BYKdb

Dataset for cluster tadcd of phylum candidate-division-ksb1

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bykdb|A0A1F4RMF3 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium RBG_16_48_16] (length=816 residues).
MMMNSNGKGQYSGNGHANAYGSDMQERQVSIKDYIRVLYKARWVIIISFLLVVISTAYYTFTTEPVYEATAKLMIEEEGG
MAQSMFDLTSMMKKETMINNQVEILKSRTLAENVIRDLMASEYADELRYLGNSPEGKEKKPGIIASTRSWLAGLIKNKDD
HGLEVSEEDDFDRYVAGLRGSINVSPIRNTDMINITVSAYSPFEAAYVTDAVANAYRRMNQAQSKDEVRQVKNFLEDQLD
QYRRELSTSEEALKNYKQEAKLVALDQETEELVRKLAEFESLYNGAKTDYQANLKRLEYINGQLQQKQGNFDMESISSQP
YLQELKKQIAEKESQLASYMASMAEIGAYDQIKNEIQLRERQIDAVKEKFKQEVTKIAASGFVDPSIVSTSLFSSKIEVE
TELKSLEPKVKALGEIVAQYSKDLESLPAKSLQLARLVRKAQVDEKIYIMLQEKFQESRITEVGQLGNVRMIDPAKEPKF
PVKPKKKLNLILGILVGLGLGIGIAFVMEYMDNSLRTMEDIEILGQSIIATIPFIKPEGSNGALSKFKQLEDAEAQDISE
RLVTHLRPKSPISESYRTLRTNIMFSNPDKEIKSIVITSSGPKEGKSTSISNLAITFSQMGTNTLLIDGDLRRPILHKLF
NLDKKNGLTNVLVGRANLDEVVQRNPDLPNLDVLSCGILPPNPAELLGSQQMRRLLTEAKEKYGIILIDTPPTIAVTDSS
VLAPLVDGVLLVVKSGGTQRDAFLRAQEQLHRVGAHILGVILNSIQASNVYGSYYYYYYYHYYYGQDGEKKRSKSRRRKA
HKKTHPSDQTIREGDA
>gnl|bykdb|A0A1W9SG22 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium 4572_119] (length=787 residues).
MYQENERQSGMKDYIRVLYRGKWIIIISFLTVVTFVSYYTFTETPIYRSTVKVMVKDNGGVQKTLFNVTDFMEKEKKINN
QVEILNSRTIAENVANKLINSTYANNLIILGNTPDNGKKKFGLKKKLKKIVKSVFVNEEEVTIPESEIKEALFNRVVGEI
RRNLKIEPIRNTDMILISMTAESPTEAAYLANTVAVAYKEQNQFESQEEVRKVKDFLKDQLNNFQSQLEKSEQALKEYKE
KEKVVALPQEIDEMVSKLAEFESLYHGAKLELNANKERLVYIDEQLDKNKKNINMENILNAPFLDQLSQQMAELETKRAN
YIAGLMDEGVYDPNGQDPMLRRYEERTKMLEEKYKSEITQLAAAETIDPIALSEALLQRKLEVEATIQSLLPQVEALKKI
VAQYNLQLEKIPERGLKLARLKRAAMLDEKITLMMSEKYEETRITEVGQLGSVRIIDAAQPNIIPIRPQIKMNIILGIIV
GLGLGIGISFLLDYFDNSVRSADEIEKMGISLLGSIPVISLDEAVKKIGKNGNNRFKKNINTNEVRTIAGRLITHFAPKS
PISEAYRSLRTSIQYSQADKTIKSIVFTSPGPKEGKSTTVVNLAIAIAQMGTNVLLVDTDLRRPVIHSIFNLNRNKGLSN
CLVGKTSIEEAISKTDIDNLCVIPSGTLPPNPSELLGSTKMKKFISELEERFDLVLFDSPPIMAVTDAAVLSSEVDGVVM
VVKEGQTNRDAVMRCYNILKSVPNQLLGAVMNGINVNGFSDYYYYYQYHYYGKEDKKKKRIFRREKV
>gnl|bykdb|A0A3A0DR05 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=798 residues).
