BYKdb

Dataset for cluster tadcd of phylum candidatus-marinimicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

28 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A101ID17      --------MNQNNHYMPYNEEEEINIKEIFQTLIKGKWIIALSFILVTAVTIWYTFNQTP
A0A124FPG2      --------MNQNNHYMPYNEEEEINIKEIFQTLIKGKWIIALSFILVTAVTIWYTFNQTP
A0A2D9VF15      ----------------MNELETNFNIKELLFFIRRNIKIMMAVFSLIMIFGCAYILKKKP
A0A2D7IJL9      --MNNQHLDYRSDNANYQTMENELYLKDYVIILRIHLKKIIIIFLIALSLGVYSTFSKIP
A0A2E3DVU2      --MKNNHLAFKEDNHNYHNIENELYLKDYFLLLRIHLRKLIYCVILFLLIGFYTTINKTP
A0A2E5VVQ3      --MKNQHLEYKSDNVNYQSMENELYLKDYIIILRIHLKKIILIFFIALLGGIYSTYSKIP
A0A2E1Q0C7      ---MTTELHNTQNGQQEISQEKSLNLRDYYFIFRTYYKLIVVMTILGLCIGFYSVLTLPP
A0A2D8V7U8      ----------MNNNINSDFNQKEISLEEIVFSLKKHIKIILFITFFCFFCTLIYVIIQKP
A0A2E1NF27      ---METNENTRIQNLETDYANKSLSFRDYIFLFRLHSKKIIFLTILSTLISIYKVYITPP
A0A2E6SF50      --MINRQSGLQSNGQMPNWQDNELTFRDYLFILRLHLKKILLFGLLGLGYSIYHVMTIPP
A0A2E0B890      -----------MNNSNQDFHKEEVSIKEIFFIIKSNIKKVYFSLFLFLFIGLIYIVITRP
A0A660XPG7      MDNTTGNMNSNIAQNFNVKEENELNLRYLVQVVMQRIHIVIIMFLLIFIGTILYTVNQSK
A0A2D7NA59      --------MSEKNKIINSIENYEISYWDIYFILKRHLKLICFSTVLILFLSVIYTLRLAP
A0A2E5VWZ7      ---MNNQNNLEKNSIQNFSENYTLTLQDYLLIFKIHLKKIIICLIIGFMSSIYYTYTITP
A0A2E5JPH8      ---MNTSSELHGNHDGQLGQEPELTIHDYWLIINRGRTSIIISTLILLVLSVYYNYSVSP
A0A2E6AXM8      ---------------MESQATTQYGFYDILYFLKRNYKYIILVTLLSVFIGALITLRTKP
A0A2E5GDL9      ----------MSNNNIYNNPVVELTLQDYLIIFRIHLKKIIIITLIGMVYGIYHTYTVPP
A0A660X6H5      -------MNQNNHYMPYNEEEEEINIKEIFQILLKGKWIILLSFILVMAVTIWYTFNKTP
A0A2E5SGC3      ----MNDFNENSKSFKNTDSSFDYSLKELYYILKNHAFAMLVTFFIVISIVIYYTLTVKP
A0A660XQL6      MENYNTQDKADFSRGTLPEQEKEVSLQDYIRILYRGRWIISVSFIVVMFFTVYFTFTAAP
A0A2E1WWX4      -----------MIENQNSNLESSYTIQEILFLLKKHIKIILAIFFATILLILIYTFSSDY
A0A660WZA2      ----------MNLRTQGDFEEKEVNLQDYLRVLYKNRWLIISIVLIVLASTVYFTFTAPP
A0A660X7Q8      ----------MNLRTQGDFEEKEVNLQDYLRVLYKNRWLIISIVLIVLASTVYFTFTAPP
A0A2H0XTF1      -------MEGLNNQSQSDFQGKEVSLQDYLRILYHGRWIIGISFVLVMIITTYITFTAQP
A0A2E5XY54      ------MNQTQSNNYSXDNNXIELSLRDYFLILKIHSKKIFFFTLIGLLISIYFVSVKKP
A0A2E5U5G7      --------MDKQNQSSFEDSR-EYSISEILFIIRKHYKLSFLIFFITLFFTIYYTLAVKP
A0A2E1Q8L9      -----MKELKINYMTNQENKKEDLNIDEIYFLILKHYKILLSSIVSCLVFSFFYILTIDP
A0A2E2VWX2      -------------MSXXDNQKXDLTLKEIYFLILXYXKIFXXSIFSCXIISLFYVFTXDP
                                                .                           

A0A101ID17      IYEASTQILIGAAGNQTA--AIFDIMTPLGNSQMEINNQVEILKSRSLAENTIKNLMENY
A0A124FPG2      IYEASTQILIGAAGNQTA--AIFDIMTPLGNSQMEINNQVEILKSRSLAENTIKNLMENY
A0A2D9VF15      IYNASGTILIESSNNKS---DVFN----FSHENKIIEDKIEILKSSTISKRAIKDLISIS
A0A2D7IJL9      KYRASATIMVTQKPGS----QSLQSFGNSDNNVQIINNKILLLKSRGLLESVVKDYWDSN
A0A2E3DVU2      MYSSKGTMIVRVSPGA----NTVADITKQKNNNQ-IRNKIELLRSRTLAEDVVRSFYDSK
A0A2E5VVQ3      RYRATATVIITQKPGS----QSLQNFGNSDNSAQ-INNKILLIKSRALLKLVVQEYWDSN
A0A2E1Q0C7      KYTATSSVAIREKPGA----SMIMDLTGNRDRNR-MSNEIQLIKSRSVAKGTIESIWDQK
A0A2D8V7U8      RFESTSLILIEDPSASAM--DIFD-AGVKTNKNY-IENEKEILKSRTIYEKSIRTLLESD
A0A2E1NF27      SFTAKATIVIREKPET----NLIMDMTGNRDRNR-IENEIQLIKSKTVAKAVIKKIWEVK
A0A2E6SF50      SYTAIATVVVQDKPGA----GMIMDITGNRDRNR-MTNEMQLIRSRSVAKATIKEIWRYK
A0A2E0B890      TYSSYGAIIVESEDSAMS--SIFD-MELGSAKNY-LENEIELLKSRTTAERTIQSLLNSN
A0A660XPG7      VYKSETQILIENGVAAG---GVFEQMTPFINNDMVINNEIQIITSRTIAERTINSLLVEY
A0A2D7NA59      VYSSTGVILIEDPSSRV---NIFD-MGVGSDKNL-LENEIEILNSHTTAESVVNRLLNSN
A0A2E5VWZ7      TFQSTSKIEVREKPGA----NMIMDISGRAKIDK-MTNEIQIIKSRVLAKRIVKRLWESN
A0A2E5JPH8      DYTATSTLLIKSESDAS---AIFD-FGGRMSQSE-LANQIELVQSRQVATNTIKTLWNSK
A0A2E6AXM8      VFTSFSEIEIVEDDNSGF--GKMSGFEAFVDQRS-LSDKIRNIGLRPIAEKTIDKLIKPV
A0A2E5GDL9      KYQSTATVMIREKPGA----NMMN-FGGNSSKNR-MVNEIQLIKSRALAKSVVKELWNSS
A0A660X6H5      IYEASTQILIGAAGNQTA--AIFDIMTPLGNSQMEINNEVEILKSRSLAENTIANLMENY
A0A2E5SGC3      VYESSSTVMVRQDQKSMSIFSMLD-MGLTKDRNY-IENEIEVLKSSTTLDVVVNRLFESK
A0A660XQL6      QYEASTLFMLAARPGQTS--GLFQ-NPWMPGNVMKVNNEIEVLKSNALARRVIKSLRNSP
A0A2E1WWX4      IYKSSSTIIVNKDPNS-L--SILN-MGYSGERNF-IDNEIGILRSRTTSEKVIKRLLDSD
A0A660WZA2      KYEARALVMLVSTPGQ-A--SLFT-SPFMPSQYLKVNNEVEVLKSFALGRRVIKSLKESP
A0A660X7Q8      KYEARALVMLVSTPGQ-A--SLFT-SPFMPSQYLKVNNEVEVLKSFALGRRVIKSLKESP
A0A2H0XTF1      QYQSTTLLSLAGRAGQTS--TLFS-NPFMPTNMMKVNNEIEVLKSNALSRRVIAALRQSP
A0A2E5XY54      EXTAVVTVAVKDKPGA-G--MVMD-MTGNRDRDR-MINEIQLIKSRRVVKATIKEIWPNK
A0A2E5U5G7      QYRSTSMIMVNEDQKS-R--SMLN-MGLDANRNF-ISNEIQVLKSRTTSQLTIEKLLDSE
A0A2E1Q8L9      IYESQGSILIEDPQNDVS--NIFD-VGLSKTKNF-IYNETEILRSRTNSEEVIKQIYNSG
A0A2E2VWX2      XYESYGSILIEDPQNDVS--NIFQ-VGLGKTXNF-LENETEILNSRTNSEEVIKQIYXSG
                   :   . :            .            : ::   :         :       

