSMAHIAALYDTRQDYGRAELLLRLTIAFVAAYLVIAMLGYFILHLTLARKAFLLSFVTA
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      FPASFLLRLVHGRLTAQSRARRKVLLLGSGEVSQMIAATVRASRHTYEVVGRLDANGRGG
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      DGSDGVWSLGTLEDLDWVSKVTRPDVIVVALEERRGTLPVSEIVESKLQGTEIEDWPNFY
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      EKLTGKIPVGNLRPSWLVFADGFKPARITVLTKRTIDLLGSLCVVMLSLPVMLLIAVAIR
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      LDSPGPVFFRQERLGRFGRVFLMFKFRSMLQGEGAALPSPTGGQAGHHGLGPGQEPVRCD
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      -------------------------------------------MDQPKSSEYVRLLRRVA
A0A2V7A3P7      RREHLGQIGIRPLLHQEHVDLSRHADPAPHRPDRAFHEGIRRMEAKTSSVDYVRLLRRVA
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      --------------------MVRGRTRGGGTSLGYRLPPGGETPPGEEWRGYFGSIKRRK
A0A2V7AVY2      -----------------------------------------MDAKTTGSIDYLRLVRRVV
A0A2V7C3J3      -----------------------------------------MDAKTTGSIDYLRLVRRVV
A0A2V6VAA8      -----------------------------------------MDAKTTGSIDYLRLVRRVV
A0A2V7CNK3      -----------------------------------------METQKQGSVDYLRLLRRVA
A0A1Q7TX95      ----------------------------------------MVEELSGPHVGYLGLLRRIA
A0A2V7B9E3      ----------------------------------------MVEELSGPHVGYLGLLRRIA
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ---------------------------------------MVEESTTSPDVDYLRLLRRIA
A0A2V7A9S9      ----------------------------------------MAPEDADMYLNFYALTEKPF
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      -----------------------------------------------MYLTFYGLKEKPF
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      TNRWRLVLAGFLAVALPTIVWAVFLTPDTYEATATLFLL-PEKSDPGFLREFATLEVN--
A0A2V7A3P7      IQRWRLILAGFLAVVLPTMVIVILSTENLYEASATLFIL-PETSDAGFLRDFTSSEAS--
A0A2V6T785      ---------------------------MVSKFFKALEQAERDRVEREGQGTKSPLAEP--
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      RLVILVTLAGTALGVVATKLVAPYLPFYSATANIWIDGSGHRPDRDQATAGPIHSGQLLG
A0A2V7AVY2      VHRWRIIVAGFLVVVVPTVALVTLSTENLYEASVTLFLL-PEKNDPPFLREFTSPEAT--
A0A2V7C3J3      VHRWRIIVAGFLVVVVPTVALVTLSTENLYEASVTLFLL-PEKNDPPFLREFTSPEAT--
A0A2V6VAA8      VHRWRIIVAGFLAVVVPTVAVVSLSTENLYEASATLFLL-PEKSDPPFLREFTSPEAT--
A0A2V7CNK3      LQRWRVIVVGFLAVVVPVAILVSFSTENLYEASATLFLM-PEKNDPPFLREFTTPEAT--
A0A1Q7TX95      -SHWRLSLIVCVGVAAPVAVWALLFLPKSYEAVAAIFIEDPRRGSVSTLRDWMPAGDA--
A0A2V7B9E3      -SHWRLSLIVCVGVAAPVAVWALLFLPKSYEAVAAIFIEDPRRGSVSTLRDWMPAGDA--
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      -NRWRLIALISLAIVLPVTAYAVVFVPKMYEAVAKIFFEDPRRLQAGMMRDWMPASDA--
A0A2V7A9S9      NPTPDPKFLYMSPAHREALAQLSYGVQERRGFMLLTGKVGTGKTTLLHALRKRLTSQT--
A0A2V6SIE8      --------------------------------------------AYYGTQFELLSSRP--
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      NATPDPRFLYLTPGHREALAQLLYSVQESRGFLVLTGEVGTGKTTLLQAFLQRLNGRA--
A0A2V7BAF4      ----------------------------MSEFFRALEQAGRDRDERLAK--QRNNRKL--
A0A2V7E6Z5      ----------------------------MSEFFRALEQAGRDRQEQLAK--QRNERKP--
A0A1Q6YM61      ----------------------------MSEFFRALEQAGRDRDERLAK--QRNNRKL--
A0A1Q7IM35      ----------------------------MSEFFRALEQAGRDRDERLAK--QRNNRKL--
A0A1Q7UA97      ----------------------------MSEFFRALEQAGRDRDERLAK--QRNNRKL--
A0A2V7DAK1      ----------------------------MSEFFRALEQAGRDRDERLAK--QRNNRKP--
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      --------------------------------TLYQVILRSRSLAQGVVETLPKESRDEL
A0A2V7A3P7      --------------------------------SLYLVLLRSRSLAQAIMEALPNESRDEL
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ASGWVNLARSYVVLDSVARGLRLYVGWEAEQDSAALWSLGLKTQFRSGEYRLEVDSSGRR
A0A2V7AVY2      --------------------------------AVYIVLLKSRSLAQAIIEALPKESREEL
A0A2V7C3J3      --------------------------------AVYIVLLKSRSLAQAIIEALPKESREEL
A0A2V6VAA8      --------------------------------AVYVVLLRSRSLAQAIIEALPKESREEL
A0A2V7CNK3      --------------------------------AIYIVLLRSRSLAQAITEALPKESRDEL
A0A1Q7TX95      --------------------------------SYQQAVLRSRSLAAAVVDNLPQDSMNEL
A0A2V7B9E3      --------------------------------SYQQAVLRSRSLAAAVVDNLPQDSMNEL
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      --------------------------------SFQLAILKSRSLAEAVVENLPRETTEEL
A0A2V7A9S9      --------------------------------AISFVFNTTLPFDGILEYILEDLGIAKG
A0A2V6SIE8      --------------------------------VLG----------------------RVE
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      --------------------------------------------------------MPPP
A0A2V7F4L5      --------------------------------AVAYVFDSTLPFDGLLEYVLEELGVPTP
A0A2V7BAF4      --------------------------------PVA----------------------AEP
A0A2V7E6Z5      ----------------------------------A----------------------AEP
A0A1Q6YM61      --------------------------------PVA----------------------AEP
A0A1Q7IM35      --------------------------------PVA----------------------AEP
A0A1Q7UA97      --------------------------------PVA----------------------AEP
A0A2V7DAK1      --------------------------------PVA----------------------AEP
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      SRRIGFQDHALIVMNQIRRWQGQEVVVYSPTELATRELRESRMNFNIAKDGT--------
A0A2V7A3P7      SRRVIFRDYLLTVMNSIRRYTGGAVVVYSPSEVAIRELQEARMSFVLGKDGT--------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------MGTTVKPDVVETTVLAAAPQDA--------
A0A1Q7G9Y1      FRLLTAKGAELQRGMVGDSIGGAVGFVWVPPASALTPRRTIRFTVSSPYDAATNLAQRLQ
A0A2V7AVY2      TKRVLFRDYLLTATNSLRRLTGGEVVVYSPSELAIRELQEARMNFNIARDGT--------
A0A2V7C3J3      TKRVLFRDYLLTATNSLRRLTGGEVVVYSPSELAIRELQEARMNFNIARDGT--------
A0A2V6VAA8      TKRVLFRDYLLTATNSLRRLTGGEVVVYSPTELALRELQEARMNFTIARDGT--------
A0A2V7CNK3      TKRVLFRDYLLTFMNSIRRFTGGEVVVYSPSEIAIRELQEARMSFNVARDGT--------
A0A1Q7TX95      IRHAMHRDYVLAGQNLIRRLLGHEPVVFSPQQRAVRELLTARVRFESLPSGE--------
A0A2V7B9E3      IRHAMHRDYVLAGQNLIRRLLGHEPVVFSPQQRAVRELLTARVRFESLPSGE--------
A0A2V6RAF2      ----------------------------------MTELQSARVTFTPLPSGE--------
A0A2V6UHF5      LARAMHRDYLLEGRNLFRRAMGQDSIIYSPQQRAVTELQSARVTFTPLPSGE--------
A0A2V7A9S9      LESRAQRLIALQHFLVDRERAGENTVLIFDEAQNLDAATLEQIRLLSNFETP--------
A0A2V6SIE8      AALGLPKHPAFAAGGWFGR-AGQSSSFEGLDRYIEVTPVKRSRLVRITARVP--------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      PAPEETEDLALASPLTSAV-----------LSRLSIEPVRSSRLVRISFESH--------
A0A2V7F4L5      ERSPAQRLLALQRFMLDRRRAGQNTVLVLDEAQNLDAPTLERIRMLSNYETP--------
