BYKdb

Dataset for cluster tadcd of phylum spirochaetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N1RHF1      ----MDSMNMAQQIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A2N1RZJ4      ----MDSMNMAQQIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A3D1WX44      ----MDSMNMAQQIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A2N1SPK0      ----MDSMNMAQQIPDDEMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPM
A0A3C1LV35      MDRKEEAKVRSVNYAEKQAEQEISITQILGIIKQRRVWVYVFFVLACALAVFYLKITDPS
A0A1V5RSB2      MNQAYDDQYTVHQ---QFDEEGMTIRELLSIFRKRFFWFLLGLVLVSGAAVGYLFWATPL
A0A521IS38      MNQAYDDQYTVHQ---QFDEEGMTIRELLSIFRKRFFWFLLGLVLVSGAAVGYLFWATPL
G8QXQ5          MNENTETQTGQNIY--DNNDEGISLSELLKIFKHHFKWFLFGFFLVVGMAVVYLQLAIPQ
A0A372MIZ7      MSQQEEYAQSTSPF--DAGEEGISIAELLHIFHKRLRWFFVGFILVVALALGYLQIAIPQ
A0A356E0K2      MSQQEEMQNTLAPY--DSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAIPQ
A0A3C1ZMS7      MSQQEEMQNTLAPY--DSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAIPQ
A0A375AMC2      MSQQEELQNTLAPY--DSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAVPQ
F0RTV6          MSQQEELQNTLSPY--DSGEEGISIAELLHIFRKRFRWFVIGLIVVMGLAVGYLQIAVPQ
                     :          .  :: ::: ::* *:. .  *. . :.:. . *: **  . * 

A0A2N1RHF1      YESEVTILVDSLQKGTDFESML-LGQSTAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A2N1RZJ4      YESEVTILVDSLQKGTDFESML-LGQSTAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A3D1WX44      YESEVTILVDSLQKGTDFESML-LGQSTAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A2N1SPK0      YESEVTILVDSLQKGTDFESML-LGQSTAKISTEVELTLSRSNIESALAKLDLSRYRTED
A0A3C1LV35      YQASATALVEPISNATSIESLLTSSTSSTKIDTEIQLITSSSNLQNALDKLDLTKYLDPD
A0A1V5RSB2      YESQVSVLVNPIQNSSSIDSLLSVTSSGAKIATEVELITSRSNINEALARLDLTRYENDE
A0A521IS38      YESQVSVLVNPIQNSSSIDSLLSVTSSGAKIATEVELITSRSNINEALARLDLTRYENDE
G8QXQ5          YESGVSVLVDPIQKSSSIENLLESSASSTKIATEVELITSRKNIEFALSTLDLDSYKNAE
A0A372MIZ7      YESEVSVLVDPIQTSSSFESLMDMSASSTKIATEVELITSRSNIDYALSTLDLSQYKNAD
A0A356E0K2      FESQVSVLVEPIQRSSSFESLLNVSASTTKIATEVELITSRKNIEYALGTLDLASYRNAD
A0A3C1ZMS7      FESQVSVLVEPIQRSSSFESLLNVSASTTKIATEVELITSRKNIEYALGTLDLASYRNAD
A0A375AMC2      YESQVSVLVEPIQRSSSFESLLDVSASTTKIATEVELITSRKNIEYALGTLDLSSYHSSD
F0RTV6          YESQVSVLVEPIQRSSSFESLLDVSTSTTKIATEVELITSRKNIEYALSTLDLASYHNAD
                ::: .: **:.:. .:.::.::    * :** **::*  * .*:: **  ***  *   :

