BYKdb

Dataset for cluster tadcd of phylum candidatus-latescibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5ZEN4      ---------MHDEKKDFRVYVDVVYRKKWLILFIFLIVFLAALYFVRKQAPSYSSSSSIY
A0A3D4BE10      MKTRTGDKSLQGTEIRLQDYIGVVYRKKWILMLSFVLVLGIALYDAFTTPPVYISSATVK
A0A1V4R2W1      --------MEEEKQVGLEDYIDIVWRRKWIILLSFVSVLASTTYFTFTRPPTYEAASILM
A0A1V4RNF1      ------MQEVSEQEVSIHDYLRILYKGRWIIVISFLAVVISTVFFTLRATPIYEAKTTIL
A0A496STL3      ------MQEVSEQEVSIHDYLRILYKGRWIIVISFLAVVISTVFFTLRATPIYEAKTTIL
A0A0S7XD06      ----MFSRDSERKEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTIM
                             :  :  *. :::. . ::   *. ..  :          * : : : 

A0A1V5ZEN4      IESGNPAAMAVALTADAQGK-----RPIEFFMGI--LESRSFRDAVRDAVRDHAISRGMP
A0A3D4BE10      IDTRTLSTRG------DGAMVRAVAQSVDYYDRI------FRTGIFRNELLDSLSADEAS
A0A1V4R2W1      VEA----EEGMNLLDPRGSLFGPLAKPVEFFERI----------MESPSYRDQVALKVTE
A0A1V4RNF1      IET-GKTGAAIPLFEAPGFTR----RETMINNQVQILKSRTIAELVLNELRKLSGSQTFA
A0A496STL3      IET-GKTGAAIPLFEAPGFTR----RETMINNQVQILKSRTIAELVLNELRKLSGSQTFA
A0A0S7XD06      VEVGGRAGGIESLFGVRSAMQSSVVNEVILNNQVEILRSRTLAERTISKLRNLPVSDRLE
                ::                       .       :                 .        

A0A1V5ZEN4      --------PIQATDLSREAIESLQIKRSKNEGFYTVIAESESPDIAYATDSLAVSLFMER
A0A3D4BE10      IIAQNHNLSLE-----NLIEFNLSLNADAVQSFFRITASASNPDLAYRLADVSSHLFQKR
A0A1V4R2W1      RLRNPHGILLPMDEALDLVEHNLTLNTSKTSDFLEIKAHADSPLLCYLLAASGTEVLKDR
A0A1V4RNF1      IFKTDLGRPWSREDALKTLEESIKVTPIRDTDIVEIKCQAPSPEEAVAIANTFAHVYYQQ
A0A496STL3      IFKTDLGRPWSREDALKTLEESIKVTPIRDTDIVEIKCQAPSPEEAVAIANTFAHVYYQQ
A0A0S7XD06      LFASEDGKA-SMASLIERLSPAVEISPIQNTNIIVVKARAGKPYEASLIANTIVETYLEL
                                      : :.     .:  : . : .*  .            . 

A0A1V5ZEN4      CILYARQQTNAMTAFVAMQFDSARARLERAEDNLQAFRKQHNLIQAGGGPAT--------
A0A3D4BE10      LIDIESESMVESDVYLDEQITLLRNKLETKEIEIQKFTREQHIIPGKPGSVGNTGFMAFQ
A0A1V4R2W1      SRGVDKEEAQSVLDFIEDQKIEAQQKLEAAEKKLQLFRERVGIVGNGEEGGALGKLIELE
A0A1V4RNF1      RLQMSREEISETRRFIEDQLAKVREELRASEEALRDFKQKEKVVALPDETKA------LV
A0A496STL3      RLQMSREEISETRRFIEDQLAKVREELRASEEALRDFKQKEKVVALPDETKA------LV
A0A0S7XD06      NLSWARGEVTEIKSFVEEQLTLVRERLSSAEDKLKRFQESEKVASLSHETEA------AV
                       .      ::  *    .  *   *  :. *     :                 

A0A1V5ZEN4      -------------DPSLPIDYVRL-----------------------------------V
A0A3D4BE10      IKLDEIEVQRELTAIKLRIYRQRQDEISR--RQYTYNNVDLLVDQIDQEIRSIGAKADSL
A0A1V4R2W1      KELAGVQAQKELAQANLEAYDLRIAQV----------LPDKTA--GGRETEGLSREIATL
A0A1V4RNF1      EQLADFEALYNEAETDLGSSQTRLNYLRKQLREQQKDLPEKIAMVSSPLIQNFRGEIAKL
A0A496STL3      EQLADFEALYNEAETDLGSSQTRLNYLRKQLREQQKDLPEKIAMVSSPLIQNFRGEIAKL
A0A0S7XD06      KKLAEFDALKGQAEVDLESTQRRLTFLETQLSDQRKSLVDDIGRVSAPMVTQLRGTLANL
                               .*     *                                    :

