BYKdb

Dataset for cluster tadcd of phylum candidatus-latescibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5ZEN4      ----------MHDEKKDFRVYVDVVYRKKWLILFIFLIVFLAALYFVRKQAPSYSSSSSI
A0A3D4BE10      -MKTRTGDKSLQGTEIRLQDYIGVVYRKKWILMLSFVLVLGIALYDAFTTPPVYISSATV
A0A1V4R2W1      ---------MEEEKQVGLEDYIDIVWRRKWIILLSFVSVLASTTYFTFTRPPTYEAASIL
A0A0S7XD06      -----MFSRDSERKEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTI
A0A1V4RNF1      MQEV-------SEQEVSIHDYLRILYKGRWIIVISFLAVVISTVFFTLRATPIYEAKTTI
A0A496STL3      MQEV-------SEQEVSIHDYLRILYKGRWIIVISFLAVVISTVFFTLRATPIYEAKTTI
A0A7C7Q8T2      MQEPMVFAGTEGETQVSLRDYIRVLYRGRWVILLSFLAVVGATAYFTFRATPIYEATATI
                              :  :  *. :::. . ::   *. ..  :          * : : :

A0A1V5ZEN4      YIESGNPAAMAVALTADAQ-------GKRPIEFFMGILESRSFRDAVRDAVRDHAISRGM
A0A3D4BE10      KIDTRT--------LSTRGDGAMVRAVAQSVDYYDRIFRTGIFRNELLDSLS----ADEA
A0A1V4R2W1      MVEAEEG----MNLLDPRGSLFGPLAKPVEFFER--IMESPSYRDQVALKVTERLRNPHG
A0A0S7XD06      MVEVGGRAGGIESLFGVRSAMQSSVVNEVILNNQVEILRSRTLAERTISKLRNLPVSDRL
A0A1V4RNF1      LIETGKT-GAAIPLFEAPGFTR----RETMINNQVQILKSRTIAELVLNELRKLSGSQTF
A0A496STL3      LIETGKT-GAAIPLFEAPGFTR----RETMINNQVQILKSRTIAELVLNELRKLSGSQTF
A0A7C7Q8T2      MIDTERSPNVGLDFLAPLGMGT----RETIINNQVEVLKSRTLAQAVLEELRRQGYDRTF
                 ::                           .     :: :    :     :         

A0A1V5ZEN4      PPIQ------------------ATDLSREAIESLQIKRSKNEGFYTVIAESESPDIAYAT
A0A3D4BE10      SIIAQNHNLSLE---------------NLIEFNLSLNADAVQSFFRITASASNPDLAYRL
A0A1V4R2W1      ILLP------------------MDEALDLVEHNLTLNTSKTSDFLEIKAHADSPLLCYLL
A0A0S7XD06      ELFASEDGKASM-----------ASLIERLSPAVEISPIQNTNIIVVKARAGKPYEASLI
A0A1V4RNF1      AIFKTDLGRPWS----------REDALKTLEESIKVTPIRDTDIVEIKCQAPSPEEAVAI
A0A496STL3      AIFKTDLGRPWS----------REDALKTLEESIKVTPIRDTDIVEIKCQAPSPEEAVAI
A0A7C7Q8T2      YLFSDGKGR-WSLRAKEVENPGDEVLIKRLQDRIKISPRRQTDFIDIKVQAPDPKEAMIL
                  :                              : :.     .:  :   : .*  .   