A0A101ID17      SP----------------------------------------------------------
A0A124FPG2      SP----------------------------------------------------------
A0A2D9VF15      KN----------------------------------------------------------
A0A2D7IJL9      RR----------------------------------------------------------
A0A2E3DVU2      RR----------------------------------------------------------
A0A2E5VVQ3      RR----------------------------------------------------------
A0A2E1Q0C7      K-----------------------------------------------------------
A0A2D8V7U8      VK----------------------------------------------------------
A0A2E1NF27      R-----------------------------------------------------------
A0A2E6SF50      K-----------------------------------------------------------
A0A2E0B890      QI----------------------------------------------------------
A0A660XPG7      PL----------------------------------------------------------
A0A2D7NA59      HK----------------------------------------------------------
A0A2E5VWZ7      RR----------------------------------------------------------
A0A2E5JPH8      HR----------------------------------------------------------
A0A2E6AXM8      NSVFLTKDNKLLYNYNYDKIDTLYFTYNGESKKIKINVTQGCGVLYEDVRVPLGIKKVDT
A0A2E5GDL9      RR----------------------------------------------------------
A0A660X6H5      SP----------------------------------------------------------
A0A2E5SGC3      YK----------------------------------------------------------
A0A660XQL6      YA----------------------------------------------------------
A0A2E1WWX4      -N----------------------------------------------------------
A0A660WZA2      YA----------------------------------------------------------
A0A660X7Q8      YA----------------------------------------------------------
A0A2H0XTF1      YA----------------------------------------------------------
A0A2E5XY54      -K----------------------------------------------------------
A0A2E5U5G7      YR----------------------------------------------------------
A0A2E1Q8L9      ------------------------------------------------------------
A0A2E2VWX2      ------------------------------------------------------------
                                                                            

A0A101ID17      ------------------------------------DSLYILGKGQEEKMESTLNRVKNW
A0A124FPG2      ------------------------------------DSLYILGKGQEEKMESTLNRVKNW
A0A2D9VF15      ------------------------------------EKLYALGNKVYKPEGFYRKAFEY-
A0A2D7IJL9      ------------------------------------NNMFLFNTRKFFPKGQAIRTLLK-
A0A2E3DVU2      ------------------------------------NNLFLFGTRKYYPKGQRIRTLFK-
A0A2E5VVQ3      ------------------------------------NNMFLFSTRNFYPKGQTIRTIVK-
A0A2E1Q0C7      ------------------------------------NNLALFDSYPFYPRGKRVRVLLK-
A0A2D8V7U8      ------------------------------------NNLFLFGTREYNHPFNFIPSFLYK
A0A2E1NF27      ------------------------------------NNLDLFNSYPYYPGGRELRKSLK-
A0A2E6SF50      ------------------------------------NNLALFGSYPFYPRGKRLRQFTK-
A0A2E0B890      ------------------------------------NNLHLFNTKKHED------GFLRE
A0A660XPG7      ------------------------------------DSLYLFDRGLLLENQSFSTKLKK-
A0A2D7NA59      ------------------------------------DNLYFFGTRKYTPVG------LSK
A0A2E5VWZ7      ------------------------------------NNLHLFGTRIHYPKGQSVRQLVK-
A0A2E5JPH8      ------------------------------------NNLSVFGTRKFLPRGQRPRRFIN-
A0A2E6AXM8      NDVLVLSDNSLNNNFKISDTLIPDGEYHNGCDLPDFRQMYLLNTKKYKYFGLR-KTFKNI
A0A2E5GDL9      ------------------------------------NNLHVFGTRKFYPRGQRPRVIIK-
A0A660X6H5      ------------------------------------DSLYILGKGQEEKVESFFNQAKKW
A0A2E5SGC3      ------------------------------------NDLFLFGTKKYEP------SWIRA
A0A660XQL6      ------------------------------------DSLYVLGVREYDKKGIGFSELIAG
A0A2E1WWX4      ------------------------------------IDLHLFGKKNNNK-----------
A0A660WZA2      ------------------------------------DSLYILGTREYEKRGLNISGAIGG
A0A660X7Q8      ------------------------------------DSLYILGTREYEKRGLNISGAIGG
A0A2H0XTF1      ------------------------------------DTLYILGTRHYQQKGIDFKKVFKP
A0A2E5XY54      ------------------------------------NNLALFGSYPFYPRGRRVRTFXK-
A0A2E5U5G7      ------------------------------------NDLYILGTKKYEP------NFYR-
A0A2E1Q8L9      ------------------------------------QKLYILQNREDKK------GLIK-
A0A2E2VWX2      ------------------------------------EKFFILQXXQVNH------SFIX-
                                                      :  :                  

A0A101ID17      I-----LFLGNRGTEDEELIS-------SREDTIRSLAYT-----------LQEAITITP
A0A124FPG2      I-----LFLGNRGTEDEELIS-------SREDTIRSLAYT-----------LQEAITITP
A0A2D9VF15      ------LSTLGGVLDSKEEDI---SLNYNSESTILYLAKK-----------LRQSIKIEN
A0A2D7IJL9      ------EIFTLGLYDAEKFKETKVLDGFYKEEIGQKYAKV-----------LQRNLSVGR
A0A2E3DVU2      ------EIFTLGLYDAQDALKVSTLEGPLTYERLDDFSKR-----------IKNHLTVKH
A0A2E5VVQ3      ------ELFTLGLYDAEESKKTKILEGPYTEEIGEKYAKR-----------IQNNLSAGR
A0A2E1Q0C7      ------ELFSMGLYDSKSNGP-AKYTEDYNDEIGERFADR-----------LLAGLSTKH
A0A2D8V7U8      KPDY--RYIDNTLNETEFLSA----------------VKK-----------LKDKTTIVN
A0A2E1NF27      ------KLFTLGLYDPKLDKPINYGDQLYTDQIGERFSDK-----------LLLRLKISP
A0A2E6SF50      ------EILTLGLYDPSTDLPLRYNEE-YSDKIGERFAEN-----------LIARLKVNH
A0A2E0B890      FFRNILFLDLNKNPEILINNE-------VNDSLFNVFVKK-----------IRNNISISN
A0A660XPG7      -------QLKKMFSKEEEKVL-------TLDQKRKNYINR-----------LLNDLEVEP
A0A2D7NA59      LLDSFFSINGEEYEKNEFLIS---------DSLVNQLTLD-----------LQQNISVNS
A0A2E5VWZ7      ------EFFSLGLYDENSFKP---------KEYNEPYSEN---IGEKFSGKVLSGLKVNN
A0A2E5JPH8      ------EIITFGMYDPESNKP---------KKYDKEYSEE---FCRRFVIKIKKSMEVKS
A0A2E6AXM8      ITMFGLFPIIDKNDDFSRNES-------FSDGEIRFFVKK-----------LQESLFIEP
A0A2E5GDL9      ------ELFTLGLYDPDSDMP---------IQYNQPYSES---IGDQFAGNILSGLNVNN
A0A660X6H5      I-----LLLGNKDAETEEWVS-------TREDTIRALAYT-----------LQEAITITP
A0A2E5SGC3      FLTFGIDSFASDFELGEELN----------DSLKIIFSDR-----------LLNSLDVLN
A0A660XQL6      MKIGIKNLIFGKPEVASGVI----------DTLDRTLVKG-----------LRGAMKVEP
A0A2E1WWX4      ------SFFNSTDNNNDFQAL-------SKEDFVNKYANK-----------LKKSVYISN
A0A660WZA2      IKDFLKGLFAGKPVEPA---V---------DTLDRELVKE-----------LHESMKVEP
A0A660X7Q8      IKDFLKGLFAGKPVEPA---V---------DTLDRELVKE-----------LHESMKVEP
A0A2H0XTF1      LIFGLEAIFQNIPFDTSTSLV---------DTLDRALVRA-----------LQASMKVEP
A0A2E5XY54      ------EFFTLGIYNSNMEEP---------VKYSMKYNDX---IGERFVGXLIQNLKATP
A0A2E5U5G7      ------TILTFGLLDNSQNIV---------DVDSEIFAESSDAWIDFCTKELMKSISVKN
A0A2E1Q8L9      ------SFFNKQYYIDDMVLT---------DSLLLEFSNY-----------LRKSMKIEN
A0A2E2VWX2      ------SXINKHYXIENMVLT---------XSLLSEFSEY-----------LXKSMRIEX
                                                                   :        

