BYKdb

Dataset for cluster tadcd of phylum candidatus-dadabacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1K715      --MRGMQDLMRLT------------------------------------AVRRVLAAVRR
A0A3M1VEF6      ---MNRDKLPQLRPLTEGLPAGVEFEDGSDYQTLY-------------PQFKEYLKVIIK
A0A0T5ZTK1      MEEGNKRDVVEYK--------SNELKEREDYPLSTQVRREYDTHIEEEPNLRDYIDVILR
A0A7C2RYD7      MEEGNKRELMEYR--------GREIKEREDYFLSTEVRREYDGYIEDDIRLRDYLDVLLR
                    .  .:                                         ..  : .: .

A0A3M1K715      YRFVGLSFFIFVILGTLFFTFSQDELYRATSVVELR-WNPKTEVFP-FRDVSTQETWGGY
A0A3M1VEF6      YRMLILTSIVLLTLIALIYAFTVTPRYTAESVIKISTYQPILTA-TKIEDMLQQRS----
A0A0T5ZTK1      RKWIVISCLAISVVTVAIASLLMNRIYKAEATIEIAPENPKITTFQEVVELEPQPQ----
A0A7C2RYD7      RKWIVISCLAISIVTVAIASLLMDPVYKAEATIEISPENPKITSFEEVVEVESRQN----
                 . : :: : :  : . : ::     * * :.:::   :*       . ::  .      

A0A3M1K715      WSYDEFRNTQIEVIRSRRVLQRVVDVLG--------------------------------
A0A3M1VEF6      -KEANYLETQVKQIKSYSLADRVLSHDNLK---EQIFGKDSPG--------------LLA
A0A0T5ZTK1      -QTDSFYETQYKLIESKSLAKEVVSALQLDLHPEFAVKEKKPGFISFVND-------TFA
A0A7C2RYD7      -E---FYETQYKLITSRSLARDVINFIQLGSHPDFS--GKGQGFFHFLEDKAARATSAVS
                 .   : :** : * *  :   *:.                                   

A0A3M1K715      ----------------------DPSLTPALLEARLTVEPVPDSRLIRVSYMDTSPQRAAD
A0A3M1VEF6      TLFGWDSKKGTEAHSKDNIYNNSVREIQSYLD-RIEVKPLRRTSLVKIQATFTDPVLAAR
A0A0T5ZTK1      QILQANEKKSDPIEIEKRQLAREEGLLDSFLD-RVKVTPDRKSRLVQISFESSFPELSAK
A0A7C2RYD7      RLFSSKKEETDPV---KQRMAREEELIDAFLS-RLKVEPDKRSRLVQINFESSDPELTAR
                                      .     : *. *: * *   : *:.:.   : *  :* 

A0A3M1K715      IANTVVQAYMDVGVENRIRWIQQIVDWLRDRIDNTQDDIGRAQKDLFEFQKEMGSINLD-
A0A3M1VEF6      VANTHAREYINWVREARVSQQSAGLKFLKGQAQELRQKVADLEREQADYAEANSIVAVN-
A0A0T5ZTK1      VANTLVDEYIGWVLERKLDATKAARRFLEKQLGEVKAKLERAEEELSSYAKGADIVSLD-
A0A7C2RYD7      AVNTLVDKYIEWVVERKVGLTKAARDFLDKQLQQIKIKLERAEEELGQFAKGVDIFSLEN
                 .** .  *:    * .:   .    :*  .  : . .:   : :  .: :  . . :: 

A0A3M1K715      -KDRQQIEAEIDALHARYIDAHTRRIQLEGQLREMKRLAEQGNSGLQQLAHALAVEDRQG
A0A3M1VEF6      -KDENITAQKMSQLNRLLTAATAKRLEAEHLYQESLK------A-LKNNAAGID----DA
A0A0T5ZTK1      -EKFNLTYKQLAELNDALSKAETERLTKEALYKEIQA------GNYEYFPQVIS----DS
A0A7C2RYD7      NEKLSPTYQQLIDLSEALSQAEAERFSKEAFYNEVRS------GNYEFLPQVVG----DE
                 :. .    ::  *      * : *:  *   .*         .  :  .  :     : 

A0A3M1K715      AVATIQKRWVELQAERAGLSAVYGDAHPKMQALDRQLNALRSELLEAARKRIDGIRAQMD
A0A3M1VEF6      STQEIRSRLAKLEAEYQQLSAKFTPNYPKMQQLRYEIKALKQSIEGQRAQIVAGLKAKAL
A0A0T5ZTK1      SIQTLDEEHTKLKSQYDNMSVIYGPNYPEMKQLAAQLGRIQSDIKGRINGIAESIKKDYQ
A0A7C2RYD7      LFRSLSKQYAELSAEYENKAIIYGPNYPDLKQLAAQSKKLENAIEMRISGIAESIKKDYQ
                    : .  .:*.::    :  :   :*.:: *  :   : . :         .:. .  