A0A1V5ZEN4      EGYYDA------RQERQTAQAALEAAEEASRLLRINLDTLATDKLRRALPALDLAEAEER
A0A3D4BE10      ESLQAT-LRNSLDQTHPDVIKINKQIRDI--QFEENEVYARIYQISSPQKRNLLPILKAK
A0A1V4R2W1      ESIRANLVRQP-GEHHVEVLSLDKKIAEKKKKLVESI--VQDTDVRSSGMQVEIAQLQER
A0A1V4RNF1      EGKYANYIAQGISEDNEKVVAIKNRIQEIKNKLKEETRKLLSEKLAPENPLLFSQALVDK
A0A496STL3      EGKYANYIAQGISEDNEKVVAIKNRIQEIKNKLKEETRKLLSEKLAPENPLLFSQALVDK
A0A0S7XD06      EGIRTRYLAQGYPENHEKMKEIERRIEETKGQLVTKTKSALSEEVSLQDPFSYSQELIER
                *.           : .           :    :  .       .:              .

A0A1V5ZEN4      TRKARTELQLKELQEQSFLAQLQAYEASHP-GLSDVSIGYLRLVRERDIYVRLSDLLLER
A0A3D4BE10      IDAAEEAMFELTTEAEYYDIKIQEFTPDSNTAFFNNELHLRRLMRSQELYETNYNVLIQL
A0A1V4R2W1      RTAEELNIYVLESQERYYENLIEKFKAEHP-SMLENAIELAQLTRARKVYENMYNILLEK
A0A1V4RNF1      ILTLEVEVEASSAKASALKRIVDQYAEKLQ-ALPEKSLELARLERTAQVNEKIYIMLMEK
A0A496STL3      ILTLEVEVEASSAKASALKRIVDQYAEKLQ-ALPEKSLELARLERTAQVNEKIYIMLMEK
A0A0S7XD06      ILDLEVEVRTLRARVEGFDQLVSQYAVELE-RLPGKALALARLEREREVNEQILLMLMDR
                       :             :. :  .    :    :   .* *  .:      :*:: 

A0A1V5ZEN4      REELRVKSASETGGVRVVDAPSEPT-PKPSRAPLILIFAAIIGLSLGAGAAFLLEAMDTS
A0A3D4BE10      NEESQLKKATQSGGVKMIDPAYRPKAPVPSTASRKILFGAILGMSLGLGAVFLLEYMDTS
A0A1V4R2W1      GEEAKINASTGTGGVKVVEKAREPDEPVPAHSKRNLVLGAMVGLGLGLGIAFALEYMDNT
A0A1V4RNF1      SQEARITEAGQIGNVRIIDEAREPKYPIKPKKKLNVILGAVVGLGLGVGIAFFLEYIDTS
A0A496STL3      SQEARITEAGQIGNVRIIDEAREPKYPIKPKKKLNVILGAVVGLGLGVGIAFFLEYIDTS
A0A0S7XD06      YEEARIKEAGQLGNASVVDRAEEPREPILPRKRRNVLLGSVAGLLLGLLCVFSLERLRDR
                 :* .:. :   *.. ::: .  *  *  .     :::.:: *: **   .* ** :   

A0A1V5ZEN4      VRTVNDITEALE-VPTIGTIP----------SIGVTPGGKRRRETERRRV---LISDGNP
A0A3D4BE10      LKSSDEISRFLQ-IPLLGEIPKIDADKPTRKWLRFLPGTIK---SNEEAYDSRIIAHFDP
A0A1V4R2W1      IRTAEDLSRTLG-LSVMGTIP----DIQKLENMQRKRSGKKKRKGGGERDDPGLISRYET
A0A1V4RNF1      IRTPDEVERFTN-LALLGTIP----------LIKGRDNDKKTRHTEASLISSRLISHLAP
A0A496STL3      IRTPDEVERFTN-LALLGTIP----------LIKGRDNDKKTRHTEASLISSRLISHLAP
A0A0S7XD06      IADVSDVETATDGIPVLAAIPSATTKRRGFRLLRTRRRVFPFQGSSGEAVPKVLLTELSP
                :   .::      :. :. **           :                    :::   .

