BYKdb

Dataset for cluster tadcd of phylum candidatus-dormibacteraeota

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2W6ATR5 [Bacteria] Bacterial tyrosine kinase [Candidatus Dormibacteraeota][Candidatus Dormibacteraeota bacterium] (length=564 residues).
MTVRQYARALRRRAWMLILVPVLALVAAVVVTHEMPPTYESQVTLLVRPAQPISSLDPTSSFVTADQVAHTYAQLMIQRP
LLQKVVTDLNLRMTPEALGRDVRVTPQSGTTVLTVTVQSRQPGRARDIANKLVDVFISQTKDLQQSQINQYTTKIDAQLE
LLKAQIQKEQARIDELQGGPTGANGLPSSRSQPRLNADQQSELYNLQQQVGLDRTQYNEIARNESSIVVNVARATDSVVV
IAPAVTSASPTSPKLWLNVLVAGVAGLALAVIVVVLLEQMDQSIRSTEQLVERTGLLPLASIPSWSAGRRGEKELVALHE
DPALGEPYRTLRTNILFSAIDRKLRTIAISSALPKEGKSRTAANLSVALAAAGHSTLLIDCDFRRPSQHRLFGRVQNIGL
ADLMLQEATESEVITPVEQVQNLWLLSSGPTPPNPSELLASGRMRELLARLAETFTYVVIDTPPVNLVADALVLGTYTDA
TLLVVEHGRSRYPAIRTAKDSLDRVGARLLGAVLNKVPSREGYGYYNYNYSANGKDNHPPRPKKRTEVLAAVGPSQEGPP
VSSN
© 1998-2020Legal notice