MKEKIARQTPLADYLRVLYRGRWIILASFLAVMAITVYLGMTAVPLYQASAKVMFKTESNIGLPGFEAMGYWQTETMISN
QVEIIGGRALAKAVAQKLMQSEQAHELPILGANKHLQSRSGRFSRFLNALFGSSAADDSRNEMQEPVLLEVETVARELPG
YISVAPIRSTDMILLSVVSEDPQEAMIIANAYVEAYSELNRAMSQAEVRQVKNFLENQLGVIQQQLAESELALKDYLKGE
TPMTLTDETNGLVTKLVEFESLYKESLADLEAARERLKFIDQQLGKRGDIAAISATSFLDELKKEMADLQQQRAAYLAYL
AQNGRLDENNARLQELDGQIERLTQKFRAELASFTAAGLGGPANLQDEMFMRKFEVEANIETLIPKVASLKHIVDDYAKK
LESLPEKKLLMVRLQRSAQVDEKIFLMMKEKYEELRITEVGQLGDVRIIEPAELPETPLGPNRKLNIILGMILGLGLGVG
LAFLLDMLDNSVRTMEDLERMGQPVLGSIPMIKEGETLARLKISKNGAPNGVHHGLSNGKVSAIENKLEQQPTAARLITH
VAPKSPISEAYRALRTNIQYTHIDRTLRTLLVTSPGPGDGKSTSVANLAIVMAQMGSKVLLIDADLRRPVLHTVFNLDRR
VGLSNVLVGRADIAEAVSPTDIENLHIMPCGALPPNPSELLGSSAMQRTLEALKQDYEVVLFDSPPVIAVTDAAVLARWV
DGVFLVVKAGHTSKEAAFRSYALLNQVKAKVLGTLLNSVKVESMYGSYYYYYHYHYYTQNSNGKLPKTQRKLLSWPWS
>gnl|bykdb|A0A3A0DV40 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=782 residues).
MGLDTFAFEDDGAMEGQKLDLGRYVQALKRRWWLALIIAAAVAIPWTIYVKQEKPVYEATATISFRNISAIKNPETMMQR
IVEELNSRTFAEQVVAALGLAVTLEQESEHEKFLIRNRIFAQLSSTYNPRAGKYVLRVPGDGQFMLAMIDEDADVEIPLR
TGDVFRAASDTISVNGISFQLADPQKLPQKVTFVVAPFKKVVSSLQQRVQPGLNQSLTLMSVKLTDNDPYVVTQTVNSLA
KLYVDKSRVVGAGEDTKQLETLQEQVRQAQRDYDEIDQRYTEAKRRAGGNVGGNRYEVTVAKLSEAEKKLEVLKQQRDGL
KELLDRAANTQVSSVSGVEREAISYVYKGIANHSLFDNNASMVVARQRLSDLESRRADELRSKTERHPDVIALENEITQL
YAQIQSSGRTKLSNLAQEISRQGREVALLEGQLGSLPNVESTLLGLERQWKQKSDYLQSLQEQLQKGKIAVTSDKSDIEI
LDPAIEPEYPVNRNKKAKAATGGVAGLLLGMFVVVALEALDRSIKSVDDIKGNLKLNVLGTIPQINFGEYYEFQDQEKAK
LIDQQLVTHDYAPTPVGEAYRSLRTNILYSKSAGRIQTFVITSTAPGDGKSFTAANLSITMAQQKSNTLLIDTDLRRGVL
HNTFAVPKEPGFSNYLTGSVLASEIIHETHIPNLSVISCGSLIPNPSEMLGSVQLRRFLDEMRRRYDLIIFDTPPLNAAT
DAVVLGTQVDGAVIVVRSGKTNREVARKKIEMFQNVQAKILGVILNGTTVDLAHEGYSYYQY
>gnl|bykdb|A0A3N5J836 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=758 residues).
