BYKdb

Dataset for cluster cd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E9TE88      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      --------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFG
A3K8W7      MNMMDSRKFRRKRKPLTTETPSPQEDASKDMAPVPPL----------ETREERLARRARE
G7EJX6      ------------------MLLSPEEQAAQQMLSLVAVFNAKL--SIEPVRSTQLVKISFE
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      LTQ--------YAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTI
A3K8W7      EGEGQTRPDPDAARQARAREAARIAAAAARQKAEAESKAQADAQRRAEEQAHDEAEAEAQ
G7EJX6      SSD------------------PKLAALVANTVGEVYIESQMRAKMGITQQASNWLNTRLS
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      -------------------------------------MQESFSVTDQGKDTGILTLTLRG
G5Q4J0      -------------------------MSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTG
G5LQM6      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
G5SDT8      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
F3CAY9      NRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIED
A3K8W7      RQAEEQARAKAEAEAQRQAEEQAHAEAEAEAQRRAEEQARAEAEAEAQRQA---------
G7EJX6      QLRIQLDTSEQKLQAYREAQKLVDIEGIAGLVTQELEQMSQQLVVARNEKN---------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      EDPKHLEQVLDSISDNYLAQNIARQAAQDAKSLEFLNAQLPKIRSDLDLAEDKLNQYRRQ
G5Q4J0      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5LQM6      EDRDKIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5SDT8      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
F3CAY9      QDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTS
A3K8W7      -EEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAE
G7EJX6      -NLQSINRVISEYGNNNLELLGSMPEITSHKVVQDVKREVILVERKVSELSEVYGPKHPK
S9QRP1      ---------------------MAERRKFQRRKRRLSEDVAPETPIAEPRPEDRIDPAEPR
G8AU96      --------------------------MNLRRGVGELKLRIRDEVGKIQKGLDADLEVARI
A3W0H7      -------------------MKLKRHEEYMRRR----------------AARRAEMEAEAE
Q0FMP0      -------------------MTMVERRKFRRRNRNPIDDGPEEPPIEPLESRDRRLERRRA
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      KDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKS
G5Q4J0      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKA
G5LQM6      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKA
G5SDT8      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKA
F3CAY9      ARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQ
A3K8W7      ------------AQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAEAE-A
G7EJX6      ------------IISAKAELATVKTNLNKQIKG---LITGIEKELNRITRTVSALEADLA
S9QRP1      RPEQDL--------------------------------------------------RADV
G8AU96      REATLL--------------------------------------------------KSIA
A3W0H7      EDAAVL--------------------------------------------------HPNL
