BYKdb

Dataset for cluster orphancd of phylum candidatus-marinimicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A359IET8      ------------------------------------------------------------
A0A3B9KQY2      ------------------------------------------ALIANTFAYEYYKQDLER
A0A660XGI5      EPEKPTFEEIVRNFRKNVISVTPKRDTDMIELKVKAYSPSEASFVANTWVDAYRDLNINE
                                                                            

A0A359IET8      -------------EQLKQVEERLRVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEY
A0A3B9KQY2      SRGAMSEVKSFILEQLKQVEERLRVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEY
A0A660XGI5      SRGEISEVVKFLDEKLKDVKKKLTASEDTLRKYKETHQVVELTAETQQLIKQLAQFESLY
                             *:**:*::.* .***:**.:::   **:*   :::*:.**::*** *

A0A359IET8      YSAMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILELQTKIAKL--EASVVEAI
A0A3B9KQY2      YSAMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILELQTKIAKL--EASVVEAI
A0A660XGI5      QEARTDLQANEKRLAYLKAQLSENQRALVDKAAGLSSPAILELQKQMAQLIGDKAAYEAQ
                 .* ::*: **:.* **. :*. ::. *:::    :.* *****.::*:*  : :. ** 

A0A359IET8      AKGID---ENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDPLSINQSMLEDVIK
A0A3B9KQY2      AKGID---ENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDPLSINQSMLEDVIK
A0A660XGI5      LKGMGLYAKNDQKLMGMEQRLAGLKKKILEETKKMVAGGIT--SLNPMQTSETLIDNILQ
                 **:.   :*  ::  :: .:  :*:.: :**. ::: *    . :*:. .:::::::::

A0A359IET8      LRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNENIYMLMKNKYEES
A0A3B9KQY2      LRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNENIYMLMKNKYEES
A0A660XGI5      IETENKSLKAKTNVLRRIVMKYSRELNSLPEKSQKLARLEREATVDNNIYMMMRQKYEEN
                :   :  *::*:. :..:* :**.**:.**:   .::*****  *::****:*.:****.

A0A359IET8      RITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTK
A0A3B9KQY2      RITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTK
A0A660XGI5      RIVEAGKIGSVRVVDYAVPPQYPIKPKKKMNLILGIMVGLGLGIGLTFLREYLDTSLKSM
                **.**.:*..* *:* :***:**:.******::** ::*******: **.*:**.::*: 

A0A359IET8      EDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDPKSPVSEAYRSMRT
A0A3B9KQY2      EDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDPKSPVSEAYRSMRT
A0A660XGI5      EDVEREGFTVLGSIPIIAPQGRNNHSNK-RNGEIKRIESRLVTHFDPKSPISEAYRTLRT
                **: .:*:*.*. ** *      :::.. .* *:.. :***:********:*****::**

A0A359IET8      NIELSGVDKSIKSVVITSAGPGEGKSTTIANLAIAFAQMDQKTLLVDTDMRRPVLQKVFK
A0A3B9KQY2      NIELSGVDKSIKSVVITSAGPGEGKSTTISNLAIAFAQMDQKTLLVDTDMRRPVLQKVFK
A0A660XGI5      NIQYTKVDKSIKSLLVTSAGPAEGKSTSVANLAITFAQMGTKTLLVDADLRCPVLHAIFD
                **: : *******:::*****.*****:::****:****. ******:*:* ***: :*.

A0A359IET8      VPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQ
A0A3B9KQY2      VPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQ
A0A660XGI5      LPRQGGLTNVLVQKLSLVEAIKPTRIENLSVLTSGTLPPNPSELLSSNAMEKVLEEMEKD
                :**  *:::::. . :: *.*: * :*** :*.**.*******:*.*: * :: : : ::

A0A359IET8      YDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVI
A0A3B9KQY2      YDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVI
A0A660XGI5      FDMVLFDSPPLIAVTDAAVLATKLDGVVLVIKSGATGRDALLRSRTLLQNVDARLFGIIV
                :* ::**:**:******::**.  **:*:*:***.*  :** . ..::*::.  ::* ::

A0A359IET8      NAITPKHMKGGSYYYYYRYMNYQYK-----------
A0A3B9KQY2      NAITPKHMKGGSYYYYYRYMNYQYK-----------
A0A660XGI5      NGININNMYGSYYYYYHHYYYGDGKHRKRKGYRELV
                *.*. ::* *. ****:.*   : *           

© 1998-2020Legal notice