A0A1V5ZEN4      DSLAVSLFMERCILYARQQTNAMTAFVAMQFDSARARLERAEDNLQAFRKQHNLIQAGGG
A0A3D4BE10      ADVSSHLFQKRLIDIESESMVESDVYLDEQITLLRNKLETKEIEIQKFTREQHIIPGKPG
A0A1V4R2W1      AASGTEVLKDRSRGVDKEEAQSVLDFIEDQKIEAQQKLEAAEKKLQLFRERVGIVGNGEE
A0A0S7XD06      ANTIVETYLELNLSWARGEVTEIKSFVEEQLTLVRERLSSAEDKLKRFQESEKVASLSHE
A0A1V4RNF1      ANTFAHVYYQQRLQMSREEISETRRFIEDQLAKVREELRASEEALRDFKQKEKVVALPDE
A0A496STL3      ANTFAHVYYQQRLQMSREEISETRRFIEDQLAKVREELRASEEALRDFKQKEKVVALPDE
A0A7C7Q8T2      ANTIAEVYHRWSLEHSREEVRKVKEFLEEQLRKKEKDLVASELALKQYQEEHGVAELSAE
                                  .      ::  *       *   *  :. :     :      

A0A1V5ZEN4      PAT--------------------------DPSLPIDYV---------------------R
A0A3D4BE10      SVGNTGFMAFQIKLDEIEVQRELTAIKLRIYRQRQDEISRRQYTYNNVDLLVDQIDQEIR
A0A1V4R2W1      GGALGKLIELEKELAGVQAQKELAQANLEAYDLRIAQV-LPDKTAGGRE-----------
A0A0S7XD06      TEA------AVKKLAEFDALKGQAEVDLESTQRRLTFL-ETQLSDQRKSLVDDIGRVSAP
A0A1V4RNF1      TKA------LVEQLADFEALYNEAETDLGSSQTRLNYL-RKQLREQQKDLPEKIAMVSSP
A0A496STL3      TKA------LVEQLADFEALYNEAETDLGSSQTRLNYL-RKQLREQQKDLPEKIAMVSSP
A0A7C7Q8T2      TEQ------LVEQLAGFEALYNEAKTKLGEARTRLRYL-RSQYADQLRSLDEDMLHVTSP
                                                     :                      

A0A1V5ZEN4      LVEGYYDA----------------RQERQTAQAALEAAEEASRLLRINLDTLATDKLRRA
A0A3D4BE10      SIGAKADSLESLQAT----LRNSLDQTHPDVIKINKQIRDIQFEENEVYARIYQ--ISSP
A0A1V4R2W1      -TEGLSREIATLESIRANLVRQP-GEHHVEVLSLDKKIAEKKKKLVESI--VQDTDVRSS
A0A0S7XD06      MVTQLRGTLANLEGIRTRYLAQGYPENHEKMKEIERRIEETKGQLVTKTKSALSEEVSLQ
A0A1V4RNF1      LIQNFRGEIAKLEGKYANYIAQGISEDNEKVVAIKNRIQEIKNKLKEETRKLLSEKLAPE
A0A496STL3      LIQNFRGEIAKLEGKYANYIAQGISEDNEKVVAIKNRIQEIKNKLKEETRKLLSEKLAPE
A0A7C7Q8T2      LLEELRDKLAELEATYARLISQNYRDDHPILANLRGQIGHIKEKMRQEIRALVQKGLSVS
                                         : .             .              :   

A0A1V5ZEN4      LPALDLAEAEERTRKARTELQLKELQEQSFLAQLQAYEASHP-GLSDVSIGYLRLVRERD
A0A3D4BE10      QKRNLLPILKAKIDAAEEAMFELTTEAEYYDIKIQEFTPDSNTAFFNNELHLRRLMRSQE
A0A1V4R2W1      GMQVEIAQLQERRTAEELNIYVLESQERYYENLIEKFKAEHP-SMLENAIELAQLTRARK
A0A0S7XD06      DPFSYSQELIERILDLEVEVRTLRARVEGFDQLVSQYAVELE-RLPGKALALARLERERE
A0A1V4RNF1      NPLLFSQALVDKILTLEVEVEASSAKASALKRIVDQYAEKLQ-ALPEKSLELARLERTAQ
A0A496STL3      NPLLFSQALVDKILTLEVEVEASSAKASALKRIVDQYAEKLQ-ALPEKSLELARLERTAQ
A0A7C7Q8T2      DPMGYSQALLERIYGLMVEVEADSSRARALGEVVRQYEERLK-QVPEKSLQLARLKRAFE
                           .       :             :  :       .    :   .* *  .