A0A2N1RHF1      GVSYAGEGIVGN-IKGRTSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSIA
A0A2N1RZJ4      GVSYAGEGIVGN-IKGRTSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSIA
A0A3D1WX44      GVSYAGEGIVGN-IKGRTSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSIA
A0A2N1SPK0      GVSYAVEGIVGN-IKGRTSVTTVKDTNIVRITVTDQDPTFARDFANALAESYNELLGSIA
A0A3C1LV35      GIPYSEKKLKGSSFSKVVSVSTVSSTKVVKITVEDGNPQFCADYANAILEAYTEMLTRIS
A0A1V5RSB2      GESYAADIAFPNSVKEKISVTTVKDTNIVRISVTDANRFFARDFANVLAESYDSMLTSIA
A0A521IS38      GESYAMNIAFPNSVKEKISVTTVKDTNIVRISVTDANRFFARDFANVLAESYDSMLTSIA
G8QXQ5          GDSYSNREVLGN-VKDRIVVSTVKDTNIVKIVVTDASPMFARDLANALASSYDGLLTGIA
A0A372MIZ7      GFDYRDKLVLGN-LKERIAVTTVKDTNIVRIKITDENPVFARDFANALASSYDTLLTGIA
A0A356E0K2      GMDYRSKDVLGD-VKERIVVSTVKDTNIVRITVTDANPAFARDFANALATSYDSLLTGIA
A0A3C1ZMS7      GMDYRSKDVLGD-VKERIVVSTVKDTNIVRITVTDANPAFARDFANALATSYDSLLTGIA
A0A375AMC2      GIDYRSKEVLGN-VKERIVVSTVKDTNIVRIAVTDANPAFARDFANALAASYDSLLTGIA
F0RTV6          GVDYRSKEALGN-VKERIVVSTVKDTNIVRIAVTDASPAFARDFSNALAASYDSLLTGIA
                *  *       . ..    *:**..*::*.* : * .  *. * :*.:  :*  :*  *:

A0A2N1RHF1      RNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRRE
A0A2N1RZJ4      RNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRRE
A0A3D1WX44      RNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRRE
A0A2N1SPK0      RNNKTIQKEFIQSQIPINEQQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRRE
A0A3C1LV35      KNSKSAQREFLETQIPETEALLDEASEKLADFKETSGIMQMTQKNTLLTSKIAAFQLEKA
A0A1V5RSB2      RNSKTAQRTFIESQIPINDQALREANDRLGDFKERSEIIQLSDKSSLLVNQISYYDLRLE
A0A521IS38      RNSKTAQRTFIESQIPINDQALREANDRLGDFKERSEIIQLSDKSSLLVNQISYYDLRLE
G8QXQ5          KNSKTAQREFIDAQIPINQKMLVLASDALGDFRENSDIIQLTDKSTLLVNEISYYKLRLE
A0A372MIZ7      KNSKTAQREFIESQIPINDRALSAAGDALGDFRENSDIIQLTDKSSMLVEQISYYTQRLE
A0A356E0K2      KNSKTAQREFIESQIPINDRELSRASDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLE
A0A3C1ZMS7      KNSKTAQREFIESQIPINDRELSRASDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLE
A0A375AMC2      KNSKTAQREFIESQIPINDRELSKAGDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLE
F0RTV6          KNSKTAQREFIESQIPINDAELSNASDSLGDFRENSDIIQLTDKSSLLVEQISYYTLRLE
                .*.*: *. *:::*** .:  *  * : *. *.* *  :*:::*..:* .:*: :     