MEGKDTTHQLSEFLRILFRGRWIIAVSFLAVVGAVTFLTYRMRPEYSSSASILILNRDMVETEFLNSRPGPVPKSRNLNA
LEILRSRTIVEDVIRSLADSPYRGELEIMREAAPSGMPITFDNRVSTLRNKVGVTLQKDTDLLKVSVIAYSPFESAFLTN
ALAEQFYRYSLQTSRGEITDVRLFLEQQLDVVRQQLSQSEEMERTYKENQGVSALDQETTQLVGQSAEFHALYNTTQTEL
NAQLRRQEYLRRQIAETKGTMVEDISSASSPLIESIQREIADKQTRIATLMANSGPGTDVTVAALEKEVEAIKSKLIEEV
RKVASGGASAIDPMRTSQRLFDELLSTDVEIKALTARAEALREVMQNMDYDLERLPQKTLVLARLTRDRELNEKLYLMLN
EKYEESRITEAGKSAGVQIVDPAKPSVEPFRPKKKLNILLGMLFGLVIGVGIAFFLEFLDDTVKTGDDVERLGMTLLGTI
PLVYTEQIIKRLKKQGKQFTDADLHRVEAKMITRFSPKSPVSEAYRSLRTNIQFADIDKPKRVLMVTSTMSKEGKSTSIV
NLAITLTQMGSRVLLVDSDLRRPSLHNFFSMDKTYGLTNVLIGSLSFDEVVKHTEVEKLDVITSGDIPPNPAELVASEAM
KKFIEEARARYDYVLLDSPPVVAVTDSAILATRVDGTLLVVSSGMVSKREVQRAAGLLKNVRSSVMGVVLNGLDIKKIYG
SYYYYFHYYQYYYYYGSEHKSGKSRKKKSASADYQEVT
>gnl|bykdb|A0A3N9NDM0 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=746 residues).
MDNIDLFKEMELEGFRLQNNQKLSTVLIDYIKIMFRRKWLIALCTIAVVVPITIWIMHVPPSYRADATIIYEEANDTAFL
LDLGQTFYSKSAIVNMIEQIQSRTLAEEVVRSLPEDMIKTFKLPERLPEHLSRDQFIVRLIREELQVEHVRGGDILKIIV
QANDPNAAKNIANSYVDHIIDWNTQKNRKEISSIRNFVEGQLSVFQDKLRDAEEALVTFKENNDVIQLSDASSKVLENLT
EAEVAYSKARAEREALQQRKHIIEQKKQELLPSLGVPVSKITQQLKEELLDLERQYSRLQLQVGLDDQEKLASMREKINQ
TKQDLIDELMHNAAQENLVDPLSQIRNLLQEAITIDVDLETCKAQEQALKNAVDEHDAELQMLPQQELELARLIRAKEVN
DKIYGTLLEKREEARITESGKIGDIRVIDYAELPIKPVKPQKKKIFVLALMLGLSLGVGLAFFLNSLDNSLKSEQDVEKC
LNLPVLASIPNISSNGVLRKITKKEDADNLYSSKLLSQLLAKSYIFEAYRSLQLNFSLLNPDKNLKTVVITSAAPGEGKT
LTSLNIAQLYARAGIRTLVMDCDLRRPMVHKALKIRQEPGLTNALIDKAAHLESYVQLFNDESLHDNLAVLTCGALPPNP
SEILGSKRMGDLLAQLEDMYGLIIIDAPPIISVTDSIILGQKVDGVLLVLRSGKITREAAQKAKKILENSKIHIAGTLLN
DVDLKKVYGYYKDYYYYSNKKMAVES
>gnl|bykdb|A0A3N9NPA0 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=794 residues).