Q0FMP0      EDKAAL--------------------------------------------------AEET
F0G6H5      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      KLNQRVTAMPKTQQEILRLSRDVNSGQAVYMQLLNRQQELNIAKSSAIGNVRIIDNAVSQ
G5Q4J0      KLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ
G5LQM6      KLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ
G5SDT8      KLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ
F3CAY9      GLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTN
A3K8W7      EAQRQAEEQARTDAETEGRRRKLAEARQAAK--LRRAEEARRAAEADADDADDEDEDGTA
G7EJX6      KIRAEYQNITRKETQYNQLKREVETNRSIFNTFLSRSKETEVTSDFTSAAARFTDRAYAP
S9QRP1      EPAHRERA----QATMRRIADARRASEARLKAQQAHEAEKARAAEAAKAAEEDAARAAEA
G8AU96      DLQEQQKGIEATGIQLRDLERAADAHRTLYRSLAERYEQTMALKNTGALDAHLSAPALPP
A3W0H7      DWPDDEDSVLATVPELLNLPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP
Q0FMP0      AHAAEEAA------------RRSAEEQARQRAAEEARLQEQREAEAREEARRQTTAKREE
F0G6H5      -----MAVVAALLLGVLAAGAYLMLRQRFVGTVSDPGEIEWTTGLPVIATVPRGESPRLA
Q74BQ8      -----MSRIEQALEKAAMLRG----------TTDRGQAVAPRQMEDLQPLERAELPPLPA
F0JCB8      -----MSRIEDALKKASEKRDENRRREPETVPSVEPVAAPVMEAASPVDASLDFSPLQSD
Q314L3      -----MSRIEQALARARKDKEHNAEDTPPR-PAGGGGAPSGVPHTPAEDSGGPAGPLPAP
B5EA81      -----MSRIEEAMEKAARMRN-GMEPPPPE-SVREPAGASALPPQTPQPVGSPALPPQPP
C6DZX5      -----MSRIEEAMEKAARMRQ-GMEPPPPG-AAPQSAGNSALPPQTPQPVVSPALPPQPP
A1ARV8      -----MSRIEKAMERAAQVRN--------------SAGVMRQPQETAARSGMVHTAPLPD
I5B296      -----MGKIFKALEKAGNKVTA-------------EKESELRDDTALVCDNPDSQVYKQS
H8YYB9      -----MERIKQALERARAERAA---AQLADVPVLSTQKVIAQEQETKPAGPGVQVSYTET
G7QCG1      -----MSRIEEALGKAAERQAG---MPRPEARLFFRQEATLPPP----------------
I2Q341      -----MSRIEEALGKAAERQAG---MPRPEARLFFRQDAPLPQP----------------
C7LPS3      -----MSRIEEALAKAAGMQSG-------------------LHSKGNRAGVSGIARAPMG
C0QCJ2      -----MGKIFKALEKSKEIDMGDSAVVENDSREDDLQDDTAGEENSRGDESPETGAHVQE
Q39U17      -----MSRIESILEKAAKMRQDKTPG----------ESRVLVEQREVPRAVIEPEVFQPD
B9M2X6      -----MSRIEEALEKAAKMRGTDGKAAL--------GKVPGSPLAVAHGSVHAYQQPMPN
A5G424      -----MSRIEEALEKAARLRSS--------------ERSNVTVGKTVATAVHVPPLPSSP
E8WSZ5      -----MSRIEMAMEKAARLRENGGQTPAQDQAQARPDTATAAAAPRAREAERVPPVVPAG
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      -PKPVKPKKILVLAVGFVLGLIVSLSLVFSRIFLRRGIE-SPEQ-------------LEE
G5Q4J0      -PGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIE-SPQV-------------LEE
G5LQM6      -PGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIE-SPQA-------------LEE
G5SDT8      -PGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIE-SPQA-------------LEE
F3CAY9      VEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIE-SAEV-------------IES
A3K8W7      -EQADTPVARPAPAMPTLALTPEQRSPAADQTPLPQSTRLQTDT-------------AWR
