BYKdb

Dataset for cluster tadcd of phylum candidatus-rokubacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1Q7GC33      MTISNLPTPLAPSPAVAPVTPYPGIAELDSPD---------------------AEGGVDW
A0A2V6RFZ8      --MSGPQEFAEDARPPSPGAPTVELVPSEPPR---PAATARARL----YTYPGEEEGVHF
A0A1Q7U8C0      --MSEQLRSEPPAPSRRLAD--------------------RADPEAFVHTVGLEE-----
A0A2V6WUL2      --MSDV-DPRHDPRPLPSGDEGHELVPGPASATLAPLEPVRA------YPYGVDEDAPHF
A0A2V6UWS7      --MSALWRPERETRMLPAGD---------------PVEITRAEHVAYGYP---AEETSHF
A0A2V7HN10      --MSALWRPERETRMLPAGD---------------PVEITRAEHVAYGYP---AEETSHF
A0A1Q7D2L3      --MNTFNDPTRDPRALPPARAGLELVQGRVPML---PEPQTL------YGVPVEKET-HF
A0A2V6R309      --MSDDVDPRRDLRSLPSGEDGPQLVQSHAPTIIAPVEPARA------YPYVVDDAAPHF
A0A1F7MHS2      ------------------------------------------------------------
A0A1F7LDJ8      --------------------------------------------MSQGRAGGATHRFSSF
A0A353V8C8      --------------------------------------------MSQGRAGGATHRFSSF
                                                                            

A0A1Q7GC33      RRISSALLRFKWLIAAVTFVGTVAGVGATRFLKPEYAAQAKIWIDVAGRRGPDRGPTPIR
A0A2V6RFZ8      WDFWHVLNCRRWTVISSCVVTVIAVTIWTFTTPPVYTGTATLRIE-------KEDPHVVK
A0A1Q7U8C0      --LLSTLRRHVWLVLGVAAVAVAATGFVAYTTGPVYRAVAVIRL--------SDPRRALT
A0A2V6WUL2      WDYWRVLARHRWTVISFFLVTVIAVMIWTFTTKPVYTGTATLRIE-------NEEPKVLK
A0A2V6UWS7      WDYWRVIRRRRWTIITCFLVTVTAVTVLSFTARPVYRASATLRIE-------KDQPRIVK
A0A2V7HN10      WDYWRVIRRRRWTIITCFLVTVTAVTVLSFTARPVYRASATLRIE-------KDQPRIVK
A0A1Q7D2L3      WDYWQVVSRRRWTILCVFLGTLLAATLYTFTIRPVFTGTVSLRIE-------KEPPRVVK
A0A2V6R309      WDYWRVLARHRWTVVSFFLVTVTVAMIWTFTTKPIYTGTATLRIE-------SEEPRVLK
A0A1F7MHS2      -----MLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVD---------RYRIDP
A0A1F7LDJ8      ADYLDVLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVD---------RYRIDP
A0A353V8C8      ADYLDVLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVD---------RYRIDP
                      :    . :         .    :    * : . . : :                

A0A1Q7GC33      PGQLLDPE------------SWVDLLESYVVLDQVVRDERLFLSPSSLADALALETFRVA
A0A2V6RFZ8      FDEVVKDADSQQDYYQ----TQYKLLQSRTLANRVI--GLLQLDQ---------------
A0A1Q7U8C0      GGVVEDPAPSADERFADPLLSQVELLTSGTVAGAVV--DSVPMLRVLTRKFSPSLLGGVA
A0A2V6WUL2      FEEVVKGADSQQDYYQ----TQYKILQSRTLANRVI--GLLQLDQ---------------
A0A2V6UWS7      FEEVVK-EDSQQDYYQ----TQYRILQSRSLANRVI--GLPQLDQ---------------
A0A2V7HN10      FEEVVK-EDSQQDYYQ----TQYRILQSRSLANRVI--GLLQLDQ---------------
A0A1Q7D2L3      FEEVVKEADNQQDYYQ----TQYKILQSRSLANRVI--GLLQLDQ---------------
A0A2V6R309      FEEVVKDADSRQDYYQ----TQYKILQSRTLADRVI--GLLQLDQ---------------
A0A1F7MHS2      LQQIEIDRPDMTNFYE----TQFELIRSRPVIQRAI--DGLQLAT---------------
A0A1F7LDJ8      LQQIEIDRPDMTNFYE----TQFELIRSRPVIQRAI--DGLQLAT---------------
A0A353V8C8      LQQIEIDRPDMTNFYE----TQFELIRSRPVIQRAI--DGLQLAT---------------
                   :                :.  :: *  :   .:      :                 