A0A101ID17      ERNTQTIRISIKSPDPKEAALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERL
A0A124FPG2      ERNTQTIRISIKSPDPKEAALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERL
A0A2D9VF15      IRKTNILNISVNSLSPTEAALIVNTFIDAYIDQEKKWANQEINQSITFLESQIEKKELEL
A0A2D7IJL9      KGGTNMIWINYESENADEARRIVNTIVRRFEQKDKEWTNKYAINSISFLDSLVNIQEKKI
A0A2E3DVU2      IPNTNLIEVSYRSKNADEARRIVNRTMGIFSVKDKEWSNQYALNSVSFLDSLVNVQEKIL
A0A2E5VVQ3      QGGTNMISVTYVSKNADEARRIVNSIVKQFEIKDKEWTNKYATNSVAFLDSLVTLQEKKI
A0A2E1Q0C7      RQGTDVIDISYTSVWPHEAQLIINNLVKVYKKFEMEISGEYAGNTVNFLEKILSDHDTKL
A0A2D8V7U8      KNKTDIIKVTVNSIDPDESALLANTIVNVYQGTDLEWSTGEMTSLKSFLDSQITIKENEL
A0A2E1NF27      RPRSDIIDISYTSVWPIEAQLIINTIANTYKDFDKNLSGEEASKTLKFLEKLVQNIEQEL
A0A2E6SF50      RQGTNIIDISYTSVWPMEAQLIVNTVADVYQDLDQKWSGEKANNSVQFLDELVKNQEKKL
A0A2E0B890      LRNTDVLKISYSSPDPYEAALIVNTLINEYQRRDKEWASGEMNHLKNFLFEQVVLKEKEL
A0A660XPG7      VRETQTINISIESYSPTEAAIILNELVTQYYANDLERVSNAAGKVRNFLEIQINDVEPKL
A0A2D7NA59      QRNTDVLKISITSIDPNEAALLVNTLIDEYKNIDLKWANGEMSHLKSFLLEQIEKKEIEL
A0A2E5VWZ7      IKNTNILKITFSSPNADEARRIANLVANTYIDFDRERSRENARRSVAFLDSLVYSKREEI
A0A2E5JPH8      KRGTDILILSSTLPFPEEAALVANTVAEEFAKLDARWGAEHTHNLLSFLESQIVIKENEL
A0A2E6AXM8      VKETSHLVITVKSFSPSEAADLANCVIDSYIEEEIKIANKRTSAQIKFLKKDIKLNSDIL
A0A2E5GDL9      RRNTDILEITITSVNADESSRIANSIASNYVRLSKIWNSEQAMQSVEFLESLVSMQEEKL
A0A660X6H5      ERNSQTIRISIKSPDPEEAALIANTFAYEYYKQDLERSRGAMSEVKSFIQEQLEQVEVRL
A0A2E5SGC3      KRNTDAIKITVKSKSPIESKLIANVLIDVYRERDLNWLTAEMGHLKNFLSSQLKQKEKEL
A0A660XQL6      IRDTEAIRLTVTSVDPNEAALLANTIAREYYHLDLEYNLAEVVEMKDFLEEQLEKIEEDL
A0A2E1WWX4      NKRTDAINISIESKDPEEAAMLVNTLIDVYRERDLEWATGEMSHLKTFLLNQLSKKQKEL
A0A660WZA2      IRETEAIRIIVYSVDPFEAALIANTIAQEYYEMDLEFNRSEVVETKNFLEEQLKKIEQDL
A0A660X7Q8      IRETEAIRIIVYSVDPFEAALIANTIAQEYYEMDLEFNRSEVVETKNFLEEQLKKIEQDL
A0A2H0XTF1      IRETEAVRLTVTSASPIEAAFLANMIAREYYRLDIEFNLGEVVEVKNFLEEQLVDIEKDL
A0A2E5XY54      RKGTDIXDISYTSVWPAEAKLIVNTIAEKYEEFEHMLGSEQAASSLKFLEKLVKDQENDL
A0A2E5U5G7      EKNTDVLSISITSLSPFESSLLVNTLIDIYKKRDIEWVTGEMSHLKHFLVDQLSEKEIEL
A0A2E1Q8L9      TIDTDVLNLSIQSKNPEEASLLVNKIIEVYKQRDLNWVTGEMQHLKQFLNEQLAIKEVDL
A0A2E2VWX2      SNETDVLKISIQSKNPEEAALLVNTIIDVYKQSDLXWATGXMQHLXQFLKEQLSIKEIEL
                   :.   :      . *:  : *     :   .             *:   :      :