G7EJX6      -NKPSKPNKKLIVVLAFVASFGFAIVMSFVFDALNDTAKTKNDV-------------EGK
S9QRP1      -AREAEAERKADAARTAAAEQAAEVARQKNAAREAEAAQEAARAAEQADQEAAVAHDPEP
G8AU96      -IRPAFPQLRMSLGVGLVGSTALAVALVLLLERLSSGLRTPTQV-------------ERA
A3W0H7      -EPEPEPEPEP--------------------EPEPEPEPEPEPE-------------PEP
Q0FMP0      -IRKRLRVHDG--------------------DKVTAPATASAPV-------------EAE
F0G6H5      ---------------------------------------------------------G--
Q74BQ8      ---------------------------------------------------------EP-
F0JCB8      ---------------------------------------------------------CLD
Q314L3      ---------------------------------------------------------RVA
B5EA81      ---------------------------------------------------------QIP
C6DZX5      ---------------------------------------------------------QIS
A1ARV8      ---------------------------------------------------------MV-
I5B296      ---------------------------------------------------------DEV
H8YYB9      ---------------------------------------------------------RSL
G7QCG1      ----------------------------------------------------------SQ
I2Q341      ----------------------------------------------------------SQ
C7LPS3      ---------------------------------------------------------EST
C0QCJ2      ---------------------------------------------------------DPQ
Q39U17      ---------------------------------------------------------TRI
B9M2X6      ---------------------------------------------------------ERL
A5G424      ---------------------------------------------------------AAA
E8WSZ5      ---------------------------------------------------------QAL
                                                                        

E9TE88      ------------------------------------------------------------
F4SM97      IGINVYASIPVAE-----------------NSV-----KKASQIKRFKQKAEKEYTTFLF
G5Q4J0      HGISVYASIPLSE-----------------WQKARDSVKTIKGIKRYKQ------SQLLA
G5LQM6      HGISVYASIPLSE-----------------WQKARDSVKTIKGIKRYKQ------SQLLA
G5SDT8      HGISVYASIPLSE-----------------WQKARDSVKTIKGIKRYKQ------SQLLA
F3CAY9      LGMPVYASLPHSR-----------------QQE-----RLEKRDQDSKD------SRLLS
A3K8W7      -------DLPVAR-----------------FEL-----SQLNRHRVVTA------DRL--
G7EJX6      LAQRMLGLLPHVK-----------------LPK-----NSVFPIHAYLD------ENY--
S9QRP1      DADGAAPAAPTQAEAPVAKNSARGTTTADPWDALRSISVDERQLDRNRV----------I
G8AU96      TGVPCLGMVPSLPRNEAT------------W----NLPLHPDS-RRARE----------I
A3W0H7      VVASDVAPEPTPAPPPLL------------WPALRRVVLDPKHLAMHRL----------I
Q0FMP0      TAPAQAPRSPARKPTP-L------------WHRLQEFTVNPRHLERHRI----------I
F0G6H5      -----ADARNRPH------------------------------------------ASAAS
Q74BQ8      -----LEGIRHDN------------------------------------------PLLAT
F0JCB8      --------RARQQ------------------------------------------RMLVA