A0A3M1K715      IATAEEEELLKAMDELVSAALDRSKIWQRYQELSDEAVSRRQFYEVLLERFKEIDITRDL
A0A3M1VEF6      AAAEEERSLKEELEKQKSMAFELSKRQVQYNILNRELQSARELLQNVLRQIDETSVAVEG
A0A0T5ZTK1      TALTKQNILMQRTDEQKKLVTKLNDKTVQYRILEREVETNKSIYQNLLQRLKETEVASGI
A0A7C2RYD7      TALEREKIIKQRVEEQKKLVSNLNEKAVQYRILEREVSTNKSIYENLLQRLKETEVTSGI
                 *   :  : :  ::  . . . ..   .*. *. *  : ..: : :* .:.* .::   

A0A3M1K715      NREQAVLIESAVPPAVAAWPNVRVNLAVGLFLALTGAIGMALLLNLLQQGVQNSEDLEAA
A0A3M1VEF6      NSSNVSIVDHAAVPLRPSFPKKGLVILIGLVLGTGLGFSLAFFLNYLDDTIRTPEELTAY
A0A0T5ZTK1      RATNIQVVDYASTPLIPYKPNIKLNMLLAILMGLMGGVFLAFIFEHFDNTIKDEEEVKRR
A0A7C2RYD7      KSTNIQVVDYASTPLVPYKPNILFNLLITTLIGLLGGVFLAFIVEHFDNTIKDEEEVKRR
                .  :  ::: *  *  .  *:  . : :  .:.   .. :*::.: ::: :.  *::   

A0A3M1K715      IGVRALAELPYLQTDSIDYPLEKLM-----------------------------------
A0A3M1VEF6      TALPSLGVVPSFEIENLLPENQSSVNGAGDIKAATGQTAKSNKGRGEKTGAPVPSKKPDN
A0A0T5ZTK1      FSLPFLGAIPLV-DENELQDLEKVV-----------------------------------
A0A7C2RYD7      YSIPFLGAVPLVSDENALQDTEKTV-----------------------------------
                 .:  *. :* .  :.     :. :                                   

A0A3M1K715      -----LHDPDSPLAESIRVVRNHILFAPRGRRIRAILFTGAQPLEGKTTTANNLAIATAQ
A0A3M1VEF6      FPVVYLRDPKSLASEAYRTIRTGILLSQAGEPPRTILLSSAQSSEGKTTTTLNLAASLAS
A0A0T5ZTK1      -----YANPKSLVSEAFRVIRTSILYSSPNSPPKSLLITSTQPLEGKTTCASNLALSFTQ
A0A7C2RYD7      -----YLNPMSIVSEAFRVIRTSILYSSPDHAPRSLLVTSTQPLEGKTTSASNLALSMVQ
                       :* *  :*: *.:*. ** :  .   .::*.:.:*. ***** : *** : ..

A0A3M1K715      AGRRVLLVDADLRKAATSKVWKARGRR--GFADVLSGNARWQDVVQPTEVANLSVMGTGG
A0A3M1VEF6      AGGRVVLIDADLRRPSLLKIIDGEERIRPGVVEVITGQANLEDVLIRDAMRRVSLLPSGN
A0A0T5ZTK1      SGLKVVLIDADLRKPRLHKLFLNNGYAF-GLSTYLVGKMELSGVINRTSLDGLDIITSGP
A0A7C2RYD7      SGLKVVLVDGDLRKPRLHKLFLSNGNAF-GLSTYLVGKMELSGVISKANVDGLDLIPSGP
                :* .*:*:*.***..   *:         *.   : *:   ..*:    :  :.:: :* 

A0A3M1K715      DPSHPPELFQKEALERVLPVLQQEWDIVIFDGSPLLLVADSIVVSSVVDETFIVMEAGRI
A0A3M1VEF6      PPPNPAELLGSIEMAGIIDKLATMFDYVLIDSPPILPVTDSVILSRYVDGVVLVVRGAST
A0A0T5ZTK1      IPPNPAELLGSKRMKELIEHLLEEYDHVILDGPPIAGFADSRLLASVVDGVLLVTSIGIT
A0A7C2RYD7      IPPNPAELLGSRRMKELIDCLLQEYDQVIIDAPPITGFADSRLLSRSVDGVLIVTSVGIT
                 *.:*.**: .  :  ::  *   :* *::*..*:  .:** :::  ** ..:*   .  

A0A3M1K715      HKREARDLVARLERIGQPTWEIILNKVTL-PSAWGY--DGYGYGYSYGYGSRGESELLVD
A0A3M1VEF6      PRKVVLDAKERLRSVGARFLGAILNDVDVTSGDYYYYNRYYYSYYNQEKHDSRAAS----
A0A0T5ZTK1      QRQTLRSSIEDILRVRGRIIGTIVNRLESRRSKYGY---SYYYYYNNEEG-------KRK
A0A7C2RYD7      QRQPLRSCIEEILRVGGRIIGTIVNRLESGRNKYGY---SYYYYYSDDQGDKHSASRQRK
                 ..   .    :  :       *:* :    . : *    *   *.              

A0A3M1K715      QGDVTVETV------------
A0A3M1VEF6      ---------------------
A0A0T5ZTK1      KSNLHLPHA------------
A0A7C2RYD7      NKKLFLKGRVGKRKSDSSFFS
                                     

© 1998-2021Legal notice