BYKdb

Dataset for cluster orphancd of phylum thermodesulfobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A496QKU4      MGKIADALDKARREPARKKDQLRPAGETRSREQKQARVQHEVSPKPVYPDTNVSKTDIQT
A0A6G7PUV0      MGKIADALEKF------------------NREKKTPLSTHSIHPE------GPPKKEGAG
                ********:*                   .**:* .   *.: *:      . .*.:   

A0A496QKU4      GEEAGFVSEAL--QGPVDPKLVVFHEPESPAAERFKVLRSQILYPKDGKDRRVILVTSAM
A0A6G7PUV0      GKDPSEASTSVPGTGALDPRLIVFTQPRSLASEHFKLLRARLINPRQGPVPRVVMVSSAM
                *::.. .* ::   *.:**.*:** :* * *:*.**:**:.:: *.:*   **::*:***

A0A496QKU4      EAAGKTMVACNLAVSIAQGVDPYALLIDTDIRKASVHRMLGFEPAEGLSEYLQTDEPLSK
A0A6G7PUV0      DKEGKSFVAANLAASVAQSLEYHALLIDCDLRKPSAHIYYGQNNDEGLSDYLQGRTPLPR
                :  **::**.***.*:**.:: :***** *:**.*.*   * :  ****:***   **..

A0A496QKU4      YLIRTPMMKLTVLPAGRSVRNPAELLNSDKMRHLFEEARERYPDRFIIVDSPPVNLAAET
A0A6G7PUV0      LLKRPPVEKLSLLTAGPPPNKPSDLLSSARMADLIEEVRSRYPDRLVILDTTPVQLTSEP
                 * *.*: **::*.** . .:*::**.* .*  *:**.*.*****::*:*:.**:*::*.

A0A496QKU4      SSLAQNVDAVVFVVRYGYSNQDLIEEAIAKVGEDKVLGIVFNCFESTPGKYSYYKKK--Y
A0A6G7PUV0      VNLARFVDTVIFVVRYGKSKRELVEDSIERLGRGKILGVVFNAFEIPPRKYSYFRSKKYY
                 .**. **:*:****** *:.:*:*::* .:* .*:**:***.** .* ****:..*  *

A0A496QKU4      PYYSSREQT
A0A6G7PUV0      GYYG-----
                 **.     

© 1998-2021Legal notice