A0A101ID17      RVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDI
A0A124FPG2      RVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDI
A0A2D9VF15      EEIENQIKTFQISNEIYNIGETSKLLLEQFLDIESKL-----------------------
A0A2D7IJL9      ENAENKKMEFMLEHDLFSMEANSDVIISQINDYEMKLYDIETEISIQQKQMDVLKSKFSK
A0A2E3DVU2      QNTDSLKMDFLLENKLHSMEAKSDDIIKRINGYEGELYNIKTQKSINKQKIEFLSSKLSS
A0A2E5VVQ3      ENSENEKMKFMLENNLYSMEAKSSVIISQINAYELDLYDIETELSIQQKQIDLLKSKFSN
A0A2E1Q0C7      ERSEKEFTNFKNQERMYDLDGTALMVTTQVANIESEIYNAVSEINIRSEKYNLLKSKLSS
A0A2D8V7U8      NISAQELKKFQEEEKIFSIDDNSSLLLTSLLNIESEYYKYKAEGNILKERISYIEDQLTS
A0A2E1NF27      YKSEKELTEFKKKEKMYDLNGPAIDISAQIAAIEIEIYNASSEKQLKQEKYSILKSKLSK
A0A2E6SF50      RDSEKALTQFKKQERMYDLDGKAIAITGQISSVETEIYNTASEINIRKEKYNHLKSKLSQ
A0A2E0B890      KEIEEKLKLFQEKEHIYGLDDNSNLLLNQLTTVESDYYNTKAKKNISLERKKYFQNQLSK
A0A660XPG7      AAIEEQLSDFLEKEGIVDLDENAKQLIQKSAEFEAQLFTARAELNIVNDQLEFLKSQFDE
A0A2D7NA59      TEFENSLKQYQEKEKIFGMSEMSNLLLNNLINSESQLYKSKAEYNILQERINYIKNLLTD
A0A2E5VWZ7      EIIEKEIREFKLNNNMYGLDGDASSISLQLNNYESDLYTIQAEINIRKEKVEILNSRLTK
A0A2E5JPH8      AVAEELVKDFMEAEKIFDLTGNAELIMMQSTDVESKFYETAAEININEENILYLQEKLSK
A0A2E6AXM8      KEIEDKIQDFQQEEDILSVDGNVDEHVGQFLKLKSDRVTQKLKLKDLIYSKQIFEDEII-
A0A2E5GDL9      NTSELEIKNFKINNKMYSFSGSNTSVTDQLAVLDSELLNILSEINIRKEKISLLNSKLSE
A0A660X6H5      RASEDSLRAFQQREGVVNLDETSKNLLDQLSNFESEYYSAMAELEINEHQLNYLTNELAA
A0A2E5SGC3      NQIEEKLKKFQEEKKIFGLEDNSKLILENLTDIESRYNNILAMIDINSHKIKHINDLLTI
A0A660XQL6      TRSEENLKEYQESEGVFGLDETAQTLIDQLSTFEATYYTTLADLKVTREKLNNQQELLNE
A0A2E1WWX4      NEIENLLKSFQEKEKIFTIDDNSKIILDNLTLFETEYNNVLASIDIINEKEKFITGQLNS
A0A660WZA2      AKAEEKLKEFQEKEGVFALDEAAKTLIDQLTTFEAEYYTTVANLKVLKGKLKNQQKLLNE
A0A660X7Q8      AKAEEKLKEFQEKEGVFALDEAAKTLIDQLTTFEAEYYTTVANLKVLKGKLKNQQKLLNE
A0A2H0XTF1      TASEEALKDFQKREGVFGLDETAQTLIDQLSTFEATYYTSLAELEVSKKKWDNQQKMLTD
A0A2E5XY54      INSEIKLTEFKKKERMYDLDGSALNLVSQISNVESEVYNFESEINIKQQKYNIGKSRLSA
A0A2E5U5G7      NQIENKLKEFQESEKIFSLDDNSKLILENLTQFETQYNNILAEINIIEEREKYLNAELTA
A0A2E1Q8L9      NNIEEKLKNFQENEKVFSISDNYSLLLGELSELESKYYNFEAEINILKSRKEFMYNQLSK
A0A2E2VWX2      NXIEXKLKDFQENQKVFSISXNYTLLLKELXNLESNYYNFEAEINILESRKKFMYDQLSK
                         :     :  .              .                          

A0A101ID17      KEKELLNNFIQTANPLILELQTKIAKLEASVVEAIAK-GIDENAPQIQTIKVQMDKMKER
A0A124FPG2      KEKELLNNFIQTANPLILELQTKIAKLEASVVEAIAK-GIDENAPQIQTIKVQMDKMKER
A0A2D9VF15      -------------------IQEKINYEDAVNLKNSYLQEESAKNEVSSTRKLELKELKRE
A0A2D7IJL9      QELNLTSSLMDNINIQLSSLRNEVGRIESQIALNSGIYG--DTHGSVIALNEKHSLIKEE
A0A2E3DVU2      EEKDLADKIVGNINIQLSALRDEAAKLESQIITNSSIYG--ETHEFVQDLKKKLNNLTVA
A0A2E5VVQ3      QELNLTSQLMNNINIQLSSLRNEVGNIESKIALNSGIYG--NDHGSVIELYGKLNLIKAE
A0A2E1Q0C7      DEKILADRLLNNINVQVLSLRGELGKIESLLIQNIAQHG--ENHGAVRDLKKKLEGIKEQ
A0A2D8V7U8      EEKKMVNNVTNTINNRLFALKNELALKETELISAISQQG--EDHQIVKNIERKLESLKER
A0A2E1NF27      EEKNLANKILNTIDAQVVYLRDDIGSLEGQLIQNIALYG--EGHSAIKSIKSRIDILKVQ
A0A2E6SF50      DEKNLAEQLMNNINIQVISLRNEISQLEANLIQNIAQYG--EEHGAVMELKSKMQGLKSQ
A0A2E0B890      DEKEFANRVSNTLDVQLYSFRQELASLEAEYNSTKAREG--STHPAVIDLDKKIKNLKIL
A0A660XPG7      KQQQILDIRLQVANPLILRLREEIAVLEKYFIDADQSIS--DNQVKLAEMELK----KKR
A0A2D7NA59      EEKLLSEKVINTINERLFTLKNEIAIKEAELVSTIVQQG--ENHNIVQVLTEKLDRLKLN
A0A2E5VWZ7      EEKSLTGQIINDINSQLINLRLEIGRLESQLLQNKNKYG--SSHDAVIGLTNKIDRLKGE
A0A2E5JPH8      EEKQLADQLLNSLNSKLFALRQEIGQREAEQIRNEGLYG--SQHDAVISTRKRISTLKGQ
A0A2E6AXM8      ------------------------------------------------------------
A0A2E5GDL9      KEKNLADQLVNNINTQLISLRVEIGDLDSKLMQNTALYG--ENHAAVKELKAKIGGLKDR
A0A660X6H5      KEKDLLNNFIQTANPLILELQIKIARLEASVVEAIAK-GIDENAPQIQTIKIQMDKMKDR
A0A2E5SGC3      DEKEFSESVTNTINDRLFALKNELALSEAELVSLETQYG--KNHAALELLNNKIEILKSN
A0A660XQL6      REKWIVKEAINTTNPLIVQLRQAIAEMEAEKITAMTVQGLTRDHDAMTEMDTRIKDLKKK
A0A2E1WWX4      DEKLLAKKVSNTINQRLQAFKVEMAVIESELISTQTKYG--NNHSAVLELENKLENVKSK
A0A660WZA2      REKWIVQEAMNISNPLIEQLKAAIAEVEAEKVKAITVHGYEPDSEALKEYDRRINQLKEK
A0A660X7Q8      REKWIVQEAMNISNPLIEQLKAAIAEVEAEKVKAITVHGYEPDSEALKEYDRRINQLKEK
A0A2H0XTF1      REQMVLKDAVNTTNPLISQLRQAIAEIEAQKITAMAVQGYKTGDAAIRELDGRIQELKIK
A0A2E5XY54      EEKSLTDQLLNNINIQVLSLRGEIAVLESSIIQNEVQYG--KNHVAVIELNNRLLSLKKQ
A0A2E5U5G7      DEKGLVNRVSNTINNRLFALKNEIDINESELISTITQYG--ENHSAVISLKNKINKLRTQ
A0A2E1Q8L9      DEKNLAQSLSNAINARLDALRNEIATKEAELIKTVNQRG--ENHEAVSFIKEKIGRLKKK
A0A2E2VWX2      DEKNLAKSLAXTMNARLDALRSEIAXXEAELIKTVNQRG--ETHEAVXSIKDKIERLKXK
                                                                            