MNDHASRQTSDNGSMTPMPIETNPSRITWRDYIRIFYRGRYAILVTFLVIFIGSVFFTFSMQPLYEASVRLMLVDQSSVG
PSLFDFTSMITKETMMNNQVEILKSRTLAEHVVRDLRKSSIASQLEVLERADTVKAAFSLARLLRSKKTEWVESEIFDDQ
VVTFRKRLGVRHIRNTDMIEIKFQAHTPTEAAFVSNAVAFAYERINQEESKAEIQQVTEFLKNQLALYQDSLQVSEDALK
AYQERAKVVALDHETSELVRKIAEFETLYNAAKTDLEAARQRLNYIDSELEKQNTDFDIEAISKTTALEEFTKRIAEKES
KLAVYQAQTLQKGLSSDTKKHTLREIENLQNQITALKEQFQEDVKAVAANQFMDPAQVSSSLFTSKIAVETELRSLTPKV
DAYGKILTEYNAQLESLPAKKLELARLSRSAQVAEKLYILLQEKYQESRITEVGQLGNVRIVDAAKAPDKPILPKKKLNL
LLGLLLGLGFGIAIAFAIEYIDDSVRSMEDLEHLRLSMIATIPHIKPEQSNGLIAKMVKLDDPEVNAINERLVTHLKPKS
PVSEAYRTLRTNILFTAPDNPKHIIMLTSTGPREGKSTSVANLAITFAQMGTKTLLIDADLRRPMLHKLFQKEKEPGLTN
VLVGGTVLESVIKTVNEVPNLFLLTCGVIPPNPAELLGSTLMRNLLHRAREHYEIILIDSPPIIAVTDPSVLARIVDGVV
MVIRIASTQRGAAQMAVEQLRRVEAPLIGVMLNGISASNFYGSFYYQQYYYYYTKDGNKKRTKKRNRKPFKHLA
>gnl|bykdb|A0A3N9PQN5 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=789 residues).
MNEHLSVIPNGNSAAPAGLNGANSRVTWRDYIRIFYRGRYAILVTFLIIFLGSIILTFTMRPIYEASVRLMLVDQSSVGQ
SLFDFTSMMTKETMMNNQVEILKSRTLAERVIRDLRKSSIAQELDILQRPDTVKAAFSISRLLGSNRKPWAEAEIFDDQV
QQLRESLIVRHIRNTDMMEIRYQAHSPEEACFIANTIALAYERINQEESKAEVQQVTDFLENQLQLYQDSLKVSEDELKS
YQESAKVVALDHETLELVRKIAEFETLYNAAKTDLEAARQRIIYIDAELERQNTDFDIETISKTTALEEFTKKIAEKESM
LAVYQAQTIQKGLSADTKKHTLREIENLQNQIDALKERFKEDVKAVAANQFMDPAQVSSSLFTSKIAVETEIRALTPKVE
AFGKILTEYNLQLESLPAKKLELARRTRSAQVAEKLYILLQEKYQESRITEVGQMGNVRIIDPAKEDEEPISPKKKLNLF
LGIIIGLGLGVAIAFVMDYVDDSVRTMEDLDALHLPLLATIPLIKPEQGNGLLARIKLEDPEVNAISERLVTHLRPKSPV
SEAYRTLRTNILFAAPDKPKQIIMMTSTGPREGKSTSVANLAITIAQTGARTLLIDADLRRPMLHKLFQKEKEPGLTNVL
VGRKSLSDSVKAVEEVPNLHLLTCGVTPPNPAELLGSNLMRELLQFARGQYDTILIDTPPIIAVTDPSVLARIMDGVILV
VRTASTQRGATLMAVEQLRRVQAPLVGVVLNGISTGNFYGSLYYQQYYYYYTTDGQKKRRKVKKQQQSV
>gnl|bykdb|A0A496T729 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=775 residues).
MDAEKFFLEDIQQEEEEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYVKKQPPQYEASALIRFKTYGSDNVGLLNETR
ITELTSRTFAEKVVAQLGLTLEMLAETKERPLRRQKVFEQFSTTTDPISGEYLLEFKDDVFSLFQLNELDKAPRLLVSDS
LSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRKQIKVRFNRTGTLMWVSLTDRDPSLVATMVNQLAQM
YVEESKFFSLKKVKDVKEVVENQLKIAKENLDKANEELKRFKESHFISLDTEVKQNVNELSDLENEIRTIKENIESLSLL
LRRLEKNFETTEASETRYIYRQIARHPAFQQDPNMGILQQQLADLESQRDQLLTRVTESHQDVVEINAQIKFIQLQIKDL
AKKRLEQLYEELATAERTASNLRYKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQEAQISEAVRTEEISILDPALPP
EYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSIPKIEFDHEYELKDADKIKQIDAQLV
TYDYSPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTLAQHKTNTLLVDADLRRGVLHNTFSVP
KEPGLSNFLMGMVSFEELLNETHVPNLTVVSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGT
QVDGVTLIVRAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHEGYSYYHY
>gnl|bykdb|A0A496TPL0 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=764 residues).