A0A2V7BAF4      PAQPEPEVPVVAKASKPRK-----------ESQPAAAPKAT--------PTP--------
A0A2V7E6Z5      PAQPEPEVPVVAKASKPRK-----------ESRPVVAAKPS--------PRP--------
A0A1Q6YM61      PAQPEPEVPVVAKASKPRK-----------ESQPAAAPKAT--------PTP--------
A0A1Q7IM35      PAQPEPEVPVVAKASKPRK-----------ESQPAAAPKAT--------PTP--------
A0A1Q7UA97      PAQPEPEVPVVAKASKPRK-----------ESQPAAAPKAT--------PTP--------
A0A2V7DAK1      PAQPEPEVPVVAKASTPRK-----------ESQPAAAPKAT--------PTP--------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ---------VTLTATAFSPRVAADLANTYVEVLLSRSSSFARQQARGTRELLESLFTQAR
A0A2V7A3P7      ---------VTITAVAFSPRVAMDLANTYVEVLLSKSSSFARQQARGTRDLLENLWSQAK
A0A2V6T785      ---------------PAAPDASSARPSDTPHPVVAPETAASVAIPGPPVDVGDIGRSPTV
A0A2V6RB03      ------------------------------------TSRAGQDAARRGGIVLPRAPGSVD
A0A1Q7G9Y1      VELDPDGNFMQVSLRGSDPAYIAATVNAVATRFVDVATDLKRKRLGELTKILAAQLEHAQ
A0A2V7AVY2      ---------VTITAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLMAQAR
A0A2V7C3J3      ---------VTITAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLMTQAR
A0A2V6VAA8      ---------VTITAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLESLMTQAK
A0A2V7CNK3      ---------VTITAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLLAQAK
A0A1Q7TX95      ---------VEIRAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATRQFIENLLAQTK
A0A2V7B9E3      ---------VEIRAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATRQFIENLLAQTK
A0A2V6RAF2      ---------VEIRAVAYAPRVAMDLANTYVEVLQTRSRSNIRDEARTSREFIETLLNQTK
A0A2V6UHF5      ---------VEIRAVAYAPRVAMDLANTYVEVLQTRSRSNIRDEARTSREFIETLLNQTK
A0A2V7A9S9      -----------------TDKLLQILLVGQP---------------ELRAKLSLPELQQLK
A0A2V6SIE8      -----------------DADLAAAIPNRVATEYIGMLSQERREASDAAAKWLESQLGGLR
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------DAFIAQQMDRMVEATRYATQFLAKQLEEAR
A0A2V6U1W4      -----------------FPDLAARVPNALADAFIAQQLDQKVEATRYATQFLATQLDETR
A0A2V7F4L5      -----------------TVKLLQILLVGQPELGCGRTRPRALQSPGSDPDCRLLGRDPAP
A0A2V7BAF4      -----------------APEVVATAPASTP-----RKESQPAAAPKATP-------TPAP
A0A2V7E6Z5      -----------------EPEAAAVVPTSTP-----RNEPGPSAAVEP-------------
A0A1Q6YM61      -----------------APEVVATAPASTP-----RKESQPAAAPKATP-------TPAP
A0A1Q7IM35      -----------------APEVVATAPASTP-----RKESQPAAAPKATP-------TPAP
A0A1Q7UA97      -----------------APEVVATAPASTP-----RKESQPAAAPKATP-------TPAP
A0A2V7DAK1      -----------------APEVVATAPVSTP-----RKESRPAAAPTPTP-------TPEP
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      TGQVDAQDALRKFQSQTGAAVKLPDEARVDLQRL--------------------------
A0A2V7A3P7      ANQTEAEDALRKYQAKNGGTLKLPEEAKVELTSL--------------------------
A0A2V6T785      EHARVPAPRAADAPA---------------------------------------------
A0A2V6RB03      PQVERSRGRRPR------------------------------------------------
A0A1Q7G9Y1      ANLRSAETALRSFQVRTATVLPGSAIIPPEALAPGANAPPPRRPPVSDLVGQSRDPVFAN
A0A2V7AVY2      SSQGEAEDAMRRFQAKAGGRFTLPDESKGELTAL--------------------------
A0A2V7C3J3      SSQGEAEEAMRRFQAKAGGRFKLPDESKGELTAL--------------------------
A0A2V6VAA8      MSQGEAEDAMRRFQAKTGGRIKLPEESKSDLTAL--------------------------
A0A2V7CNK3      SHQGDAEEAMRRYQQRTSGSLKLPDESRGTVTAL--------------------------
A0A1Q7TX95      ANLQEAEESLAKHQR--GGTLKLPERSSVEMAQL--------------------------
A0A2V7B9E3      ANLQEAEESLAKHQR--GGTLKLPERSSVEMAQL--------------------------
A0A2V6RAF2      TSLQQSEEQLAKVAR--GRSLRMPERNAIEAAQL--------------------------
A0A2V6UHF5      TSLQQSEEQLAKVAR--GRSLRMPERNAIEAAQL--------------------------
A0A2V7A9S9      QRIGLRCQIPPLAP--------------EEVRQY--------------------------
A0A2V6SIE8      SGSEATGGAVQRFVEQNDMVPS------QDGKEF--------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      GKLGESETQLSNFLNANGIIFVTADRN-GNPQDI--------------------------
A0A2V6U1W4      DRLGEAEGKLNRFLKANNILFIAGGDKTSQAQDL--------------------------
A0A2V7F4L5      REHSVRPL--PR----------------RRLRRP--------------------------
A0A2V7BAF4      EVVAVAPTITPR----------------NETRPP--------------------------
A0A2V7E6Z5      ---PVPPHVEPA----------------IYVEPE--------------------------
A0A1Q6YM61      EVVAVAPTITPR----------------NETRPP--------------------------
A0A1Q7IM35      EVVAVAPTITPR----------------NETRPP--------------------------
A0A1Q7UA97      EVVAVAPTITPR----------------NETRPP--------------------------
A0A2V7DAK1      EVVAVAPTITPR----------------HETRAP--------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      -----TQLETSLSDVQVSREIAENRLNYLKGDRKSGPPTG-----DASVQPVRERVAQLE
A0A2V7A3P7      -----ANLESQLNDLQINREIAENKLAYLKGDKKK--PGGMTLAADPSVQALRDRLAQLE
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      -----TTIAHRLQDERPSNEVFCHLSRE--------------------------------
A0A1Q7G9Y1      FLDIRVALDQLKHDRAAIERVLAQSADSGLAVDAL--ELVGSVERSSELTDALKELVGKR
A0A2V7AVY2      -----AQIESQIGDLQVTREIAENKLGYLKGEKVR--PISAPASSDPSTQSLQERLTQLE
A0A2V7C3J3      -----AQIESQIGDLQVTREIAENKLGYLKGEKVR--PISAPASSDPSTQSLQERLTQLE
A0A2V6VAA8      -----AQLESQLGDLQVTREVAENKLTYLKGEKSR--PGSPTASADSSTQGLQERLTQLE
A0A2V7CNK3      -----AQLEGQIADLQVSREIAENKLAYLKGDKPR--AGGAFPGSDPATQSLQDRLTQLE
A0A1Q7TX95      -----AQLESNLADIQASEEIAKRRLAGLKGGKD-----SAGMPGRAARQALSERLAALE
A0A2V7B9E3      -----AQLESNLADIQASEEIAKRRLAGLKGGKD-----SAGMPGRAARQALSERLAALE
A0A2V6RAF2      -----SQLENSLAEIQGSKEIAKVRLAQLKGKDA-----SGRPVPQAAQQQVTRRLLQLQ
A0A2V6UHF5      -----SQLENSLAEIQGSKEIAKVRLAQLKGKDA-----SGRPVPQAAQQQVTRRLLQLQ
A0A2V7A9S9      -----IRRRLRIAGSHDLGLFSDAAVDRLTEYSG-----GIPRVIN------------MV
A0A2V6SIE8      -----ALTQLEDLNRAYTEAENDRLQKEARARML-----TSADPATAGAALGSDLVRGLQ
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      -----ITQQLSIMSEAFLRARSDRMAKESLLTQA-----SVQDAFTLPAVLQSPLIAQLK
A0A2V6U1W4      -----ITQQLTLLSDGWLKARSERIAKESLLAQG-----NTQDVGTLPAVLQNSLVSKLR
A0A2V7F4L5      -----AATDRRRYCRPGHRGARGCGAASGALARF-----AGPGSVG--------------
A0A2V7BAF4      -----VAVETPAPVEPELATVEAAVATEV--EPE-----PEPEIAT--------------
A0A2V7E6Z5      -----VLVATA--------------------------------VAT--------------
A0A1Q6YM61      -----VAVETPAPVEPELATVEAAVATEV--EPE-----PEPEIAT--------------
A0A1Q7IM35      -----VAVETPAPVEPELATVEAAVATEV--EPE-----PEPEIAT--------------
A0A1Q7UA97      -----VAVETPAPVEPELATVEAAVATEV--EPE-----PEPEIAT--------------
A0A2V7DAK1      -----VAVEIRAPEPEMVATIEAAVATEVEPEPE-----PEPEIAT--------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ARLDGLKEKYTEQHPLVQVARADLQEAQERLKSTVQGQQTPRPGGV-V-ALKPLEAAQLS
