BYKdb

Dataset for cluster tadcd of phylum candidatus-atribacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A524KU10 [Bacteria] Bacterial tyrosine kinase [Candidatus Atribacteria][Candidatus Atribacteria bacterium] (length=766 residues).
YDSSQIPQDEQAPNLILPILRRWYIVLAVAVLISICAIPAIWLLKKPVYEVQGAIRVAPVRTNLLSGETDTGEIGKLDSF
MNTQARIITSNQIVQRVADELADKNLTFFTDQQKDFVIKMKEAIDGQKLGTEPADVLKRAISDGTITAAPARSTEHIAVT
MLNRNPREAGQIVDAFIRAYMAVEVDKSTKEEFNKLDLLETEQDTLLAKLKDHRNKIREMRQEYGSKTLDTRQEMKLERA
GMLLSEVTRYEALALRTEARVNVLRRTIEDQKSEQPEQLEQGNPVEDARTVIDSDPQREEYVNSDRAVSEMAVRISQLEQ
KLIEAKQILAPSNPDLKIRTDTIEALKVDLAERKKEAAGRYESLKLLQAANTDEQKLAEDQIRLANAEAEYELNKELESQ
FRQLFTEEDVETIQVGRKQLDIDDFQDEFALTKETYDRISRRIQELEMEGKGDPRIKTAYDAEVVNTIDKRIKLSLAAVF
GSFAAGAFLAFLLSKMDYSLYTPEDITKRVGVRIIGTTTRSDYLDPKKLPEQLTGDYQTIRANLGMLNGGGIPKKIVVTS
PGMREGKTTFAINLATSMAKSGKKVLLIDADLRKPDIHRLMRLKNNSGGLQDVITGKEFDSIVHHIEIAGFDVITADGHN
PLDAFEILSSSRLPRLLEVISEKYDHIIIDTPPVLAFPDALVLAKLADGVVLASLAGQTDQNDLKETIDRLSRIKVKVLG
TILNSVSINYSYNRYSYGYYEDRAGKRKSRKNRKDALMLPEESGKE
© 1998-2020Legal notice