A0A1Q7GC33      DQYRPGAYRFSVGRSGQDYALATMDGIEIERGTLGDSVARRLGFQWAPAPGTVAPGRTVE
A0A2V6RFZ8      ---------------HPDFQRPERERGWLTQAEIRFRQ---WLVRWAPVPPPPAPQETED
A0A1Q7U8C0      VAPDSAAHSFQLTFGRDDFVVE--GPAGQQRRAAYGRVVDLGVIRFAVLHRPSAKQGFLQ
A0A2V6WUL2      ---------------HPEFSQL--ER--DGGLAAWVRR---QLVSWIPVPPPPAPEGAED
A0A2V6UWS7      ---------------HPEFAAA--PKSLNERTEDTVRE---WLVRWIPVPPPPAPEAVED
A0A2V7HN10      ---------------HPEFAAA--PKSLNERTEATVRE---WLVRWIPVPPPPAPEAVED
A0A1Q7D2L3      ---------------HQEFEQD--QDGWVARGESWLRE---QLVRWIPVPPPAAPEATDD
A0A2V6R309      ---------------HAEFAQP--EGGLVASLEAWGKR---ELVRWIPVPPPPAPEGAED
A0A1F7MHS2      -----------------------------------------RRPGLAGAPDP--------
A0A1F7LDJ8      -----------------------------------------RRPGLAGAPDP--------
A0A353V8C8      -----------------------------------------RRPGLAGAPDP--------
                                                                   .        

A0A1Q7GC33      FTLTTLRDAATRLSEGLDARMDPDGNFLRVELRGPNPERITAIVNAVAQRYVQVEADLKR
A0A2V6RFZ8      LALAS--PLTSAVLSRLSIEPVRSSRLVRISFESHFPDLAARVPNALADAFIAQQLDQKV
A0A1Q7U8C0      VLDQE--SAISYLIAKVRVRPRLRTDIVDVAYSAPDPARAQEVVNRVVDVFRAASADAAQ
A0A2V6WUL2      LVLES--PLAETFLEHLSVEPVRNSRLVKVSFDSHYPDLAARVANTTADAFIAQQLDQKV
A0A2V6UWS7      LVVTS--PLTSAFLGRLTVEPIRSSRLVKVAFDSGHPDLAARAANTVAEAFMAQQLDQKI
A0A2V7HN10      LVVTS--PLTSAFLGRLTVEPIRSSRLVKVAFDSGHPDLAARAANTVAEAFMAQQLDQKI
A0A1Q7D2L3      LMVAS--PLTDTFLKRVTIEPVRNARLVYVSFDSHYPDLAARVANTLADAFIAQQMDRMV
A0A2V6R309      LVLES--PLAEAFQEHLSVEPVRNSRLVKVSFDSHYPDLAARVANTIADAFIAQQLDQKV
A0A1F7MHS2      ---------AKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVSDLRL
A0A1F7LDJ8      ---------AKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVSDLRL
A0A353V8C8      ---------AKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVSDLRL
                            .   :         :: :      *       *  .: :     *   

A0A1Q7GC33      KKLTELTKILGDQVQHSQENLRRAEDALQRYREETITLPSERPTVGAAVTGPPGSAPVAG
A0A2V6RFZ8      EATRYASQFLAKQLDETRDRLGEAEGKLNRF-----------------------------
A0A1Q7U8C0      RQSKLRREFLEAQLKVNDSLLADARQALTEF-----------------------------
A0A2V6WUL2      EGTRSATQFLAKQLDETRDKLREAEEKLNAF-----------------------------
A0A2V6UWS7      EATRYATQFLAKQLEEARGKLEESEGKLTKF-----------------------------
A0A2V7HN10      EATRYATQFLAKQLEEARGKLEESEGKLTKF-----------------------------
A0A1Q7D2L3      EATRYATQFLAKQLEEARGKLGESETHLSNY-----------------------------
A0A2V6R309      EGTRYATQFLANQLDETRDKLREAEEQLNKF-----------------------------
A0A1F7MHS2      EGSRNAYEYLTNEVKNMKDSLNRAEMALGRY-----------------------------
A0A1F7LDJ8      EGSRNAYEYLTNEVKNMKDSLNRAEMALGRY-----------------------------
A0A353V8C8      EGSRNAYEYLTNEVKNMKDSLNRAEMALGRY-----------------------------
                       : *  ::.     *  :   *  :                             