A0A2N1RHF1      PLALQLKEADLIIQAHEETLSSFALETP-GYDEVLADIDMGNLLESYMQRSRELIMYEAI
A0A2N1RZJ4      PLALQLKEADLIIQAHEETLSSFALETP-GYDEVLADIDMGNLLESYMQRSRELIMYEAI
A0A3D1WX44      PLALQLKEADLIIQAHEETLSSFALETP-GYDEVLADIDMGNLLESYMQRSRELIMYEAI
A0A2N1SPK0      PLALQLREADLIIQAHEGTLSSFALETP-GYDEVLADIDMDHLLESYMQRSRELIMYEAI
A0A3C1LV35      PLSLQLVEVESLLASLNSD------GSLMAVETIAQNDAVRVSLEEYVSNSKELMMYQNV
A0A1V5RSB2      PLKLQLEEAYIGFRSHEPFIAASGTTSDQLLTTIRSDEEISKKLSELESWLLELAMYESL
A0A521IS38      PLKLQLEEAYIGFRSHEPFIAASGTTSDQLLTMIRSDEEISKKLSELESWLLELAMYESL
G8QXQ5          PLKLQMQEASVFIQNYNQGLVNAGIKGILTLDELGNDVKIKAKLKELNGWKTELTMYESL
A0A372MIZ7      PLKLQLREAMVFLDSYNEGLTQAGVTGVLSLDDVRRDPVIAEKLNDLAAWKTELTMYESL
A0A356E0K2      PLKLQLRESEVFIDTYNASLKQAGVEGVLTLDQIKKDSVVMAKLSDLSAWKTELTMYESL
A0A3C1ZMS7      PLKLQLRESEVFIDTYNASLKQAGVEGVLTLDQIKKDSVVMAKLSDLSAWKTELTMYESL
A0A375AMC2      PLKLQLKESEVFIDSYNASLKQAGIDGVLTLEQIKNDSVIISKLADLSAWKTELTMYESL
F0RTV6          PLKLQLKESQVFIESYTNSLKAAGIAGVLALDQIKNDSVVMAKLADLGAWKTELTMYESL
                ** **: *    :                    :  :  :   * .   .  ** **: :

A0A2N1RHF1      QEGVPEG-----------SDRLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTSQ
A0A2N1RZJ4      QEGVPEG-----------SDRLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTSQ
A0A3D1WX44      QEGVPEG-----------SDRLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTSQ
A0A2N1SPK0      QEGIPEG-----------SERLFVLQSALNQLSKSLLDRVTLLVAPRGLSTDPFIMVTSQ
A0A3C1LV35      DATA-------------SSSRVYVLESSLASNEKNVLNAVTEIVGS-E----------NT
A0A1V5RSB2      PTNLGQG-----ALSEGTLARIFTINNAIDTTKKSLLNRVRKLIECCY----------ID
A0A521IS38      PTNLGQG-----ALSEGTLARIFTINNAIDTTKKSLLNRVRKLIECCY----------ID
G8QXQ5          SSPQIGTSAT--SLSSNNSSRVYFLNSAIEQITKDLLDRVSVLTSAYA----------NE
A0A372MIZ7      GNSSAPQTQV--SMPMDASSRTYVISSAMNQLNKDLLDRVSLLTRSYG----------NE
A0A356E0K2      SNLAGNASTAAPSTTLDSSSRIYVINSAINQVTKELLNRVADLTRSYA----------NE
A0A3C1ZMS7      SNLAGNASTAAPSTTLDSSSRIYVINSAINQVTKELLNRVADLTRSYA----------NE
A0A375AMC2      SNPARNTATLAPSTTLDSSSRTYVISSAISQVTKELLNRVASLTKKYA----------NE
F0RTV6          SNPAGNTATVAPSTVLDSSSRTYVISSAISQVTKELLNRISTLTRSYG----------NE
                                    * : :..::    *.:*: :  :                 

A0A2N1RHF1      ELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLMEL
A0A2N1RZJ4      ELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLMEL
A0A3D1WX44      ELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLMEL
A0A2N1SPK0      ELAKAMHQRAMTEAKMSVLESIEMTYSDELSHLPILERQLLDLQRDVQVYETLRMRLMEL
A0A3C1LV35      MYAKAITEYLCVKASISAIDNIIESYNEELSDYPIMERQYLELQRDVEIYEQLLLSLRQL
A0A1V5RSB2      SLAQNIAQILTTGVSIDILQSRAAVFEEELSRLPLLERTLSELLRDVQISEAIGLKLREM
A0A521IS38      SLAQNIAQILTTSVSIDILQGRAEVFEEELSRLPLLERTLSELLRDVQISEAIGLKLREM
G8QXQ5          SNTQSIVQLLTTEVAIQVLEERGAQFTNELSQLPVLERQLSELQRDVQIYETIDLKLRDM
A0A372MIZ7      SYTQAIVQALTTEVGIQVLEERGEVFISELSQLPVLERRLSELQRDVQIYEAIGLKLREM
A0A356E0K2      ANTQAIVQALTTEVGIQVLQQRGAVFVEELSQLPVLERRLSELQRDVQIYEAIGLKLREM
A0A3C1ZMS7      ANTQAIVQALTTEVGIQVLQQRGAVFVEELSQLPVLERRLSELQRDVQIYEAIGLKLREM
A0A375AMC2      ANTQAIVQALTTEVGIQVLQKRGAVFVEELSQLPVLERRLSELQRDVQIYEAIGLKLREM
F0RTV6          AYTQAIVQALTTEVGIQVLEMRGEVFVEELSQLPVLERKLSELQRDVQIYEAIGLKLREM
                  :: : :   . . :. ::     : .***  *::**   :* ***:: * : : * ::