A0A2V7A3P7      TKLAALTEKYTDQHPSVQNAQADIQETQQRLAAALQPQQSPRPGGAQV-PLRPVENAQLS
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ADLRALRYRYTETNPEVRRVAGTIGTLERQTIPA--------------------------
A0A2V7AVY2      AKLAALSEKYTDQHPSVQTTRAEIQETQERLASTLQPRQTPRPGGTAT-QLKPIEAAQLS
A0A2V7C3J3      TKLAALSEKYTDQHPSVQTTRAEIQETQERLASTLQPRQTPRPGGTAT-QLKPIEAAQLS
A0A2V6VAA8      AKLAALAEKYTDQHPSVQTARAEIQETQERLASALRPRQAPKPGGASA-SLKPIEAAQLS
A0A2V7CNK3      AKLSALNEKYTDEHPSVQTTRAEIQEAQERLASALRPRQAPKPGGAPA-PLKPLEAANLV
A0A1Q7TX95      AKLATLEEKYASEHPLVKSTQAEINELKTALAAP--PSISPGGRSAIRLTLGPADQAAVA
A0A2V7B9E3      AKLATLEEKYASEHPLVKSTQAEINELKTALAAP--PSISPGGRSAIRLTLGPADQAAVA
A0A2V6RAF2      EKLAGLRERYTDGHPLVKATQAEIKDAQDMLTAG--PQGLPERVAAPQ--FGAAERAASA
A0A2V6UHF5      EKLAGLRERYTDSHPLVKATQAEIKDAQDMLTAG--PQGLPERVAAPQ--FGAAERAASA
A0A2V7A9S9      CDHSLVFGYADQKRRIDRPIVNQAIEYLEEGASPSSQPKAVKLNGSRV----------RL
A0A2V6SIE8      AEEARLEREVARAGTTYGPQHPKMVELQADLANAKKRVETEIGKGRS-------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      TDGAAQEGEYRRLSQTFKPDYPKMLALKEKIEENRRQLRTETDRTLA-------------
A0A2V6U1W4      EDLAALESEYEKLSQVFKPGYPHMRQLAEKIAESRRQLRTEIDRAAQ-------------
A0A2V7F4L5      ---TLALG----------------------------------------------------
A0A2V7BAF4      ---DIQHAIYTELYPIFHPDGVEIHAAIEPELHEDIEPDIHMDIETEI----------HA
A0A2V7E6Z5      ---ELEPGIDTEVVPEHHAE-------VEP------------------------------
A0A1Q6YM61      ---DIQHAIYTELYPIFHPE-------VEVEIDAEVEPEMPVDVESEI----------HD
A0A1Q7IM35      ---DIQHAIYTELYPIFHPE-------VEVEIDAEVEPEMPVDVESEI----------HD
A0A1Q7UA97      ---DIQHAIYTELYPIFHPE-------VEVEIDAEVEPEMPVDVESEI----------HD
A0A2V7DAK1      ---DIQRAIYTELHPIFHPE-------VEAEIDAEVESEMPVDVESEI----------HA
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ---------------------------------MGAEEWETSKVLRRVETHRSLYATLSE
A0A2V6YHI8      KQMADLEVEIISLQSRENGLQARIARLKKSMATMGAREQEYAGLARMAETQAKLTGLLAD
A0A2V7A3P7      KQMAALDVEIVSLQAKEDTLQQRANRLRRSLSAMSGREQEYSGLLRAVMTQTKLTDMLSD
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ----------------------------------GSPVSKFLKALERAEQQRALG-----
A0A1Q7G9Y1      ----LSRQLVEELRTREAELARQVESASADLRHLPSLAIDELRLQRDVVDAEQLFANIQQ
A0A2V7AVY2      KQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMRTVLTQAKLTDLISD
A0A2V7C3J3      KQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMRTVLTQAKLTDLISD
A0A2V6VAA8      KQMAALQVEIVSLQAREEVLQQRAARLRRSLSAMGAREQEYSGFMRTVLTQAKLTDMISD
A0A2V7CNK3      KQMAALQVEGVSLQAREEILEQRANRLRRSLSAMSAREQEYSGFLRPVLTQTKLADMISD
A0A1Q7TX95      KQVADAEVELASLQNREDVLKQSIARLSSRLSALGAEEWETSKVLRRVETHRSLYATLSE
A0A2V7B9E3      KQVADAEVELASLQNREDVLKQRIARLSSRLSALGAEEWETSKVLRRVETHRSLYATLSE
A0A2V6RAF2      KQIADLEQEVSALETREEVLKQRLARTSQGLSNLGAEELEVAKLRQSVESQRNLVTTLSE
A0A2V6UHF5      KQIADLEQEVSALETREEILKQRLARTSQGLSNLGAEELEVAKLRQSVESQRNLVTTLSE
A0A2V7A9S9      LSRWSFGTLAVALADERAGP-------CPVSAPPPAPMSKFFEALEQAQQ----------
A0A2V6SIE8      ----AVQEEARAAARRAEEVGRRLDAQRQRAITQHVRQMQLTLLKKEADVGATVYADLMK
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ----SLKVDFEASVRAEKSLEASLTRQSTLARGLAENMAQYNLLRREVDTSRDLYSSLLG
A0A2V6U1W4      ----ALQADYQAALRNEQELEGALAQQRLQAGGLADNMAKYNLLRREVDTSRDLYSSLLG
A0A2V7F4L5      ----------------------RGRRRGARRARPGPAMSKFFEALERAEREQALRTPA--
A0A2V7BAF4      DVEPEVHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEPEIHADV--
A0A2V7E6Z5      ----EIYTELVPEHHAEVEPEIYTELVPEHHAEVEPEIYAELVPEHHAEVEPEIYTEL--
A0A1Q6YM61      GV--EIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEPEIHADV--
A0A1Q7IM35      GV--EIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEPEIHADV--
A0A1Q7UA97      GV--EIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEPEIHADV--
A0A2V7DAK1      DV--EIHAAIAPELHE--------DIETEIHEEVEPEVYAVIEPEIHADVEPEIYADV--
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      -------------------------------------MSRFFKALERAEQERALRVV---
A0A2V6ZW34      -------------------------------------MSKFFKALEQAERDNVEQVS---
A0A2V6SIM1      -------------------------------------MSQFWEALEQAKRDRALQAP---
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      -------------------------------------MSKFFEALERSETEVALRTR---
A0A2V6XML6      -------------------------------------MSKFFEALERAETEQVLETP---
A0A2V7CEX0      -------------------------------------MSKFHEALERADTEEALGTT---
A0A2V6W355      -------------------------------------MSKFFEALQRAERSATPSVP---
A0A2V6YDI1      -------------------------------------MSKFFKALEQAERERAVRRQ---
A0A2V7GJE5      -------------------------------------MSKFFKALEQAEHDRAVREQARR
A0A2V6X2Y0      -------------------------------------MSRFFKALEQAEHEQALRRQ---
A0A2V7AFT7      -------------------------------------MSRFFKALEQAEHEQALRRQ---
A0A2V7BA71      -------------------------------------MSKFFEALERAEQERAVRFQ---
A0A2V7BRT3      -------------------------------------MSTFFEALERAEQERAVRFQ---
A0A2V7FF08      -------------------------------------MSKFFEALERAEREQATQA----
A0A2V6YDI2      -------------------------------------MSKFFEALERAEREADRPTP---
A0A2V6YK84      -------------------------------------MSKFFKALEQAERDHAQREP---
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      --------------------MGLSLRSRARGARSAGPMSKFVEALEHAERERVLGQR---
                                                                            

A0A2V6VPM0      KLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGLGLGVGVAGVIEYF-N
A0A2V6YHI8      KVTAARISEQAQVRGIHVIDLAEQPRQPSSKRPLKFLLFGLLGGLGLGVATAVLREYA-S
A0A2V7A3P7      KLTAARITERSQIRSIHVIDLANLPRQPSPRQPLKLILFGLVGGLGFGIGAATLREYM-T
A0A2V6T785      -----------------------------------------------------------A
A0A2V6RB03      -----------------------------------------------------------R
A0A1Q7G9Y1      RSEEARLAEASSIPDVRILDAAVEPRQPFMDAAPFLFLLSVVGSLGAGVLAAVLRDRV-D
A0A2V7AVY2      KLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLALGVSAATVREYA-V
A0A2V7C3J3      KLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLALGVSAATVREYV-V
A0A2V6VAA8      KLTAARISEQSQIRSIHVIDLASLPRQPSPKQPLTLLFMGVLGGLALGVGAATAREWV-L
A0A2V7CNK3      KLTAARISEQSQIRSIHVIDLANLPRQPSPRQPVKLLVFGLLGGLGLGIGAAMLREHM-T
A0A1Q7TX95      KLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFGLGVGVAGVIEYF-N
A0A2V7B9E3      KLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFGLGVGVAGVIEYF-N
A0A2V6RAF2      KLGTVRIQEQGEDRGLRLIDLAALPQRPSSVPAMRVILLGMVGGLGLGIGLAGLLEYF-K