A0A1Q7GC33      LGGTGGVGAA-GAVGGAGRDPVLGGFF---EMQMSREEARRDRSALGRLLAQAGDSGLSG
A0A2V6RFZ8      LKANNILFITGGDKTSQAQDLITQQLT---LLSDGWLKARSERIAKESLLAQG-----NT
A0A1Q7U8C0      QRRARPYGSG-GSSAREQSELPGLELERQQLMAERRTDEALLAALRDSSTSRK-----AI
A0A2V6WUL2      LTANNILFVN-VDKNGQPQDLLTQQLS---LVSEAFLKARADRIAKESLLAQA-----NG
A0A2V6UWS7      LNGHDILFVT-ADRGGQQQDLISQQLA---LLSDALLKVRGERIAKESLMTLA-----ST
A0A2V7HN10      LNGHDILFVT-ADRGGQQQDLISQQLA---LLSDALLKVRGERIAKESLMTLA-----ST
A0A1Q7D2L3      LNSHGILFVT-ADRLGQPQDIITQQLT---LMSEAFLRARADRMAKESLLTQA-----SV
A0A2V6R309      LAANDILLVS-ADKNGQPQDLLTQQLS---LVSEAYLKARADRIAKGSLLAPA-----SG
A0A1F7MHS2      KEEHQLILLP------QRANAAASKMS---DFHAAYVDAQTRRLELEAQLRTV-----RE
A0A1F7LDJ8      KEEHQLILLP------QRANAAASKMS---DFHAAYVDAQTRRLELEAQLRTV-----RE
A0A353V8C8      KEEHQLILLP------QRANAAASKMS---DFHAAYVDAQTRRLELEAQLRTV-----RE
                                   :     :     .                            

A0A1Q7GC33      DALSVVGSVQENPELSEALKELTTKQAELRGLR--YKYQDDYPPVQRLVGEIATLERQTI
A0A2V6RFZ8      QDVGTLPAVLQNPLVSKLREDLAALESEYEKLS--QVFKPGYPHMRQLAEKIAESRRQLR
A0A1Q7U8C0      QTALAAPGMGASPALSQLSAQLFQYEMARDSLASRSARHPDLPRLNLLVSSTEA------
A0A2V6WUL2      QDNGSLPVVLQSRLIVQLKQDLTTQEADYQRLG--QIFKPQYPRMQQLAQKIAEGRRQLQ
A0A2V6UWS7      RDVDSLPAVLQSSMIAGRKQELAGLESEYRKLA--QTFKTDYPRMQQLAEKIAETRHQLR
A0A2V7HN10      RDVDSLPAVLQSSMIAGRKQELAGLESEYRKLA--QTFKTDYPRMQQLAEKIAETRHQLR
A0A1Q7D2L3      QDAFTLPAVLQSPLIAQLKTDGAALEGEYRRFS--QTFKPDYPRMLALKEKIDENRRQLR
A0A2V6R309      PDLDSLPVVLQSRLIVQLKQDLATQEAEYKKLG--QVFKPHYPRMQQLAQKIAEGRRQLQ
A0A1F7MHS2      GGPNSAALEAKSEALAGLRAQEAAAQTELNNLL--KTYKDKHPAVVRARAQLDDIRARLK
A0A1F7LDJ8      GGPNSAALEAKSEALAGLRAQEAAAQTELNNLL--KTYKDKHPAVVRARAQLDDIRARLK
A0A353V8C8      GGPNSAALEAKSEALAGLRAQEAAAQTELNNLL--KTYKDKHPAVVRARAQLDDIRARLK
                           .  :     :    :     :      :   * :     .         