Q314L3      -----AARQVRLS------------------------------------------PKLVT
B5EA81      AVSPQYGRLAPQN------------------------------------------PFLVN
C6DZX5      PVSPQYGRLAPQN------------------------------------------PFLVN
A1ARV8      -----VNKVMSDD------------------------------------------PLLVS
I5B296      T----QSGSRRTD------------------------------------------SALVT
H8YYB9      S----LDPEQLRA------------------------------------------KR-VL
G7QCG1      A----IDPARLSE------------------------------------------EKLVV
I2Q341      A----IDPARLSE------------------------------------------EKLVV
C7LPS3      S----VGGVRLAE------------------------------------------ETMVV
C0QCJ2      T----IELPQSLD------------------------------------------KSLVT
Q39U17      A----VDNP-----------------------------------------------YLVT
B9M2X6      K----VKNP-----------------------------------------------LVVS
A5G424      K----IENP-----------------------------------------------FIVT
E8WSZ5      S----PQNP-----------------------------------------------FLVT
                                                                        

E9TE88      ------------------------MMQAQNNVL-MMTGVSPSIGKTFVCANLAAVISQT-
F4SM97      IENPADLAIESIRGLRTSLH--FAMMEARNNIL-MISGASPNAGKTFVSSNLAAIIAQTG
G5Q4J0      VGNPTDLAIEAIRSLRTSLH--FAMMQAQNNVL-MLTGVSPSIGKTFVCANLAAVISQTH
G5LQM6      VGNPTDLAIEAIRSLRTSLH--FAMMQAQNNVL-MLTGVSPSIGKTFVCANLAAVISQTH
G5SDT8      VGNPTDLAIEAIRSLRTSLH--FAMMQAQNNVL-MLTGVSPSIGKTFVCANLAAVISQTH
F3CAY9      IAAPGELAIESLRSLRTSLH--FAMLEARNNVL-MISSPTPGAGKSFVSSNLATIIAQTG
A3K8W7      -----DPAHATFDVLRTRLM--HTLSERGWKRV-AVTSPGKGCGKTFTVANLAISLSRQE
G7EJX6      -----RRFAESVRTFRTSLL--LTQLERDLKVI-AVTSSSPGEGKTTTSANLAMSLAQMG
S9QRP1      TAGRHDPAHTAFDVLRTRLL--QALAEHGWTRV-AITSPTKDCGKTFTAANLAISLSRQE
G8AU96      GAFRE-----AIQTVRTMAC--MPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGL-
A3W0H7      SATREDPAHVAFDVLRTKLL--AALRANGWHRV-AITSPSPDCGKSFVAANLAISLSRQS
Q0FMP0      TAERQDPAHAAFDVLRTRLL--QALAERGWTRV-AITSPTKDCGKTFTAANLAISLSRQQ
F0G6H5      RGGLADPAIESLRNFRTTLQ--LSLPDAPNRIV-LISGPTTGVGKSYIASNLA-ALAAAA
Q74BQ8      LNDPHSYVSEEYRKLKSAIVA-GTSVGEFRNTI-MITSTLGGEGKSITALNLAITLAQEY
F0JCB8      MNEPISLAAEEFRKLKQSLVR-KTKREGFQNTI-LVTSGTVGEGKSVTAVNLAISLAQEF
Q314L3      ATAMQSGLSEEYRKLKERLVK-LTKRSGFQNML-MVTSALSREGKSLTSANLAISLAQEF
B5EA81      LHDPHSPAAEEYRKLKSALVK-MTTGDVFRNCL-MVTSSIPSEGKSLTALNLALSLAQEL
C6DZX5      LHDPHSPAAEEYRKLKSALVK-MTTGDVFRNCL-MVTSSIPSEGKSLTALNLAISLAQEL
A1ARV8      LNDPASPVAEEYRKLKAILVK-MTSVHPFKNVL-MVTSAIPNEGKSLTSLNLAISLAQEY
I5B296      ASDPHSPVSEQFRLLKNNIL--FPEKGTPPKTI-MVTSASPHEGKSFVAANLAVSIAQSI
H8YYB9      LNEVRSPIVDAYNVLRTRILQRLR--ANAWNAV-AITSPRPGCGKTLTSINLAISLAREV
G7QCG1      LKSPASPEAEEFRKLKEALVKAIRDPDNFNNII-LVTSAHHGEGKSLLVVNLAISLAQEF
