BYKdb

Dataset for cluster tadcd of phylum candidatus-hydrothermae

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A496U6A5 [Bacteria] Bacterial tyrosine kinase [Candidatus Hydrothermae][Candidatus Hydrothermae bacterium] (length=811 residues).
MEEELKFEDIINVLRSRKKIIIMSIIFVTLLSIIYSFLKSPVYEAKARVRLPGSSQVTEFFLAGMTNPWNDVPTQLEIIK
SINVAKRVINKLGLRFRVLDKKMPPGLTIDSVYVKEDMPSGDFILEVYRNYYLVKNLPEGKIYIKGPIKTYHEEKGLGLK
VLLDKKQKITFPLKVRFEILDYHTLIKSLSSRMKVSQEARSFIAVIRTRARSPELAKKLADTYANAYVEYTLDDVRYSAR
VLREFLQQQVNKIETQLKIQEDSLKLVKEKFGVFAALALENSQESTKELLRTLTTLEMEKSQSIAEREEAKKKIEILKNQ
IEGKGFLAKYRELAELPGLSNNPQVQELQNKIITLEIKKAELMEKYTEKHPEIQAIENQIEATRKNLQSILKSLAFSGPS
AGDPLFQKLATDFITNEALALALEAKVSALDKVIRAYEKKISFLPTQELTYARLKRKIEATKTVYNMLLQKLEETRIQEA
SQISDARVLDYALLPKSPISPKKKLNIVLGLILGTMLGIFGAFIAEYLDNTVKSAKEVEEITFKPVLSIIPLIQLENDNN
STSRIEKTFITHFDPLNPISEAFKKLQINIRFLDPERKLRIFSITSSIKGEGKSTVACNIAIAFANAGEKVLLIDGDIRR
ATLHDIFNVPREPGFSDLLVGHQAKAFETQIKNLYLLPAGTRILPSLDLFNPVNVDKLKERINHHYNVVIVDTPPILPVA
EALSISSLSDATILVVRSEYTDKNILQDVAQQLKRSNVNFLGTVLNAFNFENYGYYARRYYYEYYGRSGVAKRTIFNKII
NQIKKLKKNGA
>gnl|bykdb|A0A660ZFU7 [Bacteria] Bacterial tyrosine kinase [Candidatus Hydrothermae][Candidatus Hydrothermae bacterium] (length=803 residues).
MNSEEKGREVSLYDYINLIYRHRVLIIVVFVITTLGAWIFSLLSPPVYKASSVVKLALKETRLNVIPEISPALRTVDPVQ
SQIEIIKSRALLENLVMKHGLNISFLTPVDAFEFDTLWTTRKAKEGIYTVKFKGEYFQVFAPDGSVIGNGRLGEPFNGGV
LGFLIRAKRKDYPLVIKFIVTAPDRVALSLKGIFKVTQKGQTDLAVISAQGSSPDFVKKMADALADEYVAFTLYGMQEEA
KALRSFLEEQLNKVEKELKLAEDSLRAFKEKAGIFLLDESARTLIERLSALQSELAKAETEKQEAEHKLASLRAQLGEKT
ATFEKYKQTASSPEVSSNPLVRSLKEKLTSLEIQKAMLLEKYTELHPEVVAVNREIAKTKEELNRAVANALKSGPSAGDP
IFQNLIAGIIESETKIQSTEGRINALKQLIKKYEAQMKLLPQKEVQLAELTRNVEANRAVYSMLINKLEETKIAEAQKST
DAKVIEYATRPIAPIKPRKKMNVLLGAILGLVLGVGGAFVLEYVDVNVKTPEEVEELLGVQVLGNIPYIKSAEDAEPRVR
LITNLDPKSVTVEAYRSLKVNLKFASTGEPIRTFMVSSAKAEEGKTLTAVNLAITSVQAGERVILVDADMRNPSVHRFLE
MTKSPGFTDVLKGEETLDDAIKHPEFLRDLAVLTCGSDVVNTLEVINSESFGRLLNELVNRYDTVIFDSAPILLVSDTLA
MADRVKNLLLVVRAGYTERPALVAALRALKRANVNLVGAVVNAIHLQKHYGYYYPYKYYGYEEREKRKGKKSRSWWRYFT
KRG
>gnl|bykdb|A0A660ZJ93 [Bacteria] Bacterial tyrosine kinase [Candidatus Hydrothermae][Candidatus Hydrothermae bacterium] (length=825 residues).
MADPTREEEISLMDIMGVLFRYRYVIIGLTIGIAALAWLYSALTRPVYEAKSLVRLSISAPPITTLGPEMGYGTTIDPVQ
SQIEIIKSRTLAERVVKRMGLNIVFPKGIIVDTAWSTDLVKTGIYYLKLKQDSSFEVFDKDDNYLGPGKLGKIFRSQRAG
FGFSVRCKDGECEKFIGRRIPFRVKSIISTAEGFRGKIKASQKGQTDLAVIKVRAYSPQKAAQLANAVAEEYVNFVIYDL
QQEARSVRNFIESQLEKVERRLREAEDSLKAFKEKTGIFILDESAKSLISRLSELQAELTKAQTDRVGAFERLKKLRQQL
KQRGEEQYQALASTPEISGNPIVQSLRDKLTQLEIRKAKLLEEYTEAHPDVQALEREIQKTREELNKAIENMLKSGLPTG
DPIIRRIMQDIVENEATINALDGKIQALQTVINIYEGKLQSLPEAEVKLAELTREVEANRATYEMLISKLQDVKITEART
VSDAKVIDPAVLPKKPIKPKTKLNIILGFILGLMLGVGGAFVLEYLDTSVKVPEEVETALNIPVLGTIPMVMRGKPKSKD
EAQLIKERLITHFHPSHPVSEAFKTLRTNLRFSSISNPANSIVITSAVAREGKSTVTANLGITLAQLGHKTLLVDADLRK
PILHRLFGFNRIPGLTDVLIGNTQLESVIKDLHRVIPNLALITCGQIPPNPSELLGSPQMEEFIKYVKTQFDYVLFDTPP
IMPATDATELGARVDGIILVVRAGNTERAILEHAKKLLERANVNIIGAVLNAVDIERQFYYYKYRYKHYYYYYSYTHKDK
FKEFEERRKSKLSRFFGRIFRRRAA
© 1998-2020Legal notice