A0A2V6UHF5      KLGTVRIQEQGEDRGLRLIDLAALPQRPSSVPAMRVILLGMVGGLGLGIGLAGLLEYF-K
A0A2V7A9S9      ------------EKAARRRTVPAAPAEPVAERAPVVTKPPAPAEPVAERAPVFSKP---D
A0A2V6SIE8      RLKEVQLAAQMRMANVKVVDPAEKPRGRSSPNHPRDLLMGLVGGLLGGVALAFVREVA-D
A0A2V6V7G3      ------------------------------------------------------MRAA-D
A0A2V7CME2      RLRETQVSAALLTSNISVVDPAEIPAGPSRPRKGLNLLIACVAGLAGGIGLAFLFEYL-D
A0A2V6U1W4      RLRETQISAALFTSNISIVDRAEISGIPSRPKRTTNLLVGCIAGLLGGVVLALVFEYL-D
A0A2V7F4L5      ------------SS-------PSTTADL-----SGAQAPPAPSGAVEPAGPPLFERPVFE
A0A2V7BAF4      ------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGRAATPMPFAMRAA-D
A0A2V7E6Z5      ------------EPGIDTEVVPELHAEVEAEEETELETEVATENAVAPTPMPFSMRSS-D
A0A1Q6YM61      ------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGRAATPMPFAMRAA-D
A0A1Q7IM35      ------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGRAATPMPFAMRAA-D
A0A1Q7UA97      ------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGRAATPMPFAMRAA-D
A0A2V7DAK1      ------------EPEIRMHEEPEIQAEV--EDETEAEAACATEGGRAATPMPFAMRAA-D
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      -----------ASPPPAPPSETSPTV---------------------------------P
A0A2V6ZW34      ---QAPVEVVSHRPSVMTPPVVTPPP---------------------------------P
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------ME---------------------------------P
A0A2V6TVU3      -----------ASSPRSTEDLAASPA---------------------------------P
A0A2V6XML6      -----------APSPPPTVDPSASAA---------------------------------P
A0A2V7CEX0      -----------ASAPRRTVDVSASPA---------------------------------P
A0A2V6W355      -----------APA----------------------------------------------
A0A2V6YDI1      -----------T-A----------------------------------------------
A0A2V7GJE5      PEGKPAAAPPPTPGASREVSSATVAA---------------------------------P
A0A2V6X2Y0      ------------------------TA---------------------------------P
A0A2V7AFT7      ------------------------TA---------------------------------P
A0A2V7BA71      ------------------------AA---------------------------------P
A0A2V7BRT3      ------------------------AA---------------------------------P
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      -----------ASSPRPEAGPSGSPP---------------------------------P
A0A2V6YK84      -----------VIPAEASSERASVVP---------------------------------H
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      -----------LDGSSLT------------------------------------------
                                                                            

A0A2V6VPM0      QPIETEDDVFDATGLPVLGWLPTIAGHQ---------PTTGVEREPLNFVNGSIPDTLPV
A0A2V6YHI8      RVIETEQEVVAASGLPVLGSIPIARPLTGA-------PAGTK-TTPMIFVSTHDPHSLQA
A0A2V7A3P7      QIVETEQEVIHATGLPVLGSIPIAEHIEPL-------VKGPREQQPVLFGSGDVFYSLPA
A0A2V6T785      RPSVRASRVGREAGAPTAAAPNIVDA-----------AARAHASVDEHLVSLLLPATFEA
A0A2V6RB03      HPAPSEAASERGLAVPETAPPRPPRASHEL-------AREVPNGLEEHLVSLLAPRSFEA
A0A1Q7G9Y1      PKLRYPAHVTQEMGLPILGAVPHL-------------PAANGKGGRKLSGNGVGTAAPVI
A0A2V7AVY2      QVVETEQDVAHATGLPVLGSIPVAERSESASGR----EVAPVDDLPMLFVAGNDLHSLPA
A0A2V7C3J3      QVVETEQDVAHATGLPVLGSIPVAERSESASGR----EVAPGDDLPMLFVAGNDLHSLPA
A0A2V6VAA8      QVVETEREVTRATGLPVLGSIPVADRPGS-SEK----GAAPADDLPVLFVAGNDLHSLPA
A0A2V7CNK3      QVIETENDVIRATGLPVLGSIPVAEAAES-SGK----DGAQSELMPVLFVAGNDLHSLPA
A0A1Q7TX95      QPIETEDDVFDATGLPVLGWLPTIAG----H-Q----PTTGVEREPLNLVNGSIPDTLPV
A0A2V7B9E3      QPIETEDDVFDATGLPVLGWLPTIAG----H-Q----PTTGVEREPLNLVNGSIPDTLPV
A0A2V6RAF2      QPMETEEDITAATGLPVLGWLPTIQG----SGR----PDKGPEREPMSFIDVFAPNTLPI
A0A2V6UHF5      QPMETEEDITAATGLPVLGWLPTIQG----SGR----PDKGPEREPMSFIDVFAPNTLPI
A0A2V7A9S9      APTFPQP-------VPRR-----VRRSSLEPSRGGSNETEEHLQMEEHLVSLLAPTSFEA
A0A2V6SIE8      KTLRTPRDVDLLVRLPSIGAVPTIPGYRRRTLP----PVAELPGVSLPGEAPAWPEQMAE
A0A2V6V7G3      APAFTES-------VPTV-------------------KDDDAESVDDRLVTLLTPNSFAG
A0A2V7CME2      TNIKDTKEVESVLRVPALGVVPSRAAFERMLARRKALEAGPGASTPFALVSHSELPSVFA
A0A2V6U1W4      TNINIKD-------AKDVESVLRVPILGMVPSWALRRRREPADGLPFALAAQSETASDFA
A0A2V7F4L5      SPATATE-------LAVD-------------------RSDRAEA---HLVTLLNPASFEA
A0A2V7BAF4      APAFTES-------VPTV-------------------KDDDAESVDDRLVTLLTPNSFAG
A0A2V7E6Z5      APAFTES-------VPTV-------------------KDDDAESVNDRLVTLLTPNSFAG
A0A1Q6YM61      APAFTES-------VPTV-------------------KDDDAESVDDRLVTLLTPNSFAG
A0A1Q7IM35      APAFTES-------VPTV-------------------KDDDAESVDDRLVTLLTPNSFAG
A0A1Q7UA97      APAFTES-------VPTV-------------------KDDDAESVDDRLVTLLTPNSFAG
A0A2V7DAK1      APAFTES-------VPTV-------------------KDDDAESVDDRLVTLLTPNSFAG
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      --------------------------------------------MLDGLIQRLTSKPELL
A0A1F7NSZ2      ---------------------------------MAKRGKAAAPSTAAPLVAHADPKSPAA
A0A1F7PJN6      ---------------------------------MAKRGKAAAPSTAAPLVAHADPKSPAA
A0A1F7NCG6      --------------------------------MARRAKPAGTVTAVSALVAHADPKSPAA
A0A1F7Q5I6      --------------------------------MARRAKPAGTVTAVSALVAHADPKSPAA
A0A2V6SK79      --------------------------------MRRPRQPQAGSGTPTALVTETAPKSAAA
A0A2V6PDA4      -------------------------------------------------MSLLDPISFAA
A0A2V6Q732      ---------------------------MSRHRVAT---------LDECLVSLVAPHSYEA
A0A538RKA5      ------------------------MRLLSRLKLPETAAPPEWERLDEHLVSLVAVGSFEA
A0A2V6ZH60      ETVPPRPSPAAPKTTPP---RAQETFFRPPRAAATAGRAERIIGVEEHLVSLLAPTSFEA
A0A2V6ZW34      RAPSPVDEPPAPPAESPRPVFEAPRPVFKAPRPVVRSPRVASALLDEHLVSLQAPSTAAA
A0A2V6SIM1      -------QSLPVPAPPE-------PKGDSALRLVAEAPVEPLHRVDDHLVSLLAPASFAA
A0A2V6SBN9      AAPRHLGRPVIEPPAPV-----------------TKPRVDRPNRAEDHLVSLFDSESWEA
A0A2V6TVU3      EAPSVEVLPAAPRGFPR-------PVFEAPSTAINRVV-GRSNRVETHLVSLLDPRSYEA
A0A2V6XML6      AAPSAEVPPTPSVRFPP-------PVREARAPTTERAV-DRSHRVGAHLVSLLDPRSFEA
A0A2V7CEX0      EAPSVEVPPAAPPHFPR-------PVFEAPPRATKREV-DRADRIEACLVSLLDPRSFEA
A0A2V6W355      ---SAEPPPMMEPRLPP-------PALAPRPAVAASLR---SASVELHLVSLLEPASFEA
A0A2V6YDI1      ---TSEPANGQGPAVAE-------PIAYQAPRVSRGLAKGVSNGFEEPLVSLLAPTSFEA
A0A2V7GJE5      AAPPAARPAEPARDPADRRSVGRVWTAEAPRPKDRAEGPW--GEIDEHLVSLLNPTSPDA
A0A2V6X2Y0      VEPAPAPRVERAPVPSS---AGTWPPPQRPVSAARASAPAFSSELDEHLVSVLAPTSFEA
A0A2V7AFT7      VEPALAAPVLPARTPFP---AGTWPAPRGPVSAARKSAPAFSSDLDEHLVSMLAPNSFEA
A0A2V7BA71      SEPTNARGPAVPETALD---PALRSAPELPRGVA--------NGLDEHLVSLLAPTSFEA
A0A2V7BRT3      GASTSAPDPPVPESAPD---PGLRSLPELPRGAA--------NGLEEHLVSLLAPTSFEA