I2Q341      LKSPASPEAEEFRKLKEALVKAIRDPDGFNNVI-LVTSAHHGEGKSLLVVNLAISLAQEF
C7LPS3      INAPLSPMAEEYRKLKEALVK-MTKRERFDNLI-AVTSSTAGEGKSMTAVNLAASLAGEY
C0QCJ2      HLKPHSSEAEQFRILKTTIL--FPKTGIPPRTI-MVTSTAPGEGKSFVASNIAISIAKSI
Q39U17      ISEPRSPVTEEYRKLKSIILK-LTNSGQFKNTI-MVTSAVSGEGKTITSINLAVALAQEF
B9M2X6      VTAPQTSVAEEYRKLKSLLVK-LTNGDRFRNTL-MVTSAFASEGKSITAINLAVSLAQEF
A5G424      VNDPHTPAAEEYRKLKSILVK-LTKGEHFQNTL-MVTSSVGSEGKSLTALNLAVSLAQEY
E8WSZ5      ILDPHSQAAEEYRKLKSMLVK-LTDGENFKNAV-MVTSSVPNEGKSLTALNLAVSLAQGL
                                            :  ::.     **:    *:*  ::   

E9TE88      NKRVLLIDCDMRKGYTHELLGTN-NVNGLSEILIGQGDITTAA------KPTSIAKFDLI
F4SM97      K-KVLFIDTDMRKGYTHKLFNKNNENG-LSDVLSGKIAFEKAI------KQIDTCGFDYI
G5Q4J0      K-RVLLIDCDMRKGYTHELLGTNNVDG-LSDILAGKGEIASCA------KPTAIANFDLI
G5LQM6      K-RVLLIDCDMRKGYTHELLGTNNVDG-LSDILAGKGEIASCA------KPTAIANFDLI
G5SDT8      K-RVLLIDCDMRKGYTHELLGTNNVDG-LSDILAGKGEIASCA------KPTAIANFDLI
F3CAY9      R-RVLLIDADMRKGYLHRLFGLQPKHG-LSDTLAARLRCTEVI------HQTRVRHLDFM
A3K8W7      NTRTLVMDFDMRRPSLHRVLGVDSPGP-IGDVLRGKLAPEDHLIRLGENDFNAGHNIAFG
G7EJX6      --KVLIIDGDLRKPSIAKRFDIPVFHPGLSNLIVGTEELTECV------HIDEQSGVAIM
S9QRP1      NCRTLLLDCDLRRPSLHRVLGVEPPGA-MGDMLRGVVPPEQHMLRMGPNTIHAGHNIAFG
G8AU96      GLNTLLIDADFRRPSIAKLLGYQPHGS-VADLLDGRVGIDDLIHQETTNLGVLGNAVG--
A3W0H7      SVRTVLMDMDLRRPSLAHTLGQPDPGR-MAGFLSGDLPLERFLACPEDNPLHIGQTLAMG
Q0FMP0      NCRTMLIDCDLRRPSLHKVLGVKNPGS-MGDVLRGLVPPEDHLIRMGENEIHAGRNIAFG
F0G6H5      SQRVLLIDADLRKGALHDHFRYS-RAPGLSDVVMGTHRLDEAL------KRDVRPGLDFL
Q74BQ8      DNTVLLIDADLRKPMTAQYLGIP-GERGLSEYLSVGAHLPELL------VRTGIGRLSIL
F0JCB8      DHTVLLVDADIRSPSCHELLCME-NGYGLSDCLVDGSPIGKGL------VKTGIGKLSFL
Q314L3      DHTVLLIDADLRGPTCHELLGVA-RTPGLTDCLLDGTDVGEAL------VPTGLGRLSFL
B5EA81      DHTVLLVDADLRRPSVHRYLNVE-QGVGLSELLTGEAQVGETI------IPTGIGKLSII
C6DZX5      DHTVLLVDADLRRPSVHRYLNVE-QGVGLSELLTGEAQVSETI------VPTGIGKLSII
A1ARV8      DHTVLLLDADLRRPSLHRYLNIE-RNVGLADCLTRGVDLGEAI------IPTGIGKLSVV
I5B296      DEYVLLMDCDLRSPTIHTSFGYSGKEQGLSDYLAKNIPLSSVL------KKSSVNKLTIL
H8YYB9      NQTVLLVDLDLRRPSVIRYFTDA-DLPGVSDYLLEQRELAEIL------VNPGIERLVLL
G7QCG1      DHTVLVVDADLRAPTCHRYLEVA-PERGLSDCLLDGLDVGQAL------INTGIGKLVLL
I2Q341      DHTVLVVDADLRAPTCHRYLEVA-PERGLSDCLLEGLDVGPAL------INTGIGKLVLL
C7LPS3      DHTVLLVDADLRRPAVHKYLGLG-SCKGLSDCMREGLDVGELL------VKTGIGKLSVL
C0QCJ2      DEHVLLIDCDLRLPSLHTRFGFS-DIPGLSEYLRAGKSLGSIL------RKTAIDKLSLL
Q39U17      DHTVLLVDADLRRPGTSSYLGIR-AEVGLSDCLYGKVDVKDAL------VKTGIGKLVVL
B9M2X6      DHTVLLVDADLRKPSIHKYFGFE-PKLGLTDCLTRGIDVGETL------IKTGIGKLSIL
A5G424      DHTVLLVDADLRKPSIHQYIGLD-PKVGLAECLLDGVDVGEAI------VNTGIGKLSVL
E8WSZ5      DHTVLLIDADLRRPSLHDYLEIE-PGAGLSDILKGEADIGETI------VQTGIGKLAVI
               .:.:* *:*       :        :   :                       .   