MQNVNGTFSGLEENPVRLTDYLRILRRGKWIIILSFVAVVGSTAYFSFTTTPTYEAQCMVIVDSQSRVERTLFDVGPFSQ
QVTMINNQVQILKSRLLAEKVISSLLESGLQDSLSLFRVENPEDLHVGYRRYFVRHLQEALSIEPVRDTDVIKIKVKAPS
PQEAAFLANKVAEVYQNLDREFSRGEISQVVTFLRDQLQKKEESLRAAEEALRKFQQDEGIVALSQETQEMVKQLVEFES
LYQEAVTDRKTYEKRLEYLKSQLGELRRTLETDLADISHPLILELRQKIAESEAKLVNFKAQGIPESYPDFKKENERLAS
LKRTLTEETKKVLLARYPVHDPLKPYQEILEKIITAETEVEALQAKEDALKKIVDQHLLKLDTLPEKSLKLARLERAKKL
NENLYMMMKEKYEESRITRAGQIGKIRIVDPAVPPEFPISPKKKLNLILATLVGLGLGIGVVFFLEYLDNSVRTVEDVER
LQLPLLGSIPDIEPEKQNGLWRALPKKKGSEDEVGRLATRLVTHLKPKSPYSEAYRSLRTQIQYARSEKPVQTILVSSPG
PGEGKSTSVTNLAITMAQMGSKTILVDSDLRRPVLHSLFDLKRDVGLSNYLVGRAEIEEVIRPTSVDNLYLISCGILPPN
PSELLGSKRMQELIQQLKNEYDYVLFDSPPLIAVTDAVVMAPWVDGVVLVLRSGKTDRDAAVRAFELLRNVKANVLGTLL
NDVLPSYMYGSYYYYYYYYYYSSEDGKTKKRKKKHHHHTQLYTS
>gnl|bykdb|A0A496TXX1 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=775 residues).
MDAEKFFLEDIQQEEEEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYVKKQPPQYEASALIRFKTYGSDNVGLLNETR
ITELTSRTFAEKVVAQLGLTLEMLAETKERPLRRQKVFEQFSTTTDPISGEYLLEFKDDVFSLFQLNELDKAPRLLVSDS
LSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRKQIKVRFNRTGTLMWVSLTDRDPSLVATMVNQLAQM
YVEESKFFSLKKVKDVKEVVENQLKIAKENLDKANEELKRFKESHFISLDTEVKQNVNELSDLENEIRTIKENIESLSLL
LRRLEKSFETTEASETRYIYRQIARHPAFQQDPNMGILQQQLADLESQRDQLLTRVTESHQDVVEINAQIKFIQLQIKDL
AKKRLEQLYEELATAERTASNLRYKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQEAQISEAVRTEEISILDPALPP
EYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSIPKIEFDHEYELKDADKIKQIDAQLV
TYDYSPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTLAQHKTNTLLVDADLRRGVLHNTFSVP
KEPGLSNFLMGMVSFEELLNETHVPNLTVVSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGT
QVDGVTLIVRAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHEGYSYYHY
>gnl|bykdb|A0A496U1T9 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=775 residues).
MDAEKFFLEDIQQEEEEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYVKKQPPQYEASALIRFKTYGSDNVGLLNETR
ITELTSRTFAEKVVAQLGLTLEMLAETKERPLRRQKVFEQFSTTTDPISGEYLLEFKDDVFSLFQLNELDKAPRLLVSDS
LSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRKQIKVRFNRTGTLMWVSLTDRDPSLVATMVNQLAQM
YVEESKFFSLKKVKDVKEVVENQLKIAKENLDKANEELKRFKESHFISLDTEVKQNVNELSDLENEIRTIKENIESLSLL
LRRLEKNFETAEASETRYIYRQIARHPAFQQDPNMGILQQQLADLESQRDQLLTRVTESHQDVVEINAQIKFIQLQIKDL
AKKRLEQLYEELATAERTASNLRYKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQEAQISEAVRTEEISILDPALPP
EYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSIPKIEFDHEYELKDADKIKQIDAQLV
TYDYSPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTLAQHKTNTLLVDADLRRGVLHNTFSVP
KEPGLSNFLMGMVSFEELLNETHVPNLTVVSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGT
QVDGVTLIVRAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHEGYSYYHY
>gnl|bykdb|A0A660YJ49 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=766 residues).
MEEFFDEPQVEQSSVDLTRFVRAIFKSWWFIGIVTVVISVPWLYYVKTQPPLYEATALITFDNVKDISPTKIENRILRLK
SRSFAEEVTADLGLTLKMKKENHLPPLKRHEVFSHFSTTHNPVPGDYKLRFYPTGYCAFYYNNVRLDSLHVSNFVSDTVF
YNGLRFSLRDDVVGRRSVIRFTINPFQATVNSLRSREKITNSRTGNLMKITLKDTNPVLASRTVNRLANIFVEKSMAMNR
EEATLLSSHLQKELKVAKEELNKSDYALKRFRKQHPVSLSKQNENTVNKLNTLELAIKSNNLAKRGLEMLLRKLDPNVTD
ITSGISARYVYRQIPQLPIFQDDPAMSILSRNLTDLDRARNNLIKNGFPVNNPDVIEISERISTLENRIYDMAVNKVKEL
EKANSDMQQQISDLKGLLDVLPDEENRLINLTRERDTNEELYNMVLKRFKEAQISAASVTEQVNVLDPAVPPNAPISGSK
KIKAIIGILFGLFLGIGAVVTKELLDKSVKTPEDVKNYLNLSILGVIPTVTFKNLDLPDDEKAKSISSQIVTHDYSPTPV
GEAYRSLRTSLLYSKRYGKIKTLVIGSAAPGEGKSFTAANLAITMAQQKSKTLLIDADLRRGVLHNTFDCPKKPGFTNFL
SGTATLSNVMYDTYIPNLSLITCGTLIPNPSELLGSDRMKEFIKVVSEEFDFVIFDTPPLMAATDAVILGTLVDGVAVII
RSGMTNRENIKRKLELFETVQTTVVGAVLNCAGVDVAHEGYSYYRY
>gnl|bykdb|A0A660YPG8 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=745 residues).
MENFQEEQQLTLQDYLSIIYRGRWIIIISFLAVMISTIYFTFTAKPVYESSATVMIKQEGSVQQQLFDVGSFMKQETMIN
NQREILTSRTLAEMVIKKLQNSPYADSLEVLGNGPDSKRKSFMGLILSLFKKGDENEPEPFNNLVRNFREGVITVLPKRD
TDIIELKAKAGTPFEAALIANTWMEAYRELDVSESRSEVTGVRQFLQEQLEKVQKELAVSEEALKEYKEKEGVTALTAET
EQLIQNLAQFESLYRSAQTDLQANEKRLEYLKEQLGENKKNFLSSNLSSPVIEELQKQMGQLIADIAAYRQQIESSSLSD
NKKYLSLLQEKESRLKGIQSKIVEEKKKIIETGMGSLNPMAVSETLLTNILTLETENTALKARTRELRSIVRQYNKRLNK
LPDKSLRLARLTREATVNNNIFMMLRTKYEENRIAEAGQIGLVRIVDRATPPERPISPKKKMNLLLGFFLGLGLGLGIVF
TMEYLDTSLKTVEEVERRGIPVLGSVPLISPKNLAHSLNGNNGEAKQIKSRLITHFEPKSPISESYRTFRTNVQYTKVDN
PVKTIVITSAGPGEGKSTTAANLAIAFAQMGVKTLIVDTDLRRPVQHGIFGVQRGEGFTNVLYGKVNLSDAVRDTEIDNL
QLLTAGVLPPNPSELLASEAMEKFLKDVNSKFGMVIFDSPPVIAVTDAAVLSAMLDGVILVVKSGTTKDDALTRAKILLN
NVNAEFLGVLVIGIDINRMYGSYYY
>gnl|bykdb|A0A660YT75 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=764 residues).