A0A101ID17      LNQETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELE
A0A124FPG2      LNQETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELE
A0A2D9VF15      VNANQKIISERIL--NIKEELLIKQN-------------------------------ALN
A0A2D7IJL9      INKKASLLIEKGI--TTNDPLLMRNDQISQILALENSMMALKLNKDQNEKMLDLFKNKLN
A0A2E3DVU2      IDERVTKLALKGI--APQDPLRERQEIISEILNLENNIYYLNITENETQKELDRFNEKLR
A0A2E5VVQ3      INKKVDMLIAKGI--AVDDPLLVRQEQISQILSLEGSMTALKLSRDQKVKMLNSFKNKLN
A0A2E1Q0C7      LSLKIKELTKLGM--VVQDPLLARQNIVTELITLDTEIVAYELKKNESKNLLKIYLEKLK
A0A2D8V7U8      LKLETRKLVSQGI--AVADPINYRQSLMDSVISISAIYATIEAKSSEYEKLVNQYESQLV
A0A2E1NF27      LNNKVNELTEQGI--VVQDPLQSRQEIVTQLISLDNEIVALKLKKKQSEELKTIFQDKLN
A0A2E6SF50      LNTKVKELTQQGI--IVQDPLKARQDIVTELISLDSEIMGYRLKKKESERLLSLYEEKLD
A0A2E0B890      LNTETRKYVNQGI--IVANPIESRQAIMDSVINLDAFISAYNSKLLELDKLISNYESQLS
A0A660XPG7      LEEETLLLVQYGYLPGELDPMAVNQTILAQIVENESKKVSLETKVEEYSKLNRYYNGLIE
A0A2D7NA59      LQKETRVLISQGI--SVADPIKYRQSLMDSVISITAVSAVYESKIKEFDNLVENYELQLG
A0A2E5VWZ7      LDTKVSILISKGI--TVQDPLQNRQEIISQLLNLDSEIISYQLRESEIKKMLNHFTQKLN
A0A2E5JPH8      LDQEIQSLISRGV--AVADPIEYRQTLIGELLKSQATLAGYKAKADQYRKLMNHYNLQIE
A0A2E6AXM8      ---------------KQDIPKSYELSVKDTLRSLNINIELVNNRIENIAQEISSYQEFLD
A0A2E5GDL9      LNLKVADLIAKGV--TVQDPLVARQEIITELLKLDSDILGLEIKMAETKRIQKLFINKLD
A0A660X6H5      LNEETRMLISRGYIPGPDDPLSINQNMLENVIRLRLEQIFHQSKAKEFKKLVDYYNEELQ
A0A2E5SGC3      LKDETRVLISQGV--AVANPIDYRQGLMDSVIHFKTIKGILESKAISYKKLVDSYDAKLS
A0A660XQL6      LFNEAQNLTSLGL--SPEEQSQISLDLLKNVLFSNVEIIALEAKGKEYKQLVDQYSSELN
A0A2E1WWX4      IEDETRNLINEGI--TVADPILYRQTLMDSVISIKAVKANLLSKAKAYQNLVDDYDNKLS
A0A660WZA2      LVIEAQKMTNLGL--TPEDQSKISMDLLKDVLFNQVAVIELETKANEYKKLVEKYTKEFN
A0A660X7Q8      LVIEAQKMTNLGL--TPEDQSKISMDLLKDVLFNQVAVIELETKANEYKKLVEKYTKEFN
A0A2H0XTF1      LYKEAENLTNLGL--SPEEQSTISADLLRSVLFTSVEKIALEAKCSEYKDLVNQYAAKLN
A0A2E5XY54      LIEKVNKXVAQGI--TSEDPLKSRQXIVLELIALDSEIIGLNLRKKEADKLLNILNTKLN
A0A2E5U5G7      LGDETKSLIENGI--SSADPILYRQTLMDSVISIKAIKANLNSKSISYKEIVDLYDKKLS
A0A2E1Q8L9      LKEETNDFINNGI--SVSDPLLYRQEIMDSLIKVESIIPNLQSKKNEYKNLIDEYEKQLS
A0A2E2VWX2      XQIETNDLISKGI--SVSDPXLYRQEVMDSLIKVESIIPNLESKKYEYKNLIDEYEKQLS
                                                                          : 

A0A101ID17      KLPQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPK
A0A124FPG2      KLPQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPK
A0A2D9VF15      HLPEETIELMRLERIKNISEQTFRLMMQKLDESKIMFESQTGDAKVVDYAYPNINRVSPK
A0A2D7IJL9      SIPETNIIMERMNREDEILNEHYLQLVNTLETTKMNNVIEKGDVQIVDLAKKPSRPFTPN
A0A2E3DVU2      SIPETKMQMDRFERQEMILRDYYLALINKLEETKLNNAILVGDVRIVDLAKLPKIPYSPN
A0A2E5VVQ3      SIPETDMILERLNRQDEILNEHYQQLVQTLETTKMNNVIEKGDVQIVDLAKKPSRPFSPN
A0A2E1Q0C7      DLPEKQLQFSKLQRNSIILNENYSLLRKQLEEAKINLAVQVGKVHIVDYARLPFVS-GQN
A0A2D8V7U8      VLPEKLLEFSRLKRNLNIDTETYSLMRSKIEEAKINEASKISKVRVIDKANPDYERVTPK
A0A2E1NF27      QLPPKQLEFSRLQRNNIVLNQNYSLLRQKLEEAKINIFSKFGKVQIVDYASVP-EKFESN
A0A2E6SF50      LLPSKQLEFSRLQRNNIVLNQNYSLLRQKLEEAKINVASQVGKVQIVDYSRLP-GSTGQN
A0A2E0B890      LLPEKYLAYTRFQRDKIILDETYSLMKQKLEEAKINEASQLGKIRIVDSAVENVRKTAPK
A0A660XPG7      EIPSASISYIHLERERQTHERIYLLMKERYEEARIQEASQISNVYVIDKAVPKYLPIKPK
A0A2D7NA59      ELPEKVLKYTRLERNLNIHAETYSLMRQKLEEARINEASKVGKVRIIDKARPDYNRIKPK
A0A2E5VWZ7      DLPEKQMDLTKLVRDADILKQNYLFLKQKLEDAELNVAIEVGDVFLLDKARRPSSPIGPN
A0A2E5JPH8      KLPKKQMEFARLERDRSVLNTTYMFMRQKLEEARVNVASEGGKIQIIDRAHIPGRASSPD
A0A2E6AXM8      DLPRKTREFNNLKERKIEISTENIFLTEKLKNAELIYNSAQPGLTIRVDAKEDFERLKPS
A0A2E5GDL9      DLPQKQLELALLQRGSDILNQHYSHIRQKLEEARLNVAIEVGNAQFVDSALKPNKPSSPN
A0A660X6H5      KLPQVIITFMRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPIYPVSPK
A0A2E5SGC3      SLPEKMLEYARLERQRVIQAETFSFMSTKLEEARIGEASKLGKIRIIDHAIVDSKPISPN
A0A660XQL6      KLPERSLKYARLDRERQVNEKYYVLMKTKYQESRITEASKISNVRIVDPAIPPEKPVKPK
A0A2E1WWX4      MLPEKILEYTRLERDRAIHAETYRFMSQKLEEARIGEASKLSKIRIVDKAIANKIPIKPN
A0A660WZA2      SLPAKSLKYARLDRERQVNDKLYMLLKTKYQESRISEASKMSNVRIVDPAIPPEEPVKPN
A0A660X7Q8      SLPAKSLKYARLDRERQVNDKLYMLLKTKYQESRISEASKMSNVRIVDPAIPPEEPVKPN
A0A2H0XTF1      KLPESSLEYARLDRERQVNEKYFILMKTKHQESRITEASKISNIRIVDPAVPPEKPVKPK
A0A2E5XY54      ELPPKQLKFSKMQRDISVLNQSYALLRQKLEEAKINVASQIGRVQIVDYAKEPINSAKDS
A0A2E5U5G7      DLPDKALKLTQLERDRSILSQTYSFMKSKLEEARIGEASKLGKIRILDKAISNSKPIKPN
A0A2E1Q8L9      NLPQKVLEYTRLERIRNIQSETYSFMRQKLEEARINEASKIGKIRVVDSAIPNYIPIKPN
A0A2E2VWX2      XLPEKVLEYTRLERIRNIQSETYSFMXQKLEEARINEASKIGKIRVVDSAIPEYIPXKPN
                 :*        :             :    . : :          .   :         .