A0A2V7FF08      -SSPGTTDGP--SASPR-----IEPPVVQATAPANELAVDGSHRVEALLVSLLDPASFEA
A0A2V6YDI2      AAPPAASPPP--AAPEP-----VAPSVFKAPATATRPPVDRASRIGEHLVSLLNPASFEA
A0A2V6YK84      WPEPAAEQPPVFTPPPP-----RAPRAVIESRVPVDSPRIAPALLDEHLVSLQAPATPAA
A0A1Q7NS62      -------------------------------------------------MSLIEPASFEA
A0A2V7D2F0      ------------APAAA-----PVAEVSAALEPVRDAELPVGSPLDEHLVSLLKPTSFEA
                                                                            

A0A2V6VPM0      EGCRSIRTSLESLN--GSRKLQSIMLASAGPKEGKSTIALNLAWVFWEL-GRRLILIDAD
A0A2V6YHI8      DSCRAIRTAIDCHSLGLEHPIKTLLVTSPTAHDGKSTVLLNLALAFVES-GRRVLVIDAD
A0A2V7A3P7      DACRAIRTGLDCQS--LNRPLKTLLITSPGAHEGKSTVLLNLGRAFLEA-DRQLLIMDAD
A0A2V6T785      EQYRALRHVIEHQR--AATGLTVVAVTSPAVGDGKTTTAINLAGALAQAQGGRVLLVDAD
A0A2V6RB03      EQYRTLRHLIEQLH--KSTGLSVVAISSPGVADGKTTTAINLAGALAQASDARVLLVDVD
A0A1Q7G9Y1      EALRGIRLSLVHAH--GTAGPLLVTITSPGSGEGKSFVAANMALAFADA-GHSTLLIDGD
A0A2V7AVY2      DACRAIRTVLDGPS--LDKPLKTLLVTSPGAHEGKSTVLLNLGRAFLET-DRHLLMIDAD
A0A2V7C3J3      DACRAIRTALDCQS--LDKPLKTLLVTSPGAHEGKSTVLLNLGRAFLET-DRHLLMIDAD
A0A2V6VAA8      DACRAIRTALDCQG--LDRPLKTLLVTSPGAHEGKSTVLLNLGRAFLET-DRRLLLIDAD
A0A2V7CNK3      DACRAIRTALDCQS--LERPLKTLLVTSPGAHEGKSTVLLNLSRAYLET-DRQLLVIDAD
A0A1Q7TX95      EGCRSIRTSLESLN--GSRKLQSIMLASAGPKEGKSTIVLNLAWVFWEL-GRRLILIDAD
A0A2V7B9E3      EGCRSIRTSLESLN--GSRKLQSIMLASAGPKEGKSTIVLNLAWVFWEL-GRRLILIDAD
A0A2V6RAF2      EACRSIRVSLLSMY--RAEDVRTIMLASAGPGEGKSTVALNLSYVFSQA-GRRLLMVDGD
A0A2V6UHF5      EACRSIRVSLLSMY--RAEDVRTIMLASAGPGEGKSTVALNLSYVFSQA-GRRLLMVDGD
A0A2V7A9S9      EQYRTLRHLIEQLH--KAAELQVFAVSSPTASDGKTTTAINLAGALAQSHDARVLLIDAD
A0A2V6SIE8      EAFRSIRTLVFHRQ--APGTPRTMLVTSAEPGEGKSFVAVNLAVALAGTGE-PVLLIDAD
A0A2V6V7G3      EQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMD
A0A2V7CME2      EAFRNLRTSILYST--PERPPKTLMMTSLQPEDGKTSLVTNLAITLSQLGGSPVLLVDAD
A0A2V6U1W4      EAFRNLRTSLLYSS--PDHPPKTILVTSLQPEDGKTSLATNLAISLVQVGAVEVLMIDAD
A0A2V7F4L5      EQYGVLRHVMETLR--KSANLKVVAITSAGVGDGKTTTAINLAGALAQSVDARVLLVDID
A0A2V7BAF4      EQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMD
A0A2V7E6Z5      EQYRTLRHLVEKMH--TDTGVSVVGVSSPSIGDGKTTTAINLAGALAQARDTKVLLIDMD
A0A1Q6YM61      EQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMD
A0A1Q7IM35      EQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMD
A0A1Q7UA97      EQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMD
A0A2V7DAK1      EQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMD
A0A2V6U3P1      ---------MQFAG--LDRPCKTIVITSATPGEGKTTTAANF-AAVCAQSGSRVLLVDGD
A0A2V7I866      HEYAALRSGLNLGS--SSGGCKSVLVTSAQPLDGKTTIVLDL-GLTAMLSGRKVIIVDAD
A0A1F7NSZ2      EAYRSLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVVSAQAGSRVLVVDSD
A0A1F7PJN6      EAYRSLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVVSAQAGSRVLVVDSD
A0A1F7NCG6      EAYRTLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVVSAQAGSRVLVVDSD
A0A1F7Q5I6      EAYRTLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVVSAQAGSRVLVVDSD
A0A2V6SK79      EAYRTLRTNIQFAG--LDRPCKTIVITSATPGEGKTTTAANF-AAVCAQSGSRVLLVDGD
A0A2V6PDA4      EQYRTLRHIVEQPH--RAEPLSVLAVSAPTIGDGKTTTAINLAGAFAQAADVRVLLVDAD
A0A2V6Q732      EQYRGLRHLVEQAH--RTSALSVLAVSSASVGDGKTTTAINLAGALAQASDARVLLMDVD
A0A538RKA5      EQYRVLRHIVEQFY--KDADLRVLGLTSATVGDGKTTTALNLAGALAQASDARVLLIDGD
A0A2V6ZH60      EQYRALRHKIEQLH--RSTDLTTIAVSSPDAGDGKTTTTLNLAGALAQAPDARILLIDAD
A0A2V6ZW34      EQYRVLRHLVETLR--KRTNLQVLAVTSPGVGDGKSVTAINLAGALAQSEEARVLLVDMD
A0A2V6SIM1      EQYRALRFVIEQTH--RESAVSVVGVSSPSVGDGKTTTAINLAGALSQASDARVLLLDLD
A0A2V6SBN9      EQYRVLRHAVETLR--KGVNLQIVAVTSAAVGDGKTTTAINLAGALAQSADARVLLVDVD
A0A2V6TVU3      EQYRVLRYVVETLR--KGNNLQVVAVTSPGVGDGKTTTAINLAGALAQSVDARVLLVDID
A0A2V6XML6      EQYRMLRHVVETLR--KGAILHVVAVTSPGAGDGKTTTAINLAGALAQSADARVLLVDLD
A0A2V7CEX0      EQYRVLRHVVETLR--KGANLQVLAVTSPGVGDGKTTIAINLAGALAQAVDARVLLVDID
A0A2V6W355      EEYRVLRHAVETLH--KDAHLQIVSVTSPGMGDGKTTTAINLAGALAQSTDARVLLVDID
A0A2V6YDI1      EQYRVLRHVVETLR--KDANLQVVAVSSPGVGDGKTTTSINLAGSLAQAADARVLLVDLD
A0A2V7GJE5      EQYRALRHAVEQLH--RSAGLTALAVSSPTVGDGKTTTAINLAGALAQDPEARILLVDAD
A0A2V6X2Y0      EQYRALRHRIEQLH--KTTDLAIVAVSSPSVADGKTTTAINLAGALAQAPDARVLLIDAD
A0A2V7AFT7      EQYRALRHQIEQLH--KTTNLAIVAVSSPSVADGKTTTAINLAGALAQAPDARVLLIDAD
A0A2V7BA71      EQYRALRHLIEQRG--KSTALSVVAVSSPGVADGKTTTAINLAGALAQAPDARVLLIDAD
A0A2V7BRT3      EQYRALRHLIEQLH--KSTGLVVVAVSSPTVADGKTTTSINLAGALAQAPDARVLLIDAD
A0A2V7FF08      EQYRVLRHVVETLR--KGANLQVVAVTSPGIGDGKTTTAINLAGALAQSASARVLLVDMD
A0A2V6YDI2      EQYRVLRHLVETLR--KGANLQVVAVTSPGVGDGKTTTAINLAGSLAQAADARVLLVDMD
A0A2V6YK84      EQYRVLRHLVETLR--KRANLQVIAVTSGGVGDGKTVTSINLAGALAQSEDARVLLIDMD
A0A1Q7NS62      EQYRALRQLVERLH--KSTALSIVAVSSPTVADGKTTTSINLAGALAQAPDARVLLVDAD
A0A2V7D2F0      EQYRALRHLIEHLH--RTAELSVVAVSSPVADDGKTTTAINLAGALAQDPQARVLLLDAD
                         :             . :::    :**:    ::            :::* *

A0A2V6VPM0      LRRPSLHRGLRCP--PQ---PGLA-DMLT-GNVPWPRAGQGIR-E--------GFVFLPA
A0A2V6YHI8      LRRSSLHRAVGVP--NE---RGLV-DMLQ-KGVAWPEGFRGVA-T--------GFDFLPS
A0A2V7A3P7      LRRPALHKALEVP--NE---VGLA-DVLR-EGTVWPEAFRSLG-P--------GLYFMPA
A0A2V6T785      LRRPSIAEHLGLAGPHRPDLPGLVDALVG-GPVRFEEIGQTYEEF--------NLTVVTA
A0A2V6RB03      LRGGALAARLGIDERAG---RGLVDAILN-AELTLEAVVEVRPDL--------NLTILPA
A0A1Q7G9Y1      IRRGQLHRVLNAA--RT---PGLT-NWLT-AGPAPEAIVQATPYP--------RLSFIGC
A0A2V7AVY2      LRRPSLHRALRTP--NE---VGLA-DVLR-DGTVWPEAFRALA-P--------GMDFMPS
A0A2V7C3J3      LRRPSLHRALRTP--NE---VGLA-DVLR-DGTVWPEAFRALA-P--------GMDFMPS
A0A2V6VAA8      LRRPSLHRALRTP--NE---IGLA-DVLR-AGTVWPEAFRPLA-P--------GMDFMPS
A0A2V7CNK3      LRRPSLHRTLRIP--NE---VGLA-DMLR-AGTVWPEAFRSLA-P--------GMSFVPS
A0A1Q7TX95      LRRPSLHRGLRCP--PQ---PGLA-DMLT-GNVPWPRAGQGIR-E--------GFVFLPA
A0A2V7B9E3      LRRPSLHRGLRCP--PQ---PGLA-DMLT-GNVPWPRAGQGIR-E--------GFVFLPA
A0A2V6RAF2      LRRPSLNRPLRLP--VK---PGLV-DVLA-SHLPLAAALQPIK-D--------GLQLLAA
A0A2V6UHF5      LRRPSLNRPLRLP--VK---PGLV-DVLA-SHLPLAAALQPIK-D--------GFQLLAA
A0A2V7A9S9      LRVPTVGTNLGLDERPG---PGLADTILN-SSLTLDAVVQVRPQL--------NLSILPA
A0A2V6SIE8      FRRPSCHQVFDLN-LPK---VGLS-SILY-RDQPWDGSIVATSVP--------NLAFLPA
A0A2V6V7G3      LRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A2V7CME2      MRRPMVHRVLSVE--QT---PGLS-TYLT-GQADLDQVIVPSGIP--------NLFVIPA
A0A2V6U1W4      MRRPNLHNVLSVP--QA---PGLS-TFLT-GQAELADVIVPTSVR--------NLSIIPS
A0A2V7F4L5      VRRPAVARQLKLAGSKR---SLVD-ALMD-SSLKVEDTVEHLAHF--------NLSVLRA