MQNVNGTFSGLEENPVRLTDYLRILRRGKWIIILSFVAVVGSTAYFSFTTTPTYEAQCMVIVDSQSRVERTLFDVGPFSQ
QVTMINNQVQILKSRLLAEKVISSLLESGLQDSLSLFRVENPEDLHVGYRRYFARHLQEALSIEPVRDTDVIKIKVKAPS
PQEAAFLANKVAEVYQNLDREFSRGEISQVVTFLRDQLQKKEESLRAAEEALRKFQQDEGIVALSQETQEMVKQLVEFES
LYQEAVTDRKTYEKRLEYLKSQLGELRRTLETDLADISHPLILELRQKIAESEAKLVNFKAQGIPESYPDFKKENERLAS
LKRTLTEETKKVLLARYPVHDPLKPYQEILEKIITAETEVEALQAKEDALKKIVDQHLLKLDTLPEKSLKLARLERAKKL
NENLYMMMKEKYEESRITRAGQIGKIRIVDPAVPPEFPISPKKKLNLILATLVGLGLGIGVVFFLEYLDNSVRTVEDVER
LQLPLLGSIPDIEPEKQNGLWRAIPKKKGSEDEVGRLATRLVTHLKPKSPYSEAYRSLRTQIQYSRSEKPVQTILVSSPG
PGEGKSTSVTNLAITMAQMGSKTILVDSDLRRPVLHSLFDLKRDVGLSNYLVGRAEIEEVIRPTSVDNLYLISCGILPPN
PSELLGSKRMQELIQQLKSEYDYVLFDSPPLIAVTDAVVMAPWVDGVVLVLRSGKTDRDAAVRAFELLRNVKANVLGTLL
NDVLPSYMYGSYYYYYYYYYYSSEDGKTKKRKKKHHHHTQLYTS
>gnl|bykdb|A0A661X6L5 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=756 residues).
MESKVPNMPDMNDFEDQEQPLQLSDYLRIMYRGRWIITFSFIAVFIATLIYTFKTPPTYEATTTLLIETNNSVEQSLFNL
TSFGNQANMLTNQMEILKSRNIAERVVRNLEKSDVRDSISFFQPLEDGTELTFNDRVEIVMKSMDVEPKRDTDILTLKYQ
AGSPFEAAYIANVIAQEFAKQNAETNRLEVTEMRKFIEGRLRIKAKELKESEERLRNFQQREKIASLDAETTQLVEQLSQ
AESMLEEARIDLQTKQQLLNNVNKLLDERKKALGVNLTETSTPYIQALQQELADAEAKKVIYLSAIKASVQEGQAVYFDD
QLKQYDEKIKALREQLNKEAQKLVASGMVSDPLKISEDLVAKSITLTGEVDAAKAKITALRGVLDKYNARMKELPDKVLQ
LARLERRRQVDEQTYIMLTQKLEEAKIQESAQARNVRIIDKAIKPQKPVKPNKKMNIMLGILLGLGLGIGITFMMEYLDR
SVRKPEDVERLGVNVLATIPKIELDKVEKAKQRLNEGHRVESRLITHIDPKSPVSEAYRTLRTNLQFSKVEKELRTILVT
SAGPKEGKSTTASNLAIAMAQAGNSVVLVDADLRRPLIHSVFGLDKDQGLTNYLAGSLPYEQLLHESFIENLKIVPSGVL
PPNPSELLATNKMKDLLKKLQDDFDIVIIDSPPVIAVTDASILSTIVDGTLLVVYAGQTERDAIKRAIMMLSSVSARLLG
TVLNGFDVQGIYGSYYYYYYHHYYGPSKKKKSRRFF
© 1998-2020Legal notice