E9TE88      PRGQVPPNPSELLMSERFAELVNWASKNY--DLVLIDTPPILAVTDAAIVGRHVGTTLMV
F4SM97      SRGSVPPNPAELLMHRRLNELLIWANSQY--DIVILDTPPILAVTDAAIIGQYVGTTLLV
G5Q4J0      PRGQVPPNPSELLMSERFGELIAWASSRY--DLVLIDTPPILAVTDAAIVGRHVGTTLMV
G5LQM6      PRGQVPPNPSELLMSERFGELIAWASSRY--DLVLIDTPPILAVTDAAIVGRHVGTTLMV
G5SDT8      PRGQVPPNPSELLMSERFGELIAWASSRY--DLVLIDTPPILAVTDAAIVGRHAGTTLMV
F3CAY9      SCGFAAPNPSELLMHDNFNKMLAELSPLY--DLILIDTPPILAVTDATLVGRQAGTCLLV
A3K8W7      LNTVTEAYASELLQDPRTRVTLDRIEEELRPDVVLFDLPPALSYDDVIAFQPLFDGVLLV
G7EJX6      PSGQIPGNPLELLSNIRFSELLELLKAKY--DHIIIDTPPTQAVSDALVIAQSADSVIYV
S9QRP1      FNTESEPYASELLQDPRTAATLDDLQTRFAPDVMLFDLPPALFYDDVIAFRPLFDGVLMV
G8AU96      -----TPDAHDRISSQAMSDLIQWARHNY--DVVVIDSAPVMLFSDALALSFLADSVIYV
A3W0H7      LNDRAEPYAAEILHAPETGEVLQDMYRRLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIV
Q0FMP0      FNGTVEPYASELLQSPQSRTALRHIEDEFAPDVMLFDLPPALYYDDVMAFRGQFDGVILV
F0G6H5      SMGSIVADPGEVLLQPALAELIERLSSQY--RMIVIDGSPLLPVTDGLALGRLAGIVFLV
Q74BQ8      PAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFV
F0JCB8      SAGSPVPNVGELLASKRMAESLAEMKNRYADRYIIIDSPPVLPFAESRNLSRLADGVVLV
Q314L3      PAGRAVPNPGELFASTMMQDLLLQMKHRYTDRYLIIDTPPVLPFSETRSLSRVVDGVVMV
B5EA81      RAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVDGVLFV
C6DZX5      RAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVDGVLFV
A1ARV8      TAGCAVSNPAELLSSARMKTFVEEIKHRYTDRYIIFDTPPLLPFAETRSLAHLVDGVVFV
I5B296      PAGQIPPNPSELLSSDQMRRLLHEVKLRYNDRYIIIDTSPPYITSETNAIARFVDGIILV
H8YYB9      PGHSSFTNSSEMLSTPRMVRLVTELKTRYPDRIVLFDMPPLLAGDDVLAFSPYIDAIMLV
G7QCG1      PAGKAVKNPMELLSSNSMRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLV
I2Q341      PAGKAVKNPMELLSSNSMRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLV
C7LPS3      PAGTPTPNPVELFSSDAMRSLFREMKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILV
C0QCJ2      PAGKPPANPSELISSEQMRRLLQEVKGRYEDRYIIIDSPPPYLTAEANALARQVDGIIIV
Q39U17      PAGSRVENPVELLSSGRMQSFIAEIKNRYPDRYIIIDTPPLLSFAETYSLANMVDGVVFV
B9M2X6      PYGKKVENPGELFSSSKMKSLIAEIKSRYPDRYIIIDTPPVLLFAETRTISTIVDGIVFV
A5G424      LHGKTIRNPAELFSSLRMKELVKELKHRYPDRYIIIDTPPVLPFAETRSISTLIDGIVFV
E8WSZ5      RSGSQVENPVELFSSQKMRALVDELKRRYPDRYLIFDTPPVLPFAESRALANIVDGTIFV
                      : :        .           ::.* .*     :   .    .  . *

E9TE88      ARYAVNTLKEVETSLSRFEQNGIPVKGVILNSI--FRRASAYQDYGYYEYEYKSDAK---
F4SM97      VRFEQNTVKEIEVSFKRFEQSGVTVKGCILNGV-IKK-ASSYYGYGYNHYGYNYGEDK--
G5Q4J0      ARYAVNTLKEVETSLSRFDQNGIQVKGVILNSI-FRR-ATGYQDYGYYEYEYQSDSK---
G5LQM6      ARYAVNTLKEVETSLSRFDQNGIQVKGVILNSI-FRR-ATGYQDYGYYEYEYQSDSK---
G5SDT8      ARYAVNTLKEVETSLSRFDQNGIQVKGVILNSI-FRR-ATGYQDYGYYEYEYQSDSK---
F3CAY9      ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAV-VRKATTSDYDYAAYGYNYHPAPR---
A3K8W7      VGGGLTTEREVKE-VERRLGTETPLLGMILNKA-E---GVDVERYAY-------------
G7EJX6      VKSDVTRIKPIKAGIERLFESKAHVAGIVLNQV-DMSKSNDEHSYGYYDYHDYSQKPEQP