A0A1V5ZEN4      IYVRLSDLLLERREELRVKSASETGGVRVVDAPSEPT-PKPSRAPLILIFAAIIGLSLGA
A0A3D4BE10      LYETNYNVLIQLNEESQLKKATQSGGVKMIDPAYRPKAPVPSTASRKILFGAILGMSLGL
A0A1V4R2W1      VYENMYNILLEKGEEAKINASTGTGGVKVVEKAREPDEPVPAHSKRNLVLGAMVGLGLGL
A0A0S7XD06      VNEQILLMLMDRYEEARIKEAGQLGNASVVDRAEEPREPILPRKRRNVLLGSVAGLLLGL
A0A1V4RNF1      VNEKIYIMLMEKSQEARITEAGQIGNVRIIDEAREPKYPIKPKKKLNVILGAVVGLGLGV
A0A496STL3      VNEKIYIMLMEKSQEARITEAGQIGNVRIIDEAREPKYPIKPKKKLNVILGAVVGLGLGV
A0A7C7Q8T2      VNEKIYIMMKERLEETKITEAGRIGNVFLVDPAREPLYPVKPKKKLNLLLAAIIGLGMGL
                :      :: :  :* .:. :   *.. ::: .  *  *  .     :::.:: *: :* 

A0A1V5ZEN4      GAAFLLEAMDTSVRTVNDITEAL-EVPTIGTIP----------SIGVTPGGKRRRETERR
A0A3D4BE10      GAVFLLEYMDTSLKSSDEISRFL-QIPLLGEIPKIDADKPTRKWLRFLPGTIK---SNEE
A0A1V4R2W1      GIAFALEYMDNTIRTAEDLSRTL-GLSVMGTIP----DIQKLENMQRKRSGKKKRKGGGE
A0A0S7XD06      LCVFSLERLRDRIADVSDVETATDGIPVLAAIPSATTKRRGFRLLRTRRRVFPFQGSSGE
A0A1V4RNF1      GIAFFLEYIDTSIRTPDEVERFT-NLALLGTIP----------LIKGRDNDKKTRHTEAS
A0A496STL3      GIAFFLEYIDTSIRTPDEVERFT-NLALLGTIP----------LIKGRDNDKKTRHTEAS
A0A7C7Q8T2      GVAFLMEYLDTSIHTVEEIEK-Q-GFSVLAWVP----------RIQ-----VAGRGGEYF
                  .* :* :   :   .::      .. :. :*           :               

A0A1V5ZEN4      RV---LISDGNPKDPIAEAYRTLRTSLLFS-SGDQPIRSVVVSSAGQAEGKSITVANLAI
A0A3D4BE10      AYDSRIIAHFDPKDPIVESYRNVRTSLLFTFTSGDPLQAFVISSPNPSEGKSLTTSNLAT
A0A1V4R2W1      RDDPGLISRYETKDMVVESYRSLRTNLQFA-SVDKPLKSMLISSPGPMEGKTLTVANLGI
A0A0S7XD06      AVPKVLLTELSPRSEISESYRTLRTNILFS-QVDKPLRTIVLTSPGPTEGKSTVVANLGF
A0A1V4RNF1      LISSRLISHLAPKSPASEAYRTLRTNIQFT-KLDRPLQSLLVTSATPGEGKTTTVANLAI
A0A496STL3      LISSRLISHLAPKSPASEAYRTLRTNIQFT-KLDRPLQSLLVTSATPGEGKTTTVANLAI
A0A7C7Q8T2      MMSERLTSHLEPRSPVSESYRTLRTNLQYA-RASQALRSLVITSPSPKEGKSTTVANLAI
                     : :   ...   *:**.:**.: ::   . .:.:.:::*.   ***: ..:**. 