A0A2N1RHF1      LEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALLV
A0A2N1RZJ4      LEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALLV
A0A3D1WX44      LEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALLV
A0A2N1SPK0      LEEVKIAEAAVAGSVTVVDPAIVTANREGTAIPVSPNKMLILAVSVLLGGALGILLALLM
A0A3C1LV35      LEETKMVEAAVVGNVNVIDEAVVPIR------PVSPKKLMVMAIAVVGGVVLGVLFGLFL
A0A1V5RSB2      LEEIKLLEASVSGNVKVIDTANLPLK------PVSPNSLLILAVALLLGSAIGLLLALLV
A0A521IS38      LEEIKLLEASVSGNVKVIDMANLPLR------PVSPNSLLILAVALLLGSAIGLLLALLV
G8QXQ5          LEEVKLVEAAVTGNVTVVDQANIPLN------PVSPNKLLILAVALLLGCAVGLLFALGI
A0A372MIZ7      LEEVKLVEASVSGNVTVVDEAILPRN------PVSPNRVLILAVALLLGAAFGLLLTLAI
A0A356E0K2      LEEVKLTEAAVTGNVTVIDAANLPLN------PVSPNKLLILAVALLLGAAIGLLLTLGI
A0A3C1ZMS7      LEEVKLTEAAVTGNVTVIDAANLPLN------PVSPNKLLILAVALLLGAAIGLLLTLGI
A0A375AMC2      LEEVKLTEAAVTGNVTVVDAANLPLN------PVSPNKLLIIAVAMLLGAAIGLLLTLGI
F0RTV6          LEEVKLTEAAVTGNVTVVDAANLPLN------PVSPNKLLILAVAMLLGAAIGLLLTLGV
                *** *: **:* *.*.*:* * :. .      ****: ::::*:::: * ..*:*: * :

A0A2N1RHF1      EMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQD--LDIPSLVVHNDPLSFESERYKLI
A0A2N1RZJ4      EMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQD--LDIPSLVVHNDPLSFESERYKLI
A0A3D1WX44      EMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQD--LDIPSLVVHNDPLSFESERYKLI
A0A2N1SPK0      EMLDVTIKDEGTLRKLAGPNRPLLGWIPLMSFNQD--LDIPSLVVHNDPLSFESERYKLI
A0A3C1LV35      EFIDDSIRSEDSIKQILGSEIPSLGWTPYVKNVEKIQKEIPALYVFNDPDAAVSERFKSI
A0A1V5RSB2      ESLDTSIQNEEQVQRIVGRNAPMLGWVPIMKTYQK--DVYPMFMVRTHPNSFEAERLKLI
A0A521IS38      ESLDTSIQNEEQVQRIVGRNAPMLGWVPIMKTYQK--DVYPMFMVRTHPNSFEAERLKLI
G8QXQ5          EASDQTIRNEAQIKKLVKNAIPLLGWLPLMKVSPK--DKYPMFSVFNDPLSFEAERFKLI
A0A372MIZ7      EALDVSIQTEQQIQKIVGKDVPLLGWIPMMKVSNL--DLYPTLIVYNDPLSFESERFKLV
A0A356E0K2      EALDVSLQSEQQIQKIVGNDVPILGWIPMMKVSEK--DKYPTLSVYNDPLSFESERFKLI
A0A3C1ZMS7      EALDVSLQSEQQIQKIVGNDVPILGWIPMMKVSEK--DKYPTLSVYNDPLSFESERFKLI
A0A375AMC2      ETLDVSIQSEQQIQKIVGKDVPILGWIPMMKVSDN--DKYPTLSVYNDPLSFESERFKLV
F0RTV6          ETLDVSIQSEQQIQKIVGKEIPILGWIPMMKVSEN--DKYPTLSVYNDPLSFESERFKLV
                *  * ::. *  :..:     * *** * :.         * : * . * :  :** * :