A0A2V7BAF4      LRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A2V7E6Z5      LRRPALNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A1Q6YM61      LRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A1Q7IM35      LRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A1Q7UA97      LRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A2V7DAK1      LRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF--------NLSIIPS
A0A2V6U3P1      LRKPTLHRIFGL--DNQ---RGLTTTMIE--GKSLADVAIPTRVP--------NLSVVVS
A0A2V7I866      LRKPRIHEALEL--PNT---LGLSDILGA--RTHAREVIQTVKAMGGNPLDDRSVSVITA
A0A1F7NSZ2      LRRPTLHRIFGL--GNA---RGLSTALLE--EQPFADVAQATAIP--------NLSVLTS
A0A1F7PJN6      LRRPTLHRIFGL--GNA---RGLSTALLE--EQPFADVAQATAIP--------NLSVLTS
A0A1F7NCG6      LRRPTLHRIFGL--GNA---RGLSTALLE--GLPFADVAQATAIP--------NLFVLTS
A0A1F7Q5I6      LRRPTLHRIFGL--GNA---RGLSTALLE--GLPFADVAQATAIP--------NLFVLTS
A0A2V6SK79      LRKPTLHRIFGL--DNQ---RGLTTTMIE--GKSLADVAIPTRVP--------NLSVVVS
A0A2V6PDA4      LRRPTVSSRLAL-DDSG---PGLVDAILD-PALGLGDVVRPRPPF--------NLWVLPA
A0A2V6Q732      LRRPAIAERLGV-EEGR---HGLVDAILS-HDLKLADVARPCGPL--------NLAVVTA
A0A538RKA5      IRRGLVRERLGL-RDTS---AGLAEAILD-ANIPLASVARHCSPF--------NLWVLPT
A0A2V6ZH60      LRGANVAMYLGLDEHTA---PGLVDAILN-PSLTLGSVVQTHPYL--------NLTVITA
A0A2V6ZW34      LRRPAIARYLAL-GESR---PTLADALGT-PGLALKDAVVQVPSF--------NLSVLRA
A0A2V6SIM1      VRRPQIGRRLGL-DPNQ---PGLVDAIVD-PRLDLADIARAVRPF--------NFAVVLG
A0A2V6SBN9      LRRPAVARHLGL-GGSK---GSLVGALLD-SGLTLEAAVERLANS--------NLSVLPA
A0A2V6TVU3      IRRPAVARQLGL-A-TK---RSLVATLLD-ARLTLKDTVEHVAHF--------NLWVAPA
A0A2V6XML6      IRRPAVARQLRL-SGAR---RSLVDALRD-PGLTLEDTVEHLAHF--------NLSVLPA
A0A2V7CEX0      IRRPAVARQLGL-AGSK---RSLVTTLLD-ASFTLENSVERLAHF--------NLSVLPA
A0A2V6W355      LRRPAVARHLGL-AHSK---RCLLDALLD-PGVKLEDTVEHIARF--------NLSVLPA
A0A2V6YDI1      IRRPAVARQLGL-AGSK---RSLVDALLD-SSLTLEDVVEHLAQV--------NLSVVPA
A0A2V7GJE5      LRRPSVGNRLGLRNSRD---RGLVDLVLA-PDLTLDDVVRRRPSY--------NLSVLAA
A0A2V6X2Y0      LREGSLARRLGLDVNMR---PGLVEAILD-PNLTLDAVAHADHNL--------NLSVLTG
A0A2V7AFT7      LREGSLARRLGFDVDRG---PGLVEAILD-AHLTLDAVAHADRSL--------NLSVLTG
A0A2V7BA71      LRGAAVAARLGWDARVG---PGLADAILD-ASLTLETAAHACPHL--------NLSVLPA
A0A2V7BRT3      LRGAALGPRLGLEEGGG---PGFVEAILD-ANLPLAAVVQARPQL--------NLSVLPA
A0A2V7FF08      LRRPAVARRLGLAG-SK---RALVDALLD-SGLTLGDTVEPLAYF--------NLSVLPA
A0A2V6YDI2      LRRPAVAGQLGLSG-GK---RGLAEALLADSGLSLEDTVETLAHF--------NLSVLPA
A0A2V6YK84      LRRPSIARYLALGA-TR---PTLADALEA-SGPELKDAVVRIPRF--------NLSVLRA
A0A1Q7NS62      LRGAALAPRLGFDEYVG---PGLVDAIVD-VNLTLPAVVHALPSL--------NLSVVPA
A0A2V7D2F0      LRRGALAHRLGLREPSP---RGFVDVILD-GKLTLEAVVKRCPPF--------NLSIVPA
                .*       .            .                               . .   

A0A2V6VPM0      GSTGTAKPGVLLTVAKLRGVLELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRA
A0A2V6YHI8      G-IKAANPGALLSSRHMAELLDQARERADLVLIDSPPVLAVSDCLPLCTKVDGVLLVTRF
A0A2V7A3P7      G-TRRPNPSSLLSSRHMGTVLQEARDRADIVLIDAPPVLAVADCLPLCRQVDGVILVIRF
A0A2V6T785      G-GVPHAPYEVLQSPRFAAILEDARQRYDYVILDTPPLVAVPDSRVIMKVVDGVLLVVSA
A0A2V6RB03      G-RLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLVSFPDCRVIEKCVDGFLIAVAA
A0A1Q7G9Y1      GARTPFGP-ELLGSAEMARLFAALRPRYEVILVDSPPLSVGVDPYILGTLTGNLVLVLRS
A0A2V7AVY2      G-IRPANPSSLIASKHMVRVLELARERADVVLIDAPPVLAVADCLPLCRYVDGVILVARF
A0A2V7C3J3      G-IRPANPSSLIASKHMVRVLELARERANVVLIDAPPVLAVADCLPLCRYVDGVILVARF
A0A2V6VAA8      G-IKPANPSSLIASKHMLRVLELARERADVVLIDAPPVLAVADCLPLCRYVDGVILVARF
A0A2V7CNK3      G-IRPTNPSSLISSKHMTHVLELARERADVVLIDAPPVLAVADCLPLCRRVDGVILVVRF
A0A1Q7TX95      GSTGTAKPGVLLTVAKLRGALELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRA
A0A2V7B9E3      GSTGTAKPGVLLTVAKLRGALELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRA
A0A2V6RAF2      GTTDGADPGVLLSADNISRLFDLAKGHADLVVFDSAPVLAVADNLALASMVDAVILVVRA
A0A2V6UHF5      GTTDGADPGVLLSADNISRLFDLAKGHADLVVFDSAPVLAVADNLALASMVDAVILVVRA
A0A2V7A9S9      G-RLPSAPYEVLKSPRVGELLAEARKRYDYIVLDTPPLVSVPDCRVIGRWVDGFLIVVAA
A0A2V6SIE8      G-PMPPDPAALLSSERARELLAALRERYAWIIVDSPPVLAASDACALARQVEGVLLVVRA
A0A2V6V7G3      G-PRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLIIVNA
A0A2V7CME2      G-RIPVNPAELLASARLREAIETLGQRFAYIVFDTGPMFGVSDAMILAGQLEGTVLVLRH
A0A2V6U1W4      G-RIPLNPAELLTSTRLPQALEGLGGRFAHIVVDTGPIFGVSDAMIVAAQVEGVVLVLRH
A0A2V7F4L5      G-GPTLAPYELLKSSRLEALLDQARQRYDYIVLDTPPFVPVPDCRLIAKCVDGFLIVVAA
A0A2V7BAF4      G-PRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLVIVNA
A0A2V7E6Z5      G-PRQSAPYELLKSSRLHQMIDEARRRFDYVIIDTPPVIAVPDCRVISSGVDGFLIIVNA
A0A1Q6YM61      G-PRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLVIVNA
A0A1Q7IM35      G-PRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLVIVNA
A0A1Q7UA97      G-PRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLVIVNA
A0A2V7DAK1      G-PRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLIIVNA
A0A2V6U3P1      G-PLPPNHAELAASRRMHDLMEAATRVFDLIVIDTPPVLSVSDAVALAAQMDGVILVVRG
A0A2V7I866      G-LGGAPLTETLGGPTLKDAIGELTRAYDVVLVDSPPVLAADDALLLAPLVDGVIVVVHT
A0A1F7NSZ2      G-PLPPNPAELVGSLRMRECLEAAAGDFALVLLDSPPIVSVADALALSAVADGVVLVVRA
A0A1F7PJN6      G-PLPPNPAELVGSLRMRECLEAAAGDFALVLLDSPPIVSVADALALSAVADGVVLVVRA
A0A1F7NCG6      G-PLPPNPAELVGAMRMRECLEAATTDFDLVLLDSPPIVSVSDALALSAITDGVVLVIRV
A0A1F7Q5I6      G-PLPPNPAELVGAMRMRECLEAATTDFDLVLLDSPPIVSVSDALALSAITDGVVLVIRV
A0A2V6SK79      G-PLPPNHAELAASRRMHDLMEAATRVFDLIVIDTPPVLSVSDAVALAAQMDGVILVVRG
A0A2V6PDA4      G-PRTDSPYELLKSPRLAALLHEARQQYDYVILDTPPLVPVPDCRIIGKYVDGFLLVVAA
A0A2V6Q732      G-VFSDIPYELLRSPRLGDLLEQARRDYDYVVLDTPPLVPIPDARVISKWVDSFLLVVRA
A0A538RKA5      R-PGAPAPYELLKSPRFGELIQEARQQYDYVVVDAPPLIPVPDFRVIAKHVDGFLMIVGA
A0A2V6ZH60      G-RQPTSPYEVLKSPRLGELLAEAREKYDYVIVDTPPLVSVPDSQVLARLVDGFVLVVGA
A0A2V6ZW34      P-VSAAAPYELLRSPKLEALLAEARQEYDYVVIDTPPFVPVPDCRVIAKSVDGFVVVVAS
A0A2V6SIM1      G-QSAKATYELFKAARLRTLLEEARESYDYVVIDAPPLLPMPDCQLIGGFVDKFIVVLAC
A0A2V6SBN9      G-RATVAPYELLKSPRLEALFEEMRQHYDYVVLDTPPFLPVPDCRLIEKCIDGFLLVVAA
A0A2V6TVU3      G-GPAGAPYEVLKSPRLEALLGEARECYDYIVLDTPPCVPVPDCRVIAKYVDGFFLVVKA
A0A2V6XML6      S-RPAVEPYELLKSPRLEALLDEARRRYEYVVLDTPPFVPVPDGRIIAKYVDGFLIVVKA
A0A2V7CEX0      G-EPAVAPYEVLKSPRLEALLDEARQCYDYIVLDTPPFLPVPDCRVIAKCVDGFLTVVKA
A0A2V6W355      G-GPEAVPYEILTSPRLEELLNEARRRYDFVVLDAPPFVPVPDCRLLTKCVDGFVVVVAT
A0A2V6YDI1      G-GPARAPYELLQSPRLDALVDEARQRYDYVVLDTPPITPVPDCRLIAKCVDGFLVVVAA
A0A2V7GJE5      G-RAAAAPYEVLKSPRLGNLLDQARQQYDFIVLDTPPIVLTQDCRVISKWVDGFLLVVGA