A0A101ID17      KKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKAR
A0A124FPG2      KKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKAR
A0A2D9VF15      VRKEMMLCIMLGLIAAFSIALFIEQFNTSIKSLEDLEKYGLNVLAIIPSIKNRKKHKKIR
A0A2D7IJL9      HQKDIIIFCFFGLGIAIVIVFLIEFIDNTIKTIDEIEKYDKSVIGVIPAIGKISSRGIIS
A0A2E3DVU2      HQKDILMFLFFGIAIGLFIIFVIEVLDSSIKTIDEIEKYDKNVIGVIPAIGKMKSQNFIM
A0A2E5VVQ3      HQRDIITFCFFGIGFALVIVFLIEFVDNTIKTIDEIEKYDKSVIGVIPAIGKVSSQGLLN
A0A2E1Q0C7      NNRTLLLGLFLGLSLGIIMALALEVMDNTIKTTYDIERKNLAVLGIIPSIGEEQKNKKSY
A0A2D8V7U8      RKLSLLIGLIFGGILGVVAAFIIEILDGTIKSIEDIEKRGLTILALIPSIGLHDKKRK--
A0A2E1NF27      HTRTILFGLFLGIGISFCLIMLIEVIDNTIKTNYDIENNNLSVLGIIPSIETDESLSSFR
A0A2E6SF50      HKRTILMGLIFGLGLGIFLAFGLEFLDNTIKTPHDIERKSLSVLGIIPSIG-KEIVNKQR
A0A2E0B890      RKFILLISLLFGTIFSVGFILLTEFLDSTIKSIEEIERRGLPILAIIPSIGSQINQRIKK
A0A660XPG7      TNLNILLGFIFGLAAGIGIILLREFMDNSIRSKEDLEGLGLTVLGIIPSMSIDKAKKVLD
A0A2D7NA59      NKVNVLIGLMLGLGVGIGISFLLEYADNTIKSIDEIDKRGLSILALIPSIG-KKINNKRE
A0A2E5VWZ7      HNRNIILGIFLGLSFGVLLVFMIEFLDNSLKTVDEIEKYALTVLGIIPAIG-NTQQNSKK
A0A2E5JPH8      KGRNMLLGLILGMGFGVGIVFLREYLDRTIQSIEWIERFGVSVLGVIPVVTGMGSNQKSK
A0A2E6AXM8      VFENLLLSFTVGIIIGILGLFTIEYFNNSIKTIEDLERYGLNVLAIIPS---IGKKNKST
A0A2E5GDL9      HRKNIIIGFSIGLGISVILSLLIEFLDNTLKTVDDIERHDLTVLGIIPSIGGESSKNSKG
A0A660X6H5      KKLNVLLGGLLGLGLGIGIIFLKETLDNTVKTKEDLVKKGITTLAVIPK---IDEIKAAK
A0A2E5SGC3      KLMNLISGILFAIACSVAIAFLIDYSDQTIKSIELIEKKGIPILSMVPDLTNLNVHGKSR
A0A660XQL6      KKLNLILGLFIGLGLGVGIAFIKEYLDHSVRTDEDLERAGLSAIAVVPT---INVKRAIE
A0A2E1WWX4      KSQNIIFSIILGIVLGIGASMVMEFFDNTIKSIEQIERRGLAILSMIPAI--SSKNNRNK
A0A660WZA2      KRLNLILGLLVGLFLGVGIAFIREYFDRSVKTAEELQSYGLSAVAIVPE---IDVKTALE
A0A660X7Q8      KRLNLILGLLVGLFLGVGIAFVREYFDRSVKTAEELQSYGLSAVAIVPE---IDVKTALE
A0A2H0XTF1      KKMNMLLGLFLGLGLGVGIAFVRDYLDHSIKNAEDLQKLGLATVSIIPK---IDVKSATE
A0A2E5XY54      KRI-IIMGLIFGXGFGVALAFSLEFLDNSIKTVDEINKLNLSVLGIIPSIG-DDNKKALF
A0A2E5U5G7      KIKNIFLGVILGCILGLGIPLLIEFFDNTIRSIEQLERRGLSVLSIIPDIM-ISSNKKNK
A0A2E1Q8L9      KKLYILLSLVLGLALGIFIIGIKEFFDNTIKSVEQIERRGFSLLAVIPS---IGKKSSKK
A0A2E2VWX2      KKLYVLLSLVLGTIXGIAIIGIKEFFDNTIKSIEQIERRGFSXLAVIPS---IGKKTDKR
                    ::    ..   ..      :  : ::..   :       :.::*            

A0A101ID17      SV--------NNTEVSQYQSRLITHFDPKSPVSEAYRSMRTNIELS-GVDKSIKSVVITS
A0A124FPG2      SV--------NNTEVSQYQSRLITHFDPKSPVSEAYRSMRTNIELS-GVDKSIKSVVITS
A0A2D9VF15      KT---------LKEENKIERHLITLEDPKSPISEAYRTLRTSIMYS--DTNTNKTILVSS
A0A2D7IJL9      RY-LESKSFTVLGGEKGIKRKIITRDNPKSPISESYRGLRTNILLT--NTKDIKSILVSS
A0A2E3DVU2      RY-FDDKTVNILGGEKGIKRKIITKDNPKSPISESYRGLRTNILLS--NDKEIKSMLVSS
A0A2E5VVQ3      KY-LENKTFTALGGEKGIKRKIITRDNPKSPISESYRGLRTNILLS--NTKDIKSILVSS
A0A2E1Q0C7      FF------NKSNKSSSNLKRRLITQDDPKSPVSEAYRALRTSMLYT-SADKKIKSILVSS
A0A2D8V7U8      -----NKLKNSIDNAKKIQRRLITYEDPKSPVSESYRTLRTGLLYA-NSKKAGNVILVSS
A0A2E1NF27      FLRFLKK-NSSNNSNRGIKRRLMTREDPRSPISEAYRSLRTSMLYT-GVESEVKSILVSS
A0A2E6SF50      FFSFKSGLLSRSKTSHGLKRRLITREDPRSPVSEAYRSLRTSLLYT-SADKKIKSILISS
A0A2E0B890      KG---YRLNLKISNSEKIERRLLTHEDPKSPISESYRSLRTSLMYD-NNEQDSKIILVSS
A0A660XPG7      KK---------YSSNDDFRNRLISHFKPRSPISESFRSLRTNLELS-VVDKTISALVVTS
A0A2D7NA59      HS---KNLSKKIGNIEKIQRRLITHEDPKSPISEAYRSLRTSLMYSKESLNHAKIILVSS
A0A2E5VWZ7      DFLFWKNKLLTNQNTNTLKRRLITREDPKSPVSEAYRSLRTSMLYS--STNKVKSVLVSS
A0A2E5JPH8      KG---KK--DSASGSKNVQRRLITREDPKSPISESYRTLRTNILYS-QADKKIKSILVSS
A0A2E6AXM8      KG-------------KNIERTLITREDPKSPISEAYRTLRTSIMYSSENKKDAKIVMVSS
A0A2E5GDL9      WSFFGKSILSSKGNSHGLRRRLITKEDPKSPVSESYRSLRTSMLYS-TTNKKIKSILISS
A0A660X6H5      RA---RS--ATNTEISKYQSRLITHFDPKSPVSEAYRSMRTNIELS-SVDKSIKSVVITS
A0A2E5SGC3      KN---IEQLKAYITDNQIERKLIAYEDPKSPVSEAYRSLRTSLLYTSNKDMKGQCVLLSS
A0A660XQL6      KM---EKVGKDINGERSLQSRLVSHFDPKSPVAEAYRTLRTNIQFM-SPDKPLKTLVVSS
A0A2E1WWX4      NS---KRYVKNDGQVEQLQRRLITHEDPKSPISEAYRSLRTSLMYT-KSNSESNVILVSS
A0A660WZA2      RF---QKISRDPESEEPLKARLVTHYDPKSSVAEAYRTLRTNIQFS-SPDKPIKTLVISS
A0A660X7Q8      RF---QKISRDPESEEPLKARLVTHYDPKSSVAEAYRTLRTNIQFS-SPDKPIKTLVISS
A0A2H0XTF1      KS---LKVFKGENLEHSLKSRLVTHYDPKSSVAEAYRTLRTNIQFM-NPDNPIRTLVVSS
A0A2E5XY54      NF---RKKFGNSNSSKGLKRRLMTREDPKSPVSEAYRGLRTSMLYS-STKSEPKSILVSS
A0A2E5U5G7      NN---KKYLNRNMDVLKLQRRLITHEDPKSPVSEAYRSLRTSLMYT-ESESNCQILLVSS
A0A2E1Q8L9      RT---KQYISQNKNLDKIERRLITHEDPKSPISEAYRGLRTSLMYT-NVDENCRVILVSS
A0A2E2VWX2      KT---KRYISQNKNLEKIERRLITHEDPKSPISEAYRGLRTSLMYT-KVNDNCRVILVSS
                                     :::  .*.*.::*::* :**.:            ::::*

A0A101ID17      AGPGEGKSTTIANLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGT-NTI
A0A124FPG2      AGPGEGKSTTISNLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGT-NTI
A0A2D9VF15      PGPGEGKTTTVANLALTYANLGKKTLLIDTDLRKPVINKVFSVEKNPGLTNYLIND-EKF
A0A2D7IJL9      AGPGEGKTTTVANLAITFANLGRKTLLVDTDLRRPVIHSVFNVKREPGVTNYLSGQTDDY
A0A2E3DVU2      AGPGEGKTTTVANLAITFANLGKKTLLVDTDLRRPVIHSVFELKRDPGVTTFLSGQTDDY
A0A2E5VVQ3      AGPGEGKTTTVANLAITFANLGRKTLLVDTDLRRPVIHSVFNVKREPGVTNYLSGQTDDY
A0A2E1Q0C7      AGPGEGKTTTVANLAITYANLGKKTLLIDTDLRRPVVHKVIGINKEPGITDYLSNNEKDI
A0A2D8V7U8      PGPGEGKTTTIVNLAITYANLGKKCVIIDTDLRKPVAHTIFDVKREPGITRFISGVDDKI
A0A2E1NF27      AGPGEGKTTTVANMAITYANLGRKTLLIDTDLRRPVVHKIFDLEXEPGITNFLSGNTSDF
A0A2E6SF50      AGPGEGKTTTVANLAITYANLGKKTILIDTDLRRPVVHKVLDLNKEPGITDYLSGAKDDF
A0A2E0B890      PGPGEGKTTTVANLAITYANMGKKTLLIDADLRKPVLHKMFKNKENKGLTNFLSQSENNI
A0A660XPG7      AGAAEGKSTVISNLAIAYAQFGMKVLLVDGDMRKPTIHKMFSTPKKPGLANMITKR-SKM
A0A2D7NA59      PGPGEGKTTTIMNLAITFANLGKKTLLVDCDLRKPVTHKIFNVEKDIGITNFLVGNISNV
A0A2E5VWZ7      AGPGEGKTTTVANLAITYANLGKKTLLVDTDLRRPVVHKVFNLEREPGVTNFLSGQAKNI
A0A2E5JPH8      PSPGEGKTTTISNLSITFANMGKKTLLLDTDLRRPVIHRVFGIKKEPGISHYLAGNIENF
A0A2E6AXM8      PGPGEGKTTTVANLAITYANLGKKTLLIDADLRKPVVDKVFDLKKVQGLTKYIVEN-INI
A0A2E5GDL9      AGPGEGKTTTVANLAITYANLGKRTILVDTDLRRPVVHKVFELXXEPGITTYLSGXTNNY
A0A660X6H5      AGPGEGKSTTIANLAIAFAQLDQKTLLVDTDMRRPVLQKVFQVPRVPGISDIITGS-NTL
A0A2E5SGC3      CGPGEGKTTTVANLAVTYSTLGKKVLLIDSDLRKPVNHKVFKVSRSPGFSSYLSGQKNDI
A0A660XQL6      AGPKDGKSTTVANLAITFASLGKKTLLLDADLRKPILHKVFDVPRSPGLVHGVIEE-IDF
A0A2E1WWX4      PGPGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVIHNVFKADKSPGLTSFLSGN-SDL
A0A660WZA2      AGPGEGKSTTVANLAITFANLGKKTVLIDADLRKPILHKVFDMQRDPGLTHAIIGS-HAI
A0A660X7Q8      AGPGEGKSTTVANLAITFANLGKKTVLIDADLRKPILHKVFDMQRDPGLTHAIIGS-HAI
A0A2H0XTF1      AGPGDGKSTTVVNIAITFASLGKKTLLIDSDLRKPILHKVFDISRGPGLTHAMIEDLND-
A0A2E5XY54      AGPGEGKTTTVANLAITYANLGKRTLLVDTDXRRPVVHKVFDLKRXPGVTAFLSGSIDNY
A0A2E5U5G7      AGPGEGKTTSIANLAITYANLGKKTLLIDSDLRKPVIHNVFKLDKTPGLTSFLSKN-SSY
A0A2E1Q8L9      AGPGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVVHNIFKFDKSPGLTSYLSGNESDE
A0A2E2VWX2      AGPGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVIHNIFKFDKSPGLTSYLSGNESDE
                 .. :**:* : *:::::: :. . :::* * *.*    ::      *.   :       

A0A101ID17      EECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDA
A0A124FPG2      EECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDA
A0A2D9VF15      EVVIKETDIENLHIIPSGIVPPNPSELLDSDSMKTMIDNLKEQYDIILFDTPPIVAVTDA
A0A2D7IJL9      HSLVKPSEIENLSLLTSGLIPPNPSEMLGSKKMSQFIKKLESDWDMILFDSPPLVAVTDA
A0A2E3DVU2      KTLLQAGEVDNLFIMTSGIIPPNPSELLGSKRMIHLVRELEDDFDMVLFDSPPLVAVTDA
A0A2E5VVQ3      NSLIKDSGIENLYLMTSGLIPPNPSEMLGSKKMSQFVKLLESDWDMILFDSPPLVAVTDA
A0A2E1Q0C7      SKIIQKTEIKDLCVIPSGIIPPNPSELLGSDRMSNLLRDLEDEWDMILFDSPPLVAVTDA
A0A2D8V7U8      DDLIHKTEIENLSLITCGVVPPNPSEVLASERMKNLVNHLKKKFDVIFFDAPPLLAVTDA
A0A2E1NF27      NQLVKNTDIDNLKVVTSGIIPPNPSELXGSKKMGDLIKNLEKDWDIILFDSPPLVAVTDA
A0A2E6SF50      NSLVQSTSIENLYVVPSGIIPPNPSELLGSKRMSDLLKRLEKDWDMILLDSPPLVAVTDA
A0A2E0B890      DNILIDSGVENLSIITSGIVPPNPSELLSSPAMIDFIKKAKENFDVILFDTPPLIAVTDA
A0A660XPG7      DESIFKTEIDNLYVMPAGSLPPNPSELLGSKAMKELFTQLRKQFDKIFFDAPPLMAVTDA
A0A2D7NA59      DKIINPTEIENLSIITSGIIPPNPSEILASENMEILIKKIKMDYDVILIDSPPLLAVTDT
A0A2E5VWZ7      ENLVQETDIDNLSIITSGIIPPNPSEMLGSEKMISFVKTLEEGWDMVLFDSPPLVAVTDA
A0A2E5JPH8      DSLIQKTDVENLYVVSAGITPPNPSELMGSKKMAELVDKLEREWDMVLLDSPPIVAVTDA
A0A2E6AXM8      KSIIQNSSIDNLDIVTSGVIPPNPSELLDSNKMRDLFDNIKLDYDIILIDTPPIIAVTDA
A0A2E5GDL9      KNLIKXSQIPNLXIITAGIIPPNPSELXGSERMXKLVKXLENDWDMVLFDSPPLVAVTDA
A0A660X6H5      EECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQNLIGHYDKVFLDAPPIIAVTDA
A0A2E5SGC3      EEIINKTYVDNLDILSAGITPPNPSELLESDTLGELMHTLKQKYDIILIDTPPLIAVADA
A0A660XQL6      SDIIQKTEVPNLHLITCGEVPPNPSELLASQKLKNLLEKMKNEFDIILIDSPPIIAVTDA
A0A2E1WWX4      KSILNKTDIDNLEIITSGVIPPNPSELLDSNKMIDFIKKVKNQFDVILFDSPPLVAVTDA
A0A660WZA2      DDVVKKTEIDNLSIITCGEIPPNPSELLASYKLSSILGELREKYDVVLFDSPPVIAVTDA
A0A660X7Q8      DDVVKKTEIDNLSIITCGEIPPNPSELLASYKLSSILGELREKYDVVLFDSPPVIAVTDA
A0A2H0XTF1      SDIIRATEIPNLYIITCGDIPPNPSEILSSQKLKNFIERMKSEFEIVLFDSPPIIAVTDA
A0A2E5XY54      KKLVQSSGVENLSLITAGIIPPNPSELLGSDRMARLVKTLENDWDIVLFDSPPLIAVTDA
A0A2E5U5G7      SDILNKTDIKNLDVITSGIIPPNPSELLASNSMQKFIAMIREEYDVVLFDSPPLIAVTDP
A0A2E1Q8L9      LKLVNSTETKNLDVITSGVIPPNPSELLDSPKLKKLLEKLKSKYEVILFDTPPLIAVTDA
A0A2E2VWX2      KKLINSTDTKNLDIITSGVIPPNPSELLESSKLEELLLKLKNKYEVILFDTPPLIAVTDA
                   :      :* ::..*  ******:  *  :  :       :: :::*:**::**:*.