A0A1V5ZEN4      KDPIAEAYRTLRTSLLFS-SGDQPIRSVVVSSAGQAEGKSITVANLAIVCAQMGQRTVIL
A0A3D4BE10      KDPIVESYRNVRTSLLFTFTSGDPLQAFVISSPNPSEGKSLTTSNLATVFAQSGKKTLII
A0A1V4R2W1      KDMVVESYRSLRTNLQFA-SVDKPLKSMLISSPGPMEGKTLTVANLGISFAEMDKRTIIV
A0A1V4RNF1      KSPASEAYRTLRTNIQFT-KLDRPLQSLLVTSATPGEGKTTTVANLAITMAQMGTKVLLV
A0A496STL3      KSPASEAYRTLRTNIQFT-KLDRPLQSLLVTSATPGEGKTTTVANLAITMAQMGTKVLLV
A0A0S7XD06      RSEISESYRTLRTNILFS-QVDKPLRTIVLTSPGPTEGKSTVVANLGFVMAQAKNKTVVI
                ..   *:**.:**.: *:   . *:.:.:::*.   ***: ..:**.   *:   ..:::

A0A1V5ZEN4      DADLRRPVQHILFELEREEGLTEALVHRRELSEVAKPTSIENLDVVTCGVIPPNPATLLG
A0A3D4BE10      DTDLRRPVIHKIFRLPKNPGITDVLVGQIHWNEAIRQTDIDNLFVLPSGTSPPNPGEMVG
A0A1V4R2W1      DADLRRPRQHKLFGVGKEPGLTDYLVGTASLEDVILPTEVDHLSLIPAGRGSPNTAEMLG
A0A1V4RNF1      DTDLRKPMLHQIFGVERDVGLTNVLVGERGLSSVIKPTDIEGLSLISCGPIPPNPSELLG
A0A496STL3      DTDLRKPMLHQIFGVERDVGLTNVLVGERGLSSVIKPTDIEGLSLISCGPIPPNPSELLG
A0A0S7XD06      DSDLRRPTVSLLLGTPKGAGLTDVLSGKAVLDDVITSTSVDGLFLVGTGTLPPNPSEMLG
                *:***.*    ::   .  *:*: *      ...   *.:: * ::  *  .**.. ::*

A0A1V5ZEN4      SAAMGERLEELAQHYDIVLIDTPPVIVVTDAVLVARKTDGVLLVVRCNSTPREAARHTAD
A0A3D4BE10      SERMTEILDILKEHMDIIILDTPPVVAAIDAAVLGAKTQGIILVLNMEETKRDSAKFSID
A0A1V4R2W1      SNRMSDLIRKLISEHDIVLFDSPPLVPVTDAALLASKMDGVLLVTKYASTHKDAVHHALE
A0A1V4RNF1      SEKMGQLIEQARREFNFILFDSPPTVAVTDAAVLATLTDGALLVVQSAKVSREAVNRAKS
A0A496STL3      SEKMGQLIEQARREFNFILFDSPPTVAVTDAAVLATLTDGALLVVQSAKVSREAVNRAKS
A0A0S7XD06      SLRMRQVIAELAAKFEFVLFDSPPVLPISDAAALGARVDGVLMVARCGVTGVAGLSRAIS
                *  * : :       :::::*:** :   **. :.   :* ::* .   .   .   : .

A0A1V5ZEN4      TLRTANIPLIGAVLNDVDVTRRYGGYHYYNYYYHYYYGGYYGSSDGSGDTKTAKT
A0A3D4BE10      QIERAGGKVLGGLLNNVDVNRRYG------YYYNQYYY-----------------
A0A1V4R2W1      ILEKVGAPTIGAILNDVEVVRRLG---YYRYYYNNYYYYTYHEDEKKEETKA---
A0A1V4RNF1      VLEGVGARVLGAVLNDFDVESQYG---YYSHYY-YYYYYNYPESGEKKRRRKARA
A0A496STL3      VLEGVGARVLGAVLNDFDVESQYG---YYSHYY-YYYYYNYPESGEKKRRRKARA
A0A0S7XD06      VMRGVHARVIGIILNDLDIRQRLG----EGYYD-YYRSYSHAQGADEPS------
                 :  .    :* :**:.::  . *      :*   *                   

© 1998-2020Legal notice