A0A2V6X2Y0      G-RLPSAPYEVLKAPRVGELLGEARRRYDYIVLDTPPLVSVPDCRVIGRWVDGFLIVVTA
A0A2V7AFT7      G-RLPSAPYEVLKSPRVGELLGEARRRYDYIVLDTPPLVLVPDCRVIGRWVDGFLIVVTA
A0A2V7BA71      G-RRPSATYEVLKSPRVGELLAEARKRYDYVILDTPPLVLVPDCRVIEKWVDGFLIVVTA
A0A2V7BRT3      G-RFPSAPYEVLMSPRVGELLAEARRQYDYVILDTPPLVSVPDCRVIEKWVDGLLIVVTA
A0A2V7FF08      G-KPAVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRVIAKYVDGFLTVVAA
A0A2V6YDI2      G-RATVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRVITKSVDGFLVVVTV
A0A2V6YK84      P-VSTAAPYEVLRSPKLEALLAEARRQYDYVVIDTPPFVPFPDCRLIAKSVDGFVLVVAS
A0A1Q7NS62      G-RFPSAPYEVLKSPRFGELLAEARKRYDYIILDTPPLVSVPDCRVIEKWVDGFLIVVTA
A0A2V7D2F0      G-LLPSAPYEVLKASRVGELLAAARHEYDFIVLDTSPLVSVPDCRVLEKWVDGFLVVVAA
                                    .         ::.*: *     *   :       .     

A0A2V6VPM0      GETQRHDLVRAKDLLEKAGASLLGVVLNQVS---PRQTRRY-----YGRYG---------
A0A2V6YHI8      GTTQRRSLIRAKAMLEKVGAHIVGVVVNGLS---PRETRRY-----YAEYN---------
A0A2V7A3P7      GSTRRRSLQRAKDQLQKVGANVVGVVINGLS---RRETRHY-----YAEYT---------
A0A2V6T785      HQTPRRLLEEALGLVDP--AKLLGLVFNQDD---RPLSGYYRGYRGYRTYGAAP------
A0A2V6RB03      HKTSRKLLEEALNVTER--AKIVGFVFNGDD---RHLSRDS-----YGTYASTR-SVDLG
A0A1Q7G9Y1      GVTNRELAGAKLDAVDRLPIRLLGAVLNDIR------PDGA-----YRHYSYFPEGYELR
A0A2V7AVY2      GITRRRSLIRAKAQLGRVGARVVGVVINGLS---RHETRHY-----YAEYT---------
A0A2V7C3J3      GITRRRSLIRAKEQLGRVGARVVGVVINGLS---RHETRHY-----YAEYT---------
A0A2V6VAA8      GATRRRSLIRAKEQLERVGAHVVGVVINGLS---RHETRHY-----YSEYT---------
A0A2V7CNK3      GVTRRRSLQRAKDQLERVGARIVGVVINGLS---RHETRLR-----YAEYT---------
A0A1Q7TX95      GETQRHDLVRAKDLLEKAGASLLGVVLNQVS---PRETRRY-----YGRYG---------
A0A2V7B9E3      GETQRHDLVRAKDLLEKAGASLLGVVLNQVS---PRETRRY-----YGRYG---------
A0A2V6RAF2      GVTQRRDLVRAKAMLDKVRAPVVGAVLNRVS---SRETRRY-----YRSYS---------
A0A2V6UHF5      GVTQRRDLVRAKAMLDKVRAPVVGAVLNRVS---SRETRRY-----YRSYS---------
A0A2V7A9S9      HKTPRKLLEEAIRVAEP--AKVVGLVFNGDD---RHLSRDS-----YASYAARQFSDGHG
A0A2V6SIE8      NATPIEAAQLVRDRLERLGANVVGVVLNDVR---PTRDRYF-----YANYG---------
A0A2V6V7G3      HKTPTRLLSETVNVLGQ--SKVLGLIFNRDD---QPIAEHL-----YNSYGPDP------
A0A2V7CME2      GRASRDAAQRAIRSLIAVRARLLGVILNDVDLQANSYG--Y-----YDSYYLRP------
A0A2V6U1W4      GRASRDAAQRAIRNLMSVGAKLLGVILNDVDVRAEGYYGY------YSNYGYEA------
A0A2V7F4L5      HRTPRSALAETLDLLEP--AKVVGLVFNGDSVRRSSYSGYY-----HAHVGSSR------
A0A2V7BAF4      HKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----YNSYGPDP------
A0A2V7E6Z5      HKTPTRMLGETVSVLGQ--SKVLGLVFNRDD---QPMAEHL-----YNSYGPDP------
A0A1Q6YM61      HKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----YNSYGPDP------
A0A1Q7IM35      HKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----YNSYGPDP------
A0A1Q7UA97      HKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----YNSYGPDP------
A0A2V7DAK1      HRTPTRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----YNSYGPDP------
A0A2V6U3P1      GKTSAEAARRAAEQIDAVKGRILGGLLNRVD---ARNSGYY-----ADHGRYYDAYYGSD
A0A2V7I866      GIVTERDLKLTKARLEGVGGRVLGVVMNRFD---PRVHGPG-----AHPYAARYYERG--
A0A1F7NSZ2      GKIPHEVVRRAVVQIESVKGRILGVLMNSVN---LKRDGYY-----YDYYRYYHSYYSPT
A0A1F7PJN6      GKIPHEVVRRAVVQIESVKGRILGVLMNSVN---LKRDGYY-----YDYYRYYHSYYSPT
A0A1F7NCG6      GKIPHDVVRRAVVQIESVKGRILGVLMNSVN---MKREGYY-----YDYYRYYHAYYSPA
A0A1F7Q5I6      GKIPHDVVRRAVVQIESVKGRILGVLMNSVN---MKREGYY-----YDYYRYYHAYYSPA
A0A2V6SK79      GKTSAEAARRAAEQIDAVKGRILGVLLNRVD---ARNSGYY-----ADHGRYYDAYYGSD
A0A2V6PDA4      HKTRAKLLDEALGVLGS--SKILGLVFNGGD---VTDSGYY-----YAGRYGARRGGDDP
A0A2V6Q732      NTTPRSLLEESLNLMDP--PKVLGLVFNNDE---RPRTT-Y-----HDYYAGSGRHNKGG
A0A538RKA5      HKTPRRLVEEALDILDP--AKVLGLVFNGDS---RPLAG-Y-----YSYSA---------
A0A2V6ZH60      HRTPRRLLLEALNLLEP--TRVVGLVFNGDD---RHLSRDS-----YA-----SKRVYEM
A0A2V6ZW34      NRTQRGLLAETLKAMDP--DKAVGFVFNAHP---TLPTS-Y-----YDYGNGHSHG----
A0A2V6SIM1      DKTPRRALAEALNVLAA--DKVLGLVFNRSD---QLLSDYR-----REDYGEKVRG----
A0A2V6SBN9      HRTPRGAVAETLNLMDP--AKVVGAVFNGDD---ARRSN-Y-----YDVYARPSA-----
A0A2V6TVU3      HQTPRGELARALDLMDP--QKVAGLVFNDDR---VRRSS-Y-----YDVYAGPPRS----
A0A2V6XML6      HRTPRGALAQTLDLVDP--AKVTGLVFNGDN---TRRSG-Y-----YDGYVASPRG----
A0A2V7CEX0      HRTLRGELAQTLDLMDP--AKVVGLVFNGDH---ARRSS-Y-----YDVYTAPPRR----
A0A2V6W355      HRTPRGMLAETLNLIDP--AKLAGLVFNGDV---APRSS-Y-----YRVAEPTPV-----
A0A2V6YDI1      HRTPRGGLAESLAMMDP--AKVVGLVFNGDT---RRRRG-Y-----YDVYAGAPER----
A0A2V7GJE5      DRTPAKLVEEALNRMEA--DKIVGFVFNDDA---RSLSR-Y-----YSYGYTAKRHEEEG
A0A2V6X2Y0      HKTSRKLLEEALHVTEP--AKILGLVFNGDD---RHVSR-G-----YSYGGGRRSQ----
A0A2V7AFT7      HQTPRKLLEEALNVTEP--AKILGLVFNGDD---RHVSR-G-----YSYGGGRGSH----
A0A2V7BA71      HRTGRKFLGEALNLAER--TKVVGLVFNGDD---RHLSRNS-----YGSYATRLSK----
A0A2V7BRT3      HRTARKLVEEALNVTDR--AKVVGLVFNGDD---RHLSRDS-----YGSYGSRRSSSRNG
A0A2V7FF08      HRTPRSALAQALDLMDP--GKVAGLVFNGDD---ARRSSY------YSAYVGSPRG----
A0A2V6YDI2      HRTPWGVLTEALDLIDP--AKVVGLVVNGDD---TRRSSY------YDVYAGSSRG----
A0A2V6YK84      NRTPRGVLAEALKAMDS--EKAVGYVFNAHP---WTPTSY------YEDGNGHGR-----
A0A1Q7NS62      HRTARKLLEEALNVTER--ARIVGLVFNGDD---RHLSRDS-----YGAYDSRQSA----
A0A2V7D2F0      HKTPRKLLEEALNVTDP--AKIVGLVFNGDE---RPLAGYS-----HG---YGHST----
                                       * :.*                                

A0A2V6VPM0      --DYYGSRDG--------TIEPWWQRCRFWANKRTGVLR---------------------
A0A2V6YHI8      --HYVGSGKSRRTRRRKSMKSFFSGLLIVLSVLGSGITARAAEDEYRIGADDVLHIIVWD
A0A2V7A3P7      --HYVGIQKHRRRGHKPK------------------------------------------
A0A2V6T785      TNGHEASRWNRLVRRGRRIENGG-------------------------------------
A0A2V6RB03      GGGWRRLVSSSSRTHRRQTASDH-------------------------------------
A0A1Q7G9Y1      EEEPAGQRKRILMAAG--------------------------------------------
A0A2V7AVY2      --HYVGIQKR--KGKRRQ------------------------------------------
A0A2V7C3J3      --HYVGIQKR--KGKRRQ------------------------------------------
A0A2V6VAA8      --HYVGIQKRKRKGKRRK------------------------------------------
A0A2V7CNK3      --HYVGLQKRRKKGKRRK------------------------------------------
A0A1Q7TX95      --DYYGSRDG--------NIEPWWQRCRFWANKRTGVLR---------------------
A0A2V7B9E3      --DYYGSRDG--------NIEPWWQRCRFWANKRTGVLR---------------------
A0A2V6RAF2      --GYYGVGEGTSVRRRFRSAQSWWPIRR---SEKVG------------------------
A0A2V6UHF5      --GYYGVGEGTSVRRRFRSAQSWWPIRR---SEKVG------------------------