A0A1Q7GC33      PALARALAGQLAAREG------ELSRRLDADSRSLRRIPERAITEARLRRDATLSENLYA
A0A2V6RFZ8      TEIDRAAQAVQADYQAALRTEQELEGALAQQRLQAGGLADNMAKYNLLRREVDTSRDLYS
A0A1Q7U8C0      ----KLLRAVQAGVQGSIASLDGRIAAIDDLRAHWAGGLQQDAEEARLKERVDNARKVAD
A0A2V6WUL2      AELRRAVESLRADYQAAARTEQEMEASLVQYRGMARRLSDRMAEYNLLRREVDTSRELYT
A0A2V6UWS7      VEIDRAVAALQADYQAAVRTEREIEVALTQQRKLARGLSDSMAEYSLLRREVDTSRELYA
A0A2V7HN10      VEIDRAVAALQADYQAAVRTEREIEVALTQQRKLARGLSDSMAEYSLLRREVDTSRELYA
A0A1Q7D2L3      TEIDRTLASLKSDFESSVRSEKALEASLAKQSTLARGLAENMAEYNLLRREVDTSRDLYA
A0A2V6R309      AELGRTVASLQADYQAAARTEQEMESALVRHRGLARRLSARTAEYNLLRREVDTSRDLYT
A0A1F7MHS2      TEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQDLARKEVQFNVLQREATVGRDMLD
A0A1F7LDJ8      TEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQDLARKEVQFNVLQREATVGRDMLD
A0A353V8C8      TEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQDLARKEVQFNVLQREATVGRDMLD
                    .   .  .  :            :                   *.  .  . .:  

A0A1Q7GC33      SLQQQYDEARLAEVSTVSDVRVLDSAVVPRRPVKNTAPRLILLAFLGSFGLAVMGAILID
A0A2V6RFZ8      SLLARLRETQISAALFTSNISIVDRAEISGMPSRPKRSTNLLVGCIAGLLGGVVLALVFE
A0A1Q7U8C0      ELRVEYQKAGIAEAITVGQVEIVDHAALPAKPAGIGLPEQIALGLLVGLMLGSAGAFLAE
A0A2V6WUL2      SLLGRLRETQISSALLTSNIYVVDRAEIPSRPSRPKRALNFVLACVVGLVGGVGVAFFFE
A0A2V6UWS7      SLLGRLRETQISAALFTSNISVVDRAEVPSTPYKPNKAQNLLLACLVGLVGGVGLAFLFE
A0A2V7HN10      SLLGRLRETQISAALFTSNISVVDRAEVPSTPYKPNKAQNLLLACLVGLVGGVGLAFLFE
A0A1Q7D2L3      SLLGRLRETQVSAALLTSNISVVDPAEIPIGPSRPRKMLNLLIACVAGIAGGIGLAFLFE
A0A2V6R309      ALLARLRETQISSALLTSNIYVVDRAEVPNHPSKPKKALNLLLACVVGLLGGVGAAFFFE
A0A1F7MHS2      FLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRRLQNLLMGLLAGLVGGLVIAFVLE
A0A1F7LDJ8      FLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRRLQNLLMGLLAGLVGGLVIAFVLE
A0A353V8C8      FLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRRLQNLLMGLLAGLVGGLVIAFVLE
                 *     :: ::    .. : : : * :.  *        : :. : .:  .   *:. :

A0A1Q7GC33      RADPRVRYPEQVSREMGLTILGAVPYVR---VRPQARPGHNGGPRQP----------EDA
A0A2V6RFZ8      YLDTNIKDAKDVESVLRVPILGMVPSWA-----LRRRREPADG-----RPFALAAQSTTA
A0A1Q7U8C0      RLGSTIAQRVQVER-LGMSVFGVITHWD--------RDAREKGVKNP-------------
A0A2V6WUL2      YLDTSIKDAKEVEALLRVPTLGLVPSRRALERRGRRRRELVQG--DRLGPFALVSHADMS
A0A2V6UWS7      YLDTNIKDTKEVESVLRVPALGLVPSRH-LGQGRRARRALAAG--DS-APFALLAHSQMG
A0A2V7HN10      YLDTNIKDTKEVESVLRVPALGLVPSRH-LGQGRRARRALAAG--DS-APFALLAHSQMG
A0A1Q7D2L3      YLDTNIKDTKEVESLLRVPALGVVPSRAAFERMLARRKAVESGPTAE-TPFALVSHSELP
A0A2V6R309      YLDTSIKDAKEVEAVLRVPTLGLVPSRRALERRARRRREFVHG--DD-LPFALVCHADMS
A0A1F7MHS2      FAEDSVQNPDDVAQLLGAPLLGTVPVLQ------AVSPSALKDAPDK-ARHRLVETDGAD
A0A1F7LDJ8      FAEDSVQNPDDVAQLLGAPLLGTVPVLQ------AVSPSALKDAPDK-ARHRLVETDGAD
A0A353V8C8      FAEDSVQNPDDVAQLLGAPLLGTVPVLQ------AVSPSALKDAPDK-ARHRLVETDGAD
                     :    :*   :  . :* :.                 .                 