A0A1V5ZEN4      VCAQMGQRTVILDADLRRPVQHILFELEREEGLTEALVHRRELSEVAKPTSIENLDVVTC
A0A3D4BE10      VFAQSGKKTLIIDTDLRRPVIHKIFRLPKNPGITDVLVGQIHWNEAIRQTDIDNLFVLPS
A0A1V4R2W1      SFAEMDKRTIIVDADLRRPRQHKLFGVGKEPGLTDYLVGTASLEDVILPTEVDHLSLIPA
A0A0S7XD06      VMAQAKNKTVVIDSDLRRPTVSLLLGTPKGAGLTDVLSGKAVLDDVITSTSVDGLFLVGT
A0A1V4RNF1      TMAQMGTKVLLVDTDLRKPMLHQIFGVERDVGLTNVLVGERGLSSVIKPTDIEGLSLISC
A0A496STL3      TMAQMGTKVLLVDTDLRKPMLHQIFGVERDVGLTNVLVGERGLSSVIKPTDIEGLSLISC
A0A7C7Q8T2      VMAQAGMQVLLVDSDLRRPVLHHLFGQDKEPGLTEVVLGRASPEEVLRSTEVEGLTLLPC
                  *:   ..:::*:***.*    ::   .  *:*: :      ...   *.:: * ::  

A0A1V5ZEN4      GVIPPNPATLLGSAAMGERLEELAQHYDIVLIDTPPVIVVTDAVLVARKTDGVLLVVRCN
A0A3D4BE10      GTSPPNPGEMVGSERMTEILDILKEHMDIIILDTPPVVAAIDAAVLGAKTQGIILVLNME
A0A1V4R2W1      GRGSPNTAEMLGSNRMSDLIRKLISEHDIVLFDSPPLVPVTDAALLASKMDGVLLVTKYA
A0A0S7XD06      GTLPPNPSEMLGSLRMRQVIAELAAKFEFVLFDSPPVLPISDAAALGARVDGVLMVARCG
A0A1V4RNF1      GPIPPNPSELLGSEKMGQLIEQARREFNFILFDSPPTVAVTDAAVLATLTDGALLVVQSA
A0A496STL3      GPIPPNPSELLGSEKMGQLIEQARREFNFILFDSPPTVAVTDAAVLATLTDGALLVVQSA
A0A7C7Q8T2      GTIPPNPAELLGSEGMHELVRQMGRRYDFVLLDAPPIIVVTDALLLSKEVDGTLLVVRAG
                *  .**.. ::**  * : :       :::::*:** :   **  :.   :* ::* .  

A0A1V5ZEN4      STPREAARHTADTLRTANIPLIGAVLNDVDVTRRYGGYHYYNYYYHYYYGGYYGSSDGSG
A0A3D4BE10      ETKRDSAKFSIDQIERAGGKVLGGLLNNVDVNRRYG-----YYYNQYYY-----------
A0A1V4R2W1      STHKDAVHHALEILEKVGAPTIGAILNDVEVVRRLG--YYRYYYNNYYY--YTYHEDEKK
A0A0S7XD06      VTGVAGLSRAISVMRGVHARVIGIILNDLDIRQRLGEGYYDYYRSYSHA--QGADEPS--
A0A1V4RNF1      KVSREAVNRAKSVLEGVGARVLGAVLNDFDVESQYG--YYSHYYYYYYY--NYPESGEKK
A0A496STL3      KVSREAVNRAKSVLEGVGARVLGAVLNDFDVESQYG--YYSHYYYYYYY--NYPESGEKK
A0A7C7Q8T2      QTDRNALLRARSLLDQVGVQAVGVVLNDIDVTGGYGKYYYPYYYYYYYY-----------
                 .   .   : . :  .    :* :**:.::    *      *    :            

A0A1V5ZEN4      DTKTAKT
A0A3D4BE10      -------
A0A1V4R2W1      EETKA--
A0A0S7XD06      -------
A0A1V4RNF1      RRRKARA
A0A496STL3      RRRKARA
A0A7C7Q8T2      -------
                       

© 1998-2021Legal notice