A0A2V7A9S9      GGWWRGPFGTRDRRHRKHTASDD-------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      SGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLSGNGITH---------------------
A0A2V7CME2      DDSRLAERV---------------------------------------------------
A0A2V6U1W4      EKETA-------------------------------------------------------
A0A2V7F4L5      GARW----RRAWRKP---------------------------------------------
A0A2V7BAF4      SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH---------------------
A0A2V7E6Z5      NAGWTATMRRRWRRSGHRYGNGHSHEN----------SH---------------------
A0A1Q6YM61      SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH---------------------
A0A1Q7IM35      SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH---------------------
A0A1Q7UA97      SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH---------------------
A0A2V7DAK1      SGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLSGNGITH---------------------
A0A2V6U3P1      HKG---------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ESRRR-------------------------------------------------------
A0A1F7PJN6      ESRRR-------------------------------------------------------
A0A1F7NCG6      DGRRR-------------------------------------------------------
A0A1F7Q5I6      DGRRR-------------------------------------------------------
A0A2V6SK79      HKG---------------------------------------------------------
A0A2V6PDA4      EDAFRPWYRGGQPLDRLLRR----------------------------------------
A0A2V6Q732      APWWRPFAKIRSVFDPDAAGRRRAERRREIR-----------------------------
A0A538RKA5      ---YRPY-----IAEPSVNGHSWSWRGRRGRDGARASSDGR-------------------
A0A2V6ZH60      TVDGTRR-----HRFSSRSRGRQTSSDE--------------------------------
A0A2V6ZW34      ----------------KTRSGRRKGERS--------------------------------
A0A2V6SIM1      ------------------ARWRWAAKRIQPFNGAKTRSSDIR------------------
A0A2V6SBN9      ------------------ARWRRAWSKP--------------------------------
A0A2V6TVU3      ------------------PRRRL-WRRP--------------------------------
A0A2V6XML6      ------------------ARWRLPWSKP--------------------------------
A0A2V7CEX0      ------------------RRL---WRSP--------------------------------
A0A2V6W355      ------------------ARWRRPWRSP--------------------------------
A0A2V6YDI1      ------------------AGWRRAWRRP--------------------------------
A0A2V7GJE5      AGWRRAM-----TRIAGSFRQRHSF-----------------------------------
A0A2V6X2Y0      --------------TYGRARRRQTASDD--------------------------------
A0A2V7AFT7      --------------TYGRARRRQTAPDD--------------------------------
A0A2V7BA71      -------------------RNRK-------------------------------------
A0A2V7BRT3      GGRRRRV-----FWSLDRIRRRRTASDD--------------------------------
A0A2V7FF08      ------------------ARWRRPWRKP--------------------------------
A0A2V6YDI2      ------------------ARGRGAWSRA--------------------------------
A0A2V6YK84      ---------------------TRSWHRKGENS----------------------------
A0A1Q7NS62      ------------------RRNGGGWRRRVFGNRDRIRRSVTAGRRRAPGFIGRAAEKIHW
A0A2V7D2F0      ------------------NGSTAGWK-----------------------FFG--------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      NKELEQTVVVRPDGKISYPLAGEIQAQDLTVPQLTEELTKRLSTAVKNPNVSVMVQEIKS
A0A2V7A3P7      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      SRTRERDGDQRGRSLARDRHGVGDAALARPLDPQQLRAARL-------------------
A0A2V7D2F0      ----------RGRSAARA------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      YRVHFVGKVVKPGVYPIKAGTPLLQALTLAGGTSENADLTAAYIIRGNKTLPVDLRKLVQ
A0A2V7A3P7      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      QADLSKNVRLERDDTIVVPEIALGSSLQEMQDRRIYVLGKVTKPGVYNLKEDVPILHALF
A0A2V7A3P7      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      LAGGVVEGGDLASAFIIRGKEKIPVDLWKLIQKGDVSQNVMVKHEDTIVIPAGGELQNAV
A0A2V7A3P7      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      YIMGEVLKPGVYSQPEALSLLKLVSLAGGFTKYAAPGRATLVRRDGDKKVLLKVDLKDIM
A0A2V7A3P7      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V6UHF5      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A538RKA5      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------
A0A2V6YHI8      NDPKKYEDLALRPGDVLIVPERLF
A0A2V7A3P7      ------------------------
A0A2V6T785      ------------------------
A0A2V6RB03      ------------------------
A0A1Q7G9Y1      ------------------------
A0A2V7AVY2      ------------------------
A0A2V7C3J3      ------------------------
A0A2V6VAA8      ------------------------
A0A2V7CNK3      ------------------------
A0A1Q7TX95      ------------------------
A0A2V7B9E3      ------------------------
A0A2V6RAF2      ------------------------
A0A2V6UHF5      ------------------------
A0A2V7A9S9      ------------------------
A0A2V6SIE8      ------------------------
A0A2V6V7G3      ------------------------
A0A2V7CME2      ------------------------
A0A2V6U1W4      ------------------------
A0A2V7F4L5      ------------------------
A0A2V7BAF4      ------------------------
A0A2V7E6Z5      ------------------------
A0A1Q6YM61      ------------------------
A0A1Q7IM35      ------------------------
A0A1Q7UA97      ------------------------
A0A2V7DAK1      ------------------------
A0A2V6U3P1      ------------------------
A0A2V7I866      ------------------------
A0A1F7NSZ2      ------------------------
A0A1F7PJN6      ------------------------
A0A1F7NCG6      ------------------------
A0A1F7Q5I6      ------------------------
A0A2V6SK79      ------------------------
A0A2V6PDA4      ------------------------
A0A2V6Q732      ------------------------
A0A538RKA5      ------------------------
A0A2V6ZH60      ------------------------
A0A2V6ZW34      ------------------------
A0A2V6SIM1      ------------------------
A0A2V6SBN9      ------------------------
A0A2V6TVU3      ------------------------
A0A2V6XML6      ------------------------
A0A2V7CEX0      ------------------------
A0A2V6W355      ------------------------
A0A2V6YDI1      ------------------------
A0A2V7GJE5      ------------------------
A0A2V6X2Y0      ------------------------
A0A2V7AFT7      ------------------------
A0A2V7BA71      ------------------------
A0A2V7BRT3      ------------------------
A0A2V7FF08      ------------------------
A0A2V6YDI2      ------------------------
A0A2V6YK84      ------------------------
A0A1Q7NS62      ------------------------
A0A2V7D2F0      ------------------------
                                        

© 1998-2021Legal notice