A0A1Q7GC33      AMVVEALRGVCLNLSYAQRAAAPLLVTITSPGAGDGKSFLVANLGHTFAEAGH-RTLLID
A0A2V6RFZ8      SDFAEAFRNLRTSLLYSSPDHPPKTILVTSLQPEDGKTSLATNLAISLVQLGRVEVLMID
A0A1Q7U8C0      DAVVEAFRGLRLTLVNEYGAPGPIVVTVTSPGSGDGKSFVSSNLALAFA-YAKQRTLLVD
A0A2V6WUL2      SVFSEAFRNLRTSLLYSAPDHPPKTLLVTSLYPEDGKTSLVSNLAITLAQLGAGEVLLID
A0A2V6UWS7      SVFSEAFRNLRTSLLYSTPDHPPKTILVTSPHPEDGKTSLVTNLAITLAQLGSGEILVID
A0A2V7HN10      SVFSEAFRNLRTSLLYSTPDHPPKTILVTSPHPEDGKTSLVTNLAITLAQLGSGEILVID
A0A1Q7D2L3      SVFAEAFRNLRTSILYSTPERPPKTLMMTSLQPEDGKTSLVTNLAITLSQLGGSPVILVD
A0A2V6R309      SVFSEAFRNLRTSLLYSAPDHPPRTLLVTSLHPEDGKTSLVTNLAITLAQLGAGEVLLID
A0A1F7MHS2      TRAVESLNLIGVALRSDSNGSLPRRILVTSATPQEGKSTIAANLAVTLARLGT-RVLLVD
A0A1F7LDJ8      TRAVESLNLIGVALRSDSNGSLPRRILVTSATPQEGKSTIAANLAVTLARLGT-RVLLVD
A0A353V8C8      TRAVESLNLIGVALRSDSNGSLPRRILVTSATPQEGKSTIAANLAVTLARLGT-RVLLVD
                    *::. :   :        *  : :**  . :**: : :**. ::   .    :::*

A0A1Q7GC33      GDIRRGVLHRRLSARRRPGLTDFLRGEVPVEAIVQATPYPSLSLIGCGTRASNAPELLGS
A0A2V6RFZ8      ADMRRPNLHNVLSVRQAPGLSTFLTGQAELADVIVPTSVRNLSIIPSGRIPLNPAELLTS
A0A1Q7U8C0      ADLRRGALHRLLNLRRQPGLTDFLIGDVSRAPALQTTAYPFLDFLPSGTRRRDAPELMGS
A0A2V6WUL2      ADMRRPSLHEVLRLAQAPGLSTFLTGQAELNDVIKPTRIPNLSAIPSGRIPLNPAELLAS
A0A2V6UWS7      ADMRRPNLHEILELPKAPGLSTYLTGQAELADVVVASAIPNLSVIPAGLVPLNPSELLAS
A0A2V7HN10      ADMRRPNLHEILELPKAPGLSTYLTGQAELADVVVASAIPNLSVIPAGLVPLNPSELLAS
A0A1Q7D2L3      ADMRRPMVHRVLNIEQTPGLSTYLTGQADLEQVIVPSGIPNLFVIPAGRIPVNPAELLAS
A0A2V6R309      ADMRRPSLHEILGVAQAPGLSTFLTGQAALTDVIKPTGIPHLSSIPSGRIPLNPAELLAS
A0A1F7MHS2      TDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRPTAVPGLSLLPVGRVTGSPLALIKS
A0A1F7LDJ8      TDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRPTAVPGLSLLPVGRVTGSPLALIKS
A0A353V8C8      TDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRPTAVPGLSLLPVGRVTGSPLALIKS
                 *:*.  :   :     ..:       .     : .:    *  :  *    ..  *: *