A0A101ID17      SLLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGG--SYYY
A0A124FPG2      SLLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGG--SYYY
A0A2D9VF15      LILSKHIDKFILVCRPGVTQKGALERVLKNLDQVNSKINGCVFNAIGDL-DSYG--SAYY
A0A2D7IJL9      TMISKEIDSIILVIKAGQTDKKAFHHTMANLKNIEAPLDGIVMNAVTSK-SNYG--SYYY
A0A2E3DVU2      NMISREIDRILLVIKAGQTDKKAFHHTMMNLKNINAPLEGIVMNAVTSK-SNYG--SYYY
A0A2E5VVQ3      TMISKEIDSIVLVIKAGQTDKKAFHHTMANLKNIDAPLDGIVMNAVTSK-SNYG--SYYY
A0A2E1Q0C7      AMVSKEIDQIVMVVKVGQTDKKAFDHTISSLRNVGAPISGVVLNAVTHK-NSYG--AYYY
A0A2D8V7U8      FISLSYTDQFILVVRSSHTQKGGLDRAIELLNQSNAPLSGVVINDIDSS-NSYG--GGYY
A0A2E1NF27      TMVSKAIDKIIIVVKVGYTDKKAFXHTVRSLRNVNAPIGGVVLNAVTKK-SSYG--SYYY
A0A2E6SF50      TMVSKEIDQIVMVVKVGQTDKKAFDHTITSLRNVDAPLGGIILNAVTHK-NSYG--SYYY
A0A2E0B890      FVITKFVDKFLLVVRASVTQKGALERSLVNMSNMGNSISGVIFNGVDES-NTYG--GGYY
A0A660XPG7      ALLGSMTDGVLLVVRAGEAQKEVVVHLQQEMKNTKITIAGTVLNDVNPKNTSSG--YYYY
A0A2D7NA59      FILSKFASQFILVVRAGKTEKGGLDRSLDQMNQVNVNLFGIVMNDVDES-NSYG--KGYY
A0A2E5VWZ7      NMISREIDRIVLVVKVGQTDKKAFHHTINNLKNIDAPLGGIIMNAVTNK-SSYG--SYYY
A0A2E5JPH8      SMVSQEIDAMVMVVKAAETDRDAFRRAVKSLMGISVPLAGVVVNGISRRTSKDT--YYYY
A0A2E6AXM8      LIISKYVDNFILVCRSGQTQKGALDRSIKSLKLVGGKFDGAILNAISEG-NNYG--SSYY
A0A2E5GDL9      NMISXEIDQILLVVKVGQTDKKAFHHTVSNLRNXKSPLGGIIMNAVTHK-SSYG--SXYY
A0A660X6H5      SLLAKLCDGMVIVVKSGVTHNEALDQVQNIVQQIKLPMLGAVINAITPKHMKSG--SYYY
A0A2E5SGC3      YILMKYIDKFVLIVRAGVTEKGAFERVCSELQYGNFPITGVVMNAMTEEHHSYG--AGYY
A0A660XQL6      SILSKVADGLLLVVRAGGTDTRALQRAVELLSRVKCNVIGAALNGVNVS-AGYGYDSYYY
A0A2E1WWX4      FVLMKYIDQFILVVRPGKTERGALERVIASTQQSNMNITGVVMNAMSEE-HSYG--SGYY
A0A660WZA2      TILSTVTDGILLVVRANKTDTRALQRAVELLSHVKCNVLGAVLNGVSVS-GGYG--SYYY
A0A660X7Q8      TILSTVTDGILLVVRANKTDARALQRAVELLSHVKCNVLGAVLNGVSVS-GGYG--SYYY
A0A2H0XTF1      SVISKMTDAILLVVKAGVTDTRVVARAIELLRQVKTHLIGAVLNGVNIT-GGYD--SYYY
A0A2E5XY54      TMISQEIDQIVLVIKVGQTDKKAFHHTVSNLRNINAPLSGIIMNAVTGK-SSYG--SYYY
A0A2E5U5G7      YVLMKYVDQFVLVVRSGVTQRGALQRVLEVVGQTDFDITGVIMNAVSES-DAYG--SGYY
A0A2E1Q8L9      FVLMKHSSQFILVVRAGVTERLALDRVMTNLYQSGFKETGVVLNALEES-HAYG--AGYY
A0A2E2VWX2      FVLMKHSSQFILVVRAGVTERLALDRVMTNVHQSGFKETGVVLNALEES-HAYG--AGYY
                 :     . .::: .   :    . .             *  .* :            **

A0A101ID17      Y--YRYMNYQYK-----------------------
A0A124FPG2      Y--YRYMNYQYK-----------------------
A0A2D9VF15      Y--NYYQYYYNSDN---------------------
A0A2D7IJL9      YYYHQYYHYYSSHDNESDA----------------
A0A2E3DVU2      YYYHQYYHYYSSSEDDEK-----------------
A0A2E5VVQ3      YYYHQYYHYYSSHDDTSEA----------------
A0A2E1Q0C7      Y--YQYYHYYGNEKETEKV----------------
A0A2D8V7U8      Y--NYYQYYYGSEK---------------------
A0A2E1NF27      Y--YQYYHYYGSDK---------------------
A0A2E6SF50      Y--YQYYHYYRSDTETQSA----------------
A0A2E0B890      Y--NYYQYYYGSDEK--------------------
A0A660XPG7      YQRYYFDKYYGENTK--------------------
A0A2D7NA59      Y--NYYQYYYGDS----------------------
A0A2E5VWZ7      Y--YYHQYYQYYGSEKDSD----------------
A0A2E5JPH8      Y--QYYQHYYGGYYGYYGKDKEKELEGETA-----
A0A2E6AXM8      Y--NYYQYYYNEESN--------------------
A0A2E5GDL9      Y--YYYQYYXYYGXDKES-----------------
A0A660X6H5      -----------------------------------
A0A2E5SGC3      Y--NYSNYYYSDNDS--------------------
A0A660XQL6      Y--YHYHYYYGDEGKRKKRVRRKKA----------
A0A2E1WWX4      Y--NYYQYYYGDKT---------------------
A0A660WZA2      Y--YHYYYYYGDGHRKKKRAKRKKRKTKSY-----
A0A660X7Q8      Y--YHYYYYYGDGHRKKKRAKRKKRETRAY-----
A0A2H0XTF1      Y--YNYYYYYGDGGKKKKKSRFRKNRSASPAEPER
A0A2E5XY54      Y--YYYQYYHYYGSEKNDNKA--------------
A0A2E5U5G7      Y--NYYQYYYGESDK--------------------
A0A2E1Q8L9      Y--NYYQYYYAENSD--------------------
A0A2E2VWX2      Y--NYYQYYYAENSE--------------------
                                                   

© 1998-2020Legal notice