A0A2N1RHF1      ANNVSFGTMRNNQ-RIFSITSPGMGEGKTSATANIATSMAMNGLKVLVIDGDLRLPQLET
A0A2N1RZJ4      ANNVSFGTMRNNQ-RIFSITSPGMGEGKTSATANIATSMAMNGLKVLVIDGDLRLPQLET
A0A3D1WX44      ANNVSFGTMRNNQ-RIFSITSPGMGEGKTSATANIATSMAMNGLKVLVIDGDLRLPQLET
A0A2N1SPK0      ANNVSFGTMRNNQ-RIFSITSPGMGEGKTSATANIATSMAMNGLKVLLIDGDLRLPQLET
A0A3C1LV35      ANNIVYS--LPKKIQVLSINSTEMGEGKTTAICNVATAYALSGKKVLLIDGDFRKPAIEA
A0A1V5RSB2      A-NMIYS--MDGK-KVFSITSSSMAEGKSMIVANISLALAQLGNKVLVVDGDLRLPSMER
A0A521IS38      A-NMIYS--MDGK-KVFSITSSSMAEGKSMIVANISLALAQLGNKVLVVDGDLRLPSMER
G8QXQ5          S-NMLYN--KHDM-KVFSITSCSMAEGKSTIVANVALSLAQMGKKVLIIDGDLRLPSMER
A0A372MIZ7      A-NMLYN--RSEK-HVFSITSCSMAEGKSTIIGNIAVALAQMGSKVLIIDGDLRLPSMER
A0A356E0K2      A-NMLYN--KTDK-KVFSITSCAMAEGKSTIIGNIALALAQMGSKVLIIDGDLRLPSMER
A0A3C1ZMS7      A-NMLYN--KTDK-KVFSITSCAMAEGKSTIIGNIALALAQMGSKVLIIDGDLRLPSMER
A0A375AMC2      A-NMLYN--KTDK-KVFSITSCAMAEGKSTIIGNVALALAQMGSKVLVIDGDLRLPSMER
F0RTV6          A-NMLYN--KTDK-KVFSITSCAMAEGKSTIIGNMALALAQMGSKVLVIDGDLRLPSMER
                : *: :.       .::**.*  *.***:    *:: : *  * ***::***:* * :* 

A0A2N1RHF1      FFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A2N1RZJ4      FFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A3D1WX44      FFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A2N1SPK0      FFNLKKSPQGLVDVATTDISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEML
A0A3C1LV35      FFCLKRSKLGFVDAIVDDVPLEKCIVRPLAQVPNLHLMPPGKGTRNPNALYNSPKADAVL
A0A1V5RSB2      FFRLEHQSVGLVDAVTSGVSLEDCIVQPLEDVSTLHLLPAGSSPLVPAAIFSNPRYISWT
A0A521IS38      FFRLEHQSVGLVDAVTSGVSLEDCIVQPLEDVSTLHLLPAGSSPLVPAAIFSNPRYISWT
G8QXQ5          FFLLKHSESGLVDYVINSVPLERSIVQPLDSVPNLHLLSSGSTPLVPAAIFSNPNYIETL
A0A372MIZ7      YFHLKHREVGLVDYVTKNATLEACILKPIEKVPGLHLLPPGNAPLVHAGIFSNPRYTRLI
A0A356E0K2      YFRLKHREVGLVDFVTKKTKLEECLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGL
A0A3C1ZMS7      YFRLKHREVGLVDFVTKKTKLEECLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGL
A0A375AMC2      YFRLKHREIGLVDFVTKKTRLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGL
F0RTV6          YFRLKHREVGLVDFVTKKARLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGI
                :* *:.   *:**       :*  ::.*: . . ***:..*  .    .::...      