S9QRP1      VGGGITTEREVREVERRLGD-STPLLGTVLNRA-E---DTQIRKYSY-------------
G8AU96      VRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRV-V---ASKHVKYGHKDDAYYYALHAPA
A3W0H7      VGGGRTTARHLRDLKARFGT-DTPLLGVVMNRA-E---GESIAKYGY-------------
Q0FMP0      IGGGITTEKEIRETQRRLGD-DVPLLGTVLNKA-E---GSKIRQYTY-------------
F0G6H5      ARSGVTTLTEIDESVRRLQDVQVDVRGVILNDF---------ARGPGHGYGYGNAETHQA
Q74BQ8      VREGQSSLANIDEAISALNRKK--ILGIVFNEASAVGISS--------KYGYGYGYGGYG
F0JCB8      IKEGQASQADLRDTIEALQGSN--ILGAVYTQASRMHRSLNADAYMKYKYYHYAS-----
Q314L3      VRENVATMEDLRESLEALEGAT--MLGVVYNNARSGGGRRG-------RYGYGYGYGGY-
B5EA81      VMERLVSQANLKDALESLKACP--ILGMVYNAA-AVDDKDG-------RYSYYRS-----
C6DZX5      VMERLVSQANLKDALESLKACP--ILGMVYNAA-TVDHNDG-------RYSYYRS-----
A1ARV8      VKEQTATKDNVSDAIEALKGAD--LLGIVYNDT-TITQNVE-------RYYSYRSYAAVS
I5B296      IRHGKTRIKEVLDILDIYGREK--VLGVVTNFS-KKTI--------GYGYGYHKSGYGYG
H8YYB9      VEAGGTTRDDLRRAWNLLGGKR--ILGVVLNKA-DGDSSGD-----GYY-----------
G7QCG1      VREGKTSLEDVQESLTLL-NNK--VLGLVYNAT-DYVKPCS-----SYYSSYYAACND--
I2Q341      VREGKTSLEDVQESLTLL-NNK--VLGLVYNAT-DYVKPCS-----SYYSSYYAACND--
C7LPS3      VKEGMPSLEQIEEAIDALD-QK--VLGIVYNGA-HLQS--------RSSYYYAE------
C0QCJ2      VKAGKTKRSDVQDLIDTYGKEK--ILGVVKNFA-------------DARHGFKKYEYK--
Q39U17      VKEGGATMSNVKDALGHLKKEK--VYGVVYNNV-GINRFDENYRYRNYYAYYKDNGAQ--
B9M2X6      VKEGAASVKEVNDALTALDKSN--LLGIVYNET-VNENLNGHY---HDYYQHKQYAW---
A5G424      VKEGAASLNDVSDAIAALKGTN--LLGIVYNEA-SIDGFNDRY---NYYYRYDAEKW---
E8WSZ5      VRERLATQAEIKEAYDHLKGSG--VLGVVYNAA-DAAAGDESL---SYYKHYQKTPAA--
                      :             : * : .                             

E9TE88      ----------------------------
F4SM97      ----------------------------
G5Q4J0      ----------------------------
G5LQM6      ----------------------------
G5SDT8      ----------------------------
F3CAY9      ----------------------------
A3K8W7      ----------------------------
G7EJX6      TA--------------------------
S9QRP1      ----------------------------
G8AU96      RH--------------------------
A3W0H7      ----------------------------
Q0FMP0      ----------------------------
F0G6H5      ASGYAGMMAHRPAGAGGKGDR-------
Q74BQ8      PSAEPAEARSTAEKTGKLSRILGKRGSK
F0JCB8      ----------------------------
Q314L3      -GSGA-----------------------
B5EA81      -ADNA-----------------------
C6DZX5      -ADNA-----------------------
A1ARV8      PGESA-----------------------
I5B296      YHQQR-----------------------
H8YYB9      ----------------------------
G7QCG1      ----------------------------
I2Q341      ----------------------------
C7LPS3      ----------------------------
C0QCJ2      ----------------------------
Q39U17      ----------------------------
B9M2X6      ----------------------------
A5G424      ----------------------------
E8WSZ5      ----------------------------
                                        

© 1998-2020Legal notice