A0A1Q7GC33      QVMAQLVTTLRPSYDVILVDSPPLGAGVDPLILGTLAGHLAVVLRTGYSHRDMAAAKLDV
A0A2V6RFZ8      TRLPQALEGLGGRFAHIVVDTGPIFGVSDAMIVAAQVEGVVLVLRHGRASRDAAQRAIRN
A0A1Q7U8C0      AAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLLMVLRLGRTDRELAEAKLEI
A0A2V6WUL2      SRLRQALTALEARYAYVVFDTGPLFGISDAMVLAAQVEGVVLVLRHGRATRDASQRAIRS
A0A2V6UWS7      ARFKQALDTLGQRFAYIIVDTGPLFGVSDGMILAGQVEGVVLVLRQGRASRDAAQRAIRS
A0A2V7HN10      ARFKQALDTLGQRFAYIIVDTGPLFGVSDGMILAGQVEGVVLVLRQGRASRDAAQRAIRS
A0A1Q7D2L3      ARLREMIEALGQRFAYIVFDIGPMFGVSDAMILAGQLEGTVLVLRHGRASRDAAQRAVRS
A0A2V6R309      TRLRQALTTLEVGFAYVVFDTGPLFGISDAMVLAAQVEGVVLVLRHGRATRDAAQRAVRS
A0A1F7MHS2      AYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVRHGHGSQWRLRKMVGQ
A0A1F7LDJ8      AYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVRHGHGSQWRLRKMVGQ
A0A353V8C8      AYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVRHGHGSQWRLRKMVGQ
                  :   :  *   :  ::.*  *:    * : :.       :*:* *   .      :  

A0A1Q7GC33      VQRLPVRLLGAILNAVPAGAAYGYYSYY--SYYLS---------GYEAVDEENERSNGSK
A0A2V6RFZ8      LMSVGAKLLGVILNDVDVRAEG-YYGYY--SNY-----------GYEAEKETA-------
A0A1Q7U8C0      LRRLPLRLLGAVLNDVRDESEYRAYAYYMDGYALTNEPPFRPLGGKQGASSHAAG-----
A0A2V6WUL2      LLSVRARLLGVVLNDVDVSGQG-SYGYY--GYY-----------GYDARAAEGAAKEVRS
A0A2V6UWS7      LLAVRARLLGVILNDVEVGGTR-YYGYY--DYY-----------GNGGSNGHAAGEGHRN
A0A2V7HN10      LLAVRARLLGVILNDVEVGGTR-YYGYY--DYY-----------GNGGSNGHAAGEGHRN
A0A1Q7D2L3      LTAVRARLLGVILNDVDIHANGYGYGYY--GYY-----------GYSSNESTVARRN---
A0A2V6R309      LLSVRARLLGVVLNDVDLSGQG-SYGYY--GYY-----------GYGARSAEGAAKEVSS
A0A1F7MHS2      LDRIRVPVLGFVYDGYTPRDDK-HYSYY----Y-----------GAPRKRTSRGRAGNQT
A0A1F7LDJ8      LDRIRVPVLGFVYDGYTPRDDK-HYSYY----Y-----------GAPRKRTSRGRAGNQT
A0A353V8C8      LDRIRVPVLGFVYDGYTPRDDK-HYSYY----Y-----------GAPRKRTSRGRAGNQT
                :  :   :** : :          *.**                *               

A0A1Q7GC33      GQPLVT---------
A0A2V6RFZ8      ---------------
A0A1Q7U8C0      ---------------
A0A2V6WUL2      HGSST----------
A0A2V6UWS7      GTAHEPVADDSRRAS
A0A2V7HN10      GTAHEPVADDSRRAS
A0A1Q7D2L3      ---------------
A0A2V6R309      QGSRA----------
A0A1F7MHS2      VGRGS----------
A0A1F7LDJ8      VGRGS----------
A0A353V8C8      VGRGS----------
                               

© 1998-2021Legal notice