A0A2N1RHF1      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGIN
A0A2N1RZJ4      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGIN
A0A3D1WX44      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGIN
A0A2N1SPK0      DHLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGISTKGGLRELLDNLDLAGIN
A0A3C1LV35      AKLKAVYDYIIIDCPPISYGSEFTHLARHLDGFVINVRAGVSSKRALSSFMSELDFINAP
A0A1V5RSB2      KMLSNIYDYIIIDAPPLDAASELLAIAKHVDGLIITVRAGVTSRIALRDLLESLINANVQ
A0A521IS38      KMLSNIYDYIIIDAPPLDAASELLAIAKHVDGLIITVRAGVTSRIALRDLLESLINANVQ
G8QXQ5          KHLKTLYDFIIIDAPPLDSASELLTISKNIDGLIITVRAGVTSKLSLIDLVDNLKTGNAP
A0A372MIZ7      SYLESVYDFVIIDAPPLDSASELLSISKHVDGLIITVRAGITSKGSLFDLISSLRTANVP
A0A356E0K2      QYLEKLYDFIIIDAPPLDSASELLSISKHVDGLIITVRAGISSKGSLYDLVSNLRTANAP
A0A3C1ZMS7      QYLEKLYDFIIIDAPPLDSASELLSISKHVDGLIITVRAGISSKGSLYDLVSNLRTANAP
A0A375AMC2      SYLENLYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLYDLVSNLRTANAP
F0RTV6          AYLENLYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLFDLVSNLKTANAP
                  *  :**:::** **:  .**:  ::.::**: :.****:::. .* .::..*   .  

A0A2N1RHF1      VLGVIFNGVIESKMGG----HYS-------SGRYYTYQGSSYAKRYYSSRYNTGDKEGKK
A0A2N1RZJ4      VLGVIFNGVIESKMGG----HYS-------SGRYYTYQGSSYAKRYYSSRYNTGDKEGKK
A0A3D1WX44      VLGVIFNGVIESKMGG----HYS-------SGRYYTYQGSSYAKRYYSSRYNTGDKEGKK
A0A2N1SPK0      VLGVIFNGVIESKMGG----HYS-------SGRYYTYQGSSYARRYYSSRYNTGDKEGKK
A0A3C1LV35      LLGYIYYGVIARNQSSYSNYGYGSYYGNKKYGYGYGYGYGNKKSMYEEGKGN--------
A0A1V5RSB2      LAGFVFNGVMPSKHSRYGTYGYS-------VSYKMGKTERKFGRKYRYLP----------
A0A521IS38      LAGFVFNGVMPSKHSRYGTYGYS-------VSYKMGKTERKFGRKYRYLP----------
G8QXQ5          ILGIVFNGCSAGTTNS---------------GYHYGNYYNSYAYRYNSYQNNNSKKGLKL
A0A372MIZ7      ISGVVFNGVVPGSVGTGYRYGYG-------YGYGKGYGYSSYASRYSAMGSSGTLKKRRK
A0A356E0K2      LIGFVFNGVIPGATSS---YGYG-------YGRNYGYGYS--AYRYGYAQGQGTAKKK-K
A0A3C1ZMS7      LIGFVFNGVIPGATSS---YGYG-------YGRNYGYGYS--AYRYGYAQGQGTAKKK-K
A0A375AMC2      LIGFVFNGVIPGTTSS---YGYG-------YGRGYGYS----AYRYGYAQGQSGSRKKSK
F0RTV6          LIGFVFNGVLPGSSSS---YRYG-------YGKGYGYGYGHYAYRYGYAQGQGNARKNSK
                : * :: *      .                .             *              

