BYKdb

Dataset for cluster orphancd of phylum thermodesulfobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A496QKU4      MGKIADALDKAR--REPARKKDQLRPAGETRSREQKQARVQHEVSPKPVYPDTNVSKTDI
A0A6G7PUV0      MGKIADALEKFNREKKTPLSTHSIHPEGPPKK--------EGAGGKDPSEASTSVP--G-
A0A7C7RKI0      MSKLEKALEKAKQTRDTGTDADTVVS-GRPAP--------AGPVCLDPDYVHTRICKLD-
                *.*: .**:* .  ...  .   : . * .                .*    * :   . 

A0A496QKU4      QTGEEAGFVSEALQGPVDPKLVVFHEPESPAAERFKVLRSQILYPKDGKDRRVILVTSAM
A0A6G7PUV0      -------------TGALDPRLIVFTQPRSLASEHFKLLRARLINPRQGPVPRVVMVSSAM
A0A7C7RKI0      -------------EASMQKEGLLSPYCHPVIMEQFNLVKSKLIDRMNPDGYRSLLVASPK
                              ..::   ::     .   *.*:::.:.::   :    * ::*:*. 

A0A496QKU4      EAAGKTMVACNLAVSIAQGVDPYALLIDTDIRKASVHRMLGFEPAEGLSEYLQTDEPLSK
A0A6G7PUV0      DKEGKSFVAANLAASVAQSLEYHALLIDCDLRKPSAHIYYGQNNDEGLSDYLQGRTPLPR
A0A7C7RKI0      QDDGKTLTAVNLAISLTRDKTRTVMLIDTDFRRPSVTGYFGIEDGRGLYDHLSESVPLSE
                :  **::.* *** *::..    .:*** *:*..*.    * :   ** ::*.   **. 

A0A496QKU4      YLIRTPMMKLTVLPAGRSVRNPAELLNSDKMRHLFEEARERYPDRFIIVDSPPVNLAAET
A0A6G7PUV0      LLKRPPVEKLSLLTAGPPPNKPSDLLSSARMADLIEEVRSRYPDRLVILDTTPVQLTSEP
A0A7C7RKI0      LLINPGIPRLTILPAGTIKDHPADFLSGPAMHSFVTEVKKRYTDRFIIFDSPPLLAFSDG
                 * .. : .*::*.**    :*:::*..  *  :. *...**.**::*.*:.*:   :: 

A0A496QKU4      SSLAQNVDAVVFVVRYGYSNQDLIEEAIAKVGEDKVLGIVFNCFESTPGKYSYYKKK--Y
A0A6G7PUV0      VNLARFVDTVIFVVRYGKSKRELVEDSIERLGRGKILGVVFNAFEIPPRKYSYFRSKKYY
A0A7C7RKI0      FELSSYVDGVLMVIRSQKTTSEDLKHALEILKGRRIFGTILNRVS-----KNGLPIKDYK
                 .*:  ** *::*:*   :. : :: ::  :   .::* ::* ..      .    *   

A0A496QKU4      PYYSSREQT
A0A6G7PUV0      GYYG-----
A0A7C7RKI0      KYYK-----
                 **      

© 1998-2021Legal notice