A0A2N1RHF1      ASQSTKVRSSYRQNFLKDLKRREKSRNLG-------------------------------
A0A2N1RZJ4      ASQSTKVRSSYRQNFLKDLKRREKSRNLG-------------------------------
A0A3D1WX44      ASQSTKVRSSYRQNFLKDLKRREKSRNLG-------------------------------
A0A2N1SPK0      ASQSTKVRNSYRQNFLKDLKRREKSRNLG-------------------------------
A0A3C1LV35      ----------YKIIYKKEIQHRSEVRHGNREPVLAF------------------------
A0A1V5RSB2      ---RRRTASWYRKRYKQDVKIRGKLPA-LFTPVRAFGPHAPYMNLKEMEEKNNGNGEEKL
A0A521IS38      ---RRRTASWYRKRYKQDVKIRGKLPA-LFTPVRAFGPHAPYMNLKEMEEKNNGNGEEKL
G8QXQ5          SNYKIQNSSGYRKKYRQNIRQRDNQKLDLSDTVLAFGPQSYCHSLHEWGDVQ--------
A0A372MIZ7      HQVRKRSNGWYRKMYKRDVKNRGKLSQEQFDAVLAFGPDSPYATIADWVEAE--------
A0A356E0K2      ANIRRRSTSWYRKRYKLDLKDRGKINSEQFEPVLAFGEHAEYRTLEAWAGEH--------
A0A3C1ZMS7      ANIRRRSTSWYRKRYKLDLKDRGKINSEQFEPVLAFGEHAEYRTLEAWAGEH--------
A0A375AMC2      SHSRRRSTSWYRKRYKQDLRNRGKISSEQFDPILAFGEHAEYRTLEAWAQEH--------
F0RTV6          GHMRRRSTSWYRRRYKLDLKNRGKITTEQFDPVLAFGEHAEFRTLEAWAQAH--------
                          *.  :  ::. * :                                    

A0A2N1RHF1      ---------TATPIHPFIDKRDPFLDDDHSSKPISNILRKKVD-------------DGNR
A0A2N1RZJ4      ---------TATPIHPFIDKRDPFLDDDHSSKPISNILRKKVD-------------DGNR
A0A3D1WX44      ---------TATPIHPFIDKRDPFLDDDHSSKPISNILRKKVD-------------DGNR
A0A2N1SPK0      ---------TATPIHPFIEKRDPFQDDDHSSKPISNILRKKIE-------------DGNR
A0A3C1LV35      ---------AGGAENAFTGSQSAKAGNVSQVLKPEAKPAQKSS--------AKPSGTKMS
A0A1V5RSB2      IFKPVASGDAGSRSKEVAEKRDETGAEKSVFTPAAFKDTPKHP-------------MTED
A0A521IS38      IFKPVVSGDAGSRSKELAEKRDETGEEKPVFTPAAFKDTPKHP-------------MTED
G8QXQ5          ---------HFNPVTGIGPQHNA-------------------------------------
A0A372MIZ7      ---------RENGKTKPNETRQT------EVPSAKQEDPRPSS-------------DPVE
A0A356E0K2      ---------ATTHSTVFPEARTS---GFTDSPAAKVEEKPVVQ------------PVQDA
A0A3C1ZMS7      ---------ATTHSTVFP------------------------------------------
A0A375AMC2      ---------ATTHSTAFTEARTS---VFADLPPSKVESKPASP-------QQKPKADLPV
F0RTV6          ---------ASTHSSAFFEAKASPSVASQSAPVVQVEEKSATPAVPVAPKQSEKPAKKAN
                                                                            

A0A2N1RHF1      AYADLLAAIEDDPRATGRIEE-
A0A2N1RZJ4      AYADLLAAIEDDPRATGRIEE-
A0A3D1WX44      AYADLLAAIEDDPRATGRIEE-
A0A2N1SPK0      DYEDPLAAIEDDPRATGRIEE-
A0A3C1LV35      AAEKKTSDMLADIEKIYRK---
A0A1V5RSB2      KVIDFLSAIEGDEAARGKK---
A0A521IS38      KVIDFLSAIEGDEAARGKK---
G8QXQ5          DFKDGLEAIENDLESIGKL---
A0A372MIZ7      QDLASLRDIENDADAAGKKRED
A0A356E0K2      VKHDGLGVIERDPDAVGKK---
A0A3C1ZMS7      ----------------------
A0A375AMC2      VELDGLGAIEKDPDAVGKKQEE
F0RTV6          VPFDSLSVIEMDELAIGKKQED
                                      